Home

Digital Flexo Suite for Flexible Packaging 12.0 User Guide

1. 1 0 Left Inner Border Right Inner Border 1 0 Right Outer Border e zj CH zj 2005 gt gt z ER OK Cancel mm rivatx Hit dat Mixt ats di DR d Ha AT EA Ha Uh Vogurtiid fbr stagger fitsheet vlen Vogurtijd fbr staqger fitsheet v len Enlarge the bear bars until no other elements are visible 2 By left clicking on the icon for automatic detection the image section is analysed and the detected area is displaved in green 3 BV right clicking on the green area a new window is opened in which the width of the bear bar can be changed asvmmetricallv The last changed values will be applied automaticallv Left Outer Border gt left bear bar left margin Left Inner Border gt left bear bar right margin Right Inner Border gt right bear bar left margin Right Outer Border gt right bear bar right margin Repeat this step for the second bear bar ESKOG Now you can enter the height of the bear bars in the Bar Height field These bars will always be arranged in the centre of the cut If the difference between Design Height and Bar Height is 20 mm the bear bar will be 10 mm longer at the top and at the bottom than the cult Staggered Cut s E ETTO TTA T TA T 2 T D pre MMIIM MM MM MTIM IM ee Ree ee
2. cdi 62 Idle m E CDI Sound B l Adress Mame cdi 6 1 Col 20 ci 20 G ee i e HIScreen cdi 55 gt Widget q Idle Preferences no jab cdi 50 me About mam FE no jab Help The CDI status is displayed with the following colours grey CDI or service is not activated e red CDI is activated and waits for jobs e green CDI exposes a plate The remaining time is displayed The CDI list of the Digital Flexo Suite is used automatically Right click on the CDI monitor to change CDI list under Preferences Fullscreen displays the monitor as full screen Widget removes borders and the monitor will always be displayed in the foreground ESKOO pE e 14 Support Europe To contact ESKO please visit www esko com ESKO
3. kd e POE EOS Goa poa DA oa ET ECET A AL o poa at ELET LOAN KO JALI O dass ptd POE KO KAT EGIT JA A EL LOAN ea a e Er a POET Isa quam ctt POS se fat BON atr fet To nnig 100 200 300 400 500 600 700 800 900 Testi 2540DPI K x 487 548mm_ y 905 777 mm The distance to the selected contour can be set in the Line Distance field ESKO mmm 9 4 Creating Lines de de se creates vertical and horizontal lines across the entire image height or image width using the left mouse button Line Distance 10 0 Test1_2540DPILK x 219 17 mm y 849 211 mm 9 4 1 Moving Lines Pa TT marks a line so it can be moved Y Position 449 502 mm Cancel The line can be moved manually using the left mouse button ESKOG Right clicking opens a new window in which the new position can be entered 9 4 2 Deleting Lines gt activates the marking function You can mark a line with the left mouse button and delete it using the Delete key on the keyboard ES Lu 2 x e 9 5 Deleting Several Objects marks several objects so they can be deleted By pressing and holding the left mouse button a rectangle is pulled across the desired objects Then use the Delete key on the keyboard to delete them You cannot delete individual lines from the contour recognition and from the rectangles The whole object is selected when marking it 9 6 Creating a Template saves the in
4. 0 100 Line to circle tolerance 4 ESKOG 11 5 Assignment of the Output Channels Each element in the ACM file is assigned to its own channel line The channels cannot be defined or hidden in the Digital Flexo Suite This has the advantage that the operator of the Kongsberg table can change the output quickly 11 5 1 Output Channels of the Merger The plate may be cut and labelled from the front A or back B The function Front Text can be used for front labelling FRONT SIDE A BACK SIDE B FRONT SIDE A Staggered Cut SN e Channel 5 Kiss Cut label Permanent ID e Channel 9 knife pen lines Staggered Cut e Channel 10 knife contour cut of Staggered Cut e Channel 11 knife cutting line of the image e Channel 12 knife Fronttext pen label e Channel 14 pen centerlines e Channel 32 NO TOOL Do not set any tools ESKO ESKO PLATEPATCHER Front Side A PLATEPATCHER Front Side A f Premount Patch Cut J Drill Channel 13 drill PlatePatcher Drill Channel 17 Bevel Knife 2 finishing cut at PreMount unexposed plate Channel 23 knife PlatePatcher register marks and text BACK SIDE B Line Editor Center Lines Channel 6 Kiss Cut and pen shortened Center lines Channel 7 pen Center lines Channel 18 knife pen lines Line Editor Channel 19 knife
5. MUIA Name Date Modified File and Folder Tasks fae Mowe the selected Rema OH Copy the selected kams Publish the selected output Dipptemp GEE CHIPS _Stack_v2_fbr_stagger_fitsheet_C gf E CHIPS Stack v2_Jbr_stagger _fisheet_C len Dee ftshent k d Te aner tibshe 29 07 2008 03 33 SOF 2008 12 37 ORK LES Zen SL OF 20S et 31 07 2005 23 27 A OF 2008 e327 Host 127 0 0 1 ems bo the Web 31 07 2009 23 27 CH E mail the selected TFT TT 31 07 2008 23 27 31 OF 2008 23 27 A Delete the selected CHIPS Stack v2 fbr stagger fitchest y len 31 07 2008 23 27 Working Folder Di FILES Plate Type other Loaded Images 4 6 13 Unique ID All LEN and or TIF files from an AE12 system contain a unique code which can be read by the Merger As soon as the Unique ID option is activated under Options Configuration this code is added to all images Depending on the output the code is either inserted at the top or in the left frame area as normal text or for XL CUT it is output as front text or back text ESKOG 6 14 iMask Output Option As soon as iMask output is activated a LEN or TIF file with the mask is generated in addition to the job An appropriate license is required to output TIFs Depending on the settings a frame is added to the contour compiling the various elements Workflow Displays the name of the parameter set Mask Export Folder Output directory Frame
6. OK confirms the input The new setting is automatically selected Adjust the required settings and save them by pressing Save 7 6 2 Changing Settings Select the setting 1 and change it Press Save to save the setting To not lose existing settings the new settings can be renamed by pressing Save as 7 6 3 Deleting Settings select the setting 1 and delete it by pressing Delete 7 6 4 Possible Settings Register Mark The register marks for later alignment on the Kongsberg table can be selected from a list An overview can be found in the appendix Knife Type Thick plates are often cut at an angle of 45 For this purpose select BevelKnife Depending on the plate thickness an additional frame is put around each image except for images from the PlatePatcher Plot PreMount For PreMount this option is controlled automatically Po lt o Knife gt BevelkKnife Safe Distance The distance between the cutting lines can be specified to avoid double cuts Cut Gap A base area that cannot be cut can be selected close to the corners to prevent parts of the plate coming loose during cutting Reserved Area Sets the width of the reserved area in which the marks for setting up and labelling of the plate are positioned MAT Info As an option the name of the XL Guide Job Setups which will be automatically loaded on the Kongsberg table can be entered in this field 4 Point Registrati
7. disabled UAC User Account Control FTP server installed and enabled Only in combination with Grapholas version 11 and below Grapholas 7 5 on the CDI The following configuration is recommended The index and file names may not include special characters umlauts or spaces An underscore is the only permitted special character and can be used as a substitute Intel 7 processor 8 GB RAM Hard drives 512 GB SSD 1 GB network board Microsoft Windows 7 64 bit disabled firewall and user account control UAC Grapholas 12 0 on the CDI for a space ESKOG 2 Digital Flexo Suite Service After the user login the service for the Digital Flexo Suite is started automatically The following programs must be enabled e gravurd e cmotsim The status of the DFS service is shown in the Windows taskbar Only in exceptional cases the service is disabled or faulty AN Service enabled Service disabled Service faulty In addition an http server is installed on port 5580 as a service as of version 12 ESKOG ee 3 First Start up of the Software LEN and TIF files are prepared for exposure on a CDI using the Merger lt positions the images on the printing plate and can also rotate mirror crop and invert the images as required several CDIs can be controlled via the network simultaneously XL CUT generates cutting files so that the generated plate can be cut automatically on the Kongsberg table
8. object contour Line Editor Channel 21 knife pen rectangle around object Line Editor Channel 22 knife No Tool image border Line Editor e e e Channel 8 knife Microcross from front side e Channel 8 Kiss Cut and pen Microcross from the back e Channel 20 drill Digital Video Drill 11 6 Aligning the Plate on the Kongsberg Table The positioning marks are normally on the operator s side 1 2 Only if the alignment Vertical Landscape has been deactivated the positioning marks are on the right hand side 3 When activating the 3 point registration a third positioning mark is placed on the opposite side The text for identifying the plate is always located between the first two marks lf the X Mirror X or Y Mirror Y option for back labelling has been selected in the Merger the plate is rotated accordingly As cut optimisation cannot be used for the 45 Knife the plate should be fixed to the table as an additional measure To achieve a clean cut this knife requires a special set up ESKO O x ESKO x el KS EE on nn on es T e in gdeid fie Start Pouton Temgiste Widows Optom Heip s t o ho A xhar d Gi Most 127 Epose ug 11 7 Starting the Job When importing the ACM file the setting is automatically changed to CTP Flexo Here the regis
9. 0 5 mm 5 mm x 5 mm 0 2 mm 5 mm x 5 mm 5 mm x 5 mm 10 mm x 10 mm 5 mm x 5 mm 5 mm x 5 mm 5 mm x 5 mm 5 mm x 5 mm 5 mm x 5 mm 5 mm x 5 mm 5 mm x 5 mm 5 mm x 5 mm 0 3 mm gt lt 0 1 mm gt lt 0 1 mm lt 0 2 mm ee 0 3 mm lt 05mm gt lt 1mm gt lt 1 5 mm gt lt 2mm lt gt 15mm gt lt 15mm men 7 9 Recommended Settings in XL CUT e The plate can be set up on the Kongsberg table more easily with vertically arranged positional markers Align Vertical e For small plate pieces a Cut Gap of 0 5 mm is recommended so that the plate pieces are not triggered automatically e The marks reg 502 c 1nd reg 503 c are suited for positioning using the laser pointer on the Kongsberg table EK 8 Staggered Cut Option opens a new window in which the cutting line can be created Cutting lines created by Plato cannot be edited with Staggered Cut in the Digital Flexo Suite Staggered Cut 8 1 Toolbar The toolbar is always located on the right hand side Only available functions are activated ESKOS EM Individual sections of the image can be enlarged with a square magnifier by using the mouse wheel or by holding down the left mouse button and pulling the mouse across the section of interest The magnified image section can then be positioned using the arrow keys on the keyboard The image section can be zoome
10. Size of the extension frame Apply to White ikali Resolution Output resolution V Negative Apply to White White pixels are expanded Tiff Output Activates the TIF output Negative Allows to invert the output Mirror Allows to mirror the output Changes are saved by pressing Save New creates a new parameter set Remove removes the currently selected parameter set Close closes the setup window 6 15 Lenticular Output Option As soon as the Lenticular function is activated the output is converted into the required resolution and then sent to the CDI To achieve an optimum printing result the output is reprocessed on the CDI ESKOG 3 Allows to set the number of printing 1 Activates the Lenticular function 2 Allows to enter a new resolution This value may differ from the original resolution of the positioned images by a maximum of 50 DPI lenses used for To ensure an optimum printing result the correct number of lenses needs to be set The resolution results from the test print and the resulting change in the size of the image which is set via the new resolution The Lenticular output must not be used for normal jobs 6 16 Basic Merger Settings The basic settings of the Merger can be changed via the menu item Options Preferences Merge Folder Plugins Output Units mm File Copy Method Copy Move Bleed 0 0 Expose frames Archivin
11. Staggered Cut option creates a user defined cutting shape which then can be cut using XL CUT The Viewer is used to display and measure the LEN TIF files The angle and the rasterization can also be measured iMask option adds an adjustable frame to the output data and creates an additional LEN or TIF file Lenticular option adjusts the width of the job to adapt the data to the lens system for creating 3D images All important settings are copied over during an update When the software is being installed for the first time the output devices must be set up and the network settings must be set 3 1 Entering the License Key During initial installation or when updating from an older version the license key must be entered to start the Merger Warning License 2 Your copy of Grapholas has an invalid license Do you want to register now OK Cancel The ESKO Service provides a serial number for this ProductID which needs to be entered in the Serial Number field and confirmed by ENTER The license can be subsequently changed with the New License program in the Windows Start Menu under Esko Digital Flexo Suite system ESKO 3 2 Setting the Language In the Merger the language can be changed under Edit Change language CI A m Grapholas Language Language Selection Tool Language German English 3 3 Setting the Output Devic
12. Under Register mark input the From input file option 1 must be activated otherwise the plate cannot be cut correclly Under Transformation the Offset and rotation only option 2 must be selected to ensure that the cut is not distorted during the registration It is possible to register using the laser pointer or the camera 3 The cutting accuracy of the camera is higher ESKOS 11 2 4 Point Registration When selecting the 4 point registration in the Digital Flexo Suite the cutting file can be distorted differently in horizontal and vertical direction in order to compensate the distortion of the plate A current ACM file must be loaded from the Digital Flexo Suite before setting the registration options Otherwise the Different X Y scale option is not available By clicking on this icon a new window with the option to change the registration behaviour is opened Registration setup Find register marks by C Pointing with laser D i BBB From input file e Viewing with camera r Transformation C Offset and rotation only Register on e All sheets C Common XjV scale C First sheet only e Different X V scale Dee c e Under Register mark input the From input file option 1 must be activated otherwise the plate cannot be cut correctly Under Transformation the Different X Y scale option 2 must be selected in order to differently distort the cut in X and Y direction The reg
13. which has to be selected here using the Browse button Result Directory Optionally you can define a subdirectory in the working directory The files transmitted to the CDI are then saved in this subdirectory Input File Type With Grapholas Image you can choose only LEN only TIF or both file types EK 11 Kongsberg XL Guide If PreMount output or 6064 point registration is used at least XL Guide version 4 must be installed on the Kongsberg table lf an ACM file created with XL CUT or PlatePatcher in XL Guide is opened the global setting is automatically changed to Ctp Flexo The cut and sequence optimization is deactivated in this setting If set in the Digital Flexo Suite Job Setup is loaded additionally The interface of the version 6064 slightly changed It is no longer necessary to select the positions of the register marks Also the register wizard is summarised in one window in which the 3 point registration option can be set 11 1 2 Point Registration When selecting the 2 point registration in the Digital Flexo Suite the size of the cutting file may not be changed during the registration By clicking on this icon a new window with the option to change the registration behaviour is opened Registration setup Transformation de e Offset and rotation only Register on Licensing Al sheets ARS license Ce ale m je ommon X Y sc C First sheet only C Different X Y scale ces C s J o w
14. Arrangement File New Plate Ctrl n removes all images from the Merger and resets the parameters 6 4 7 Automatic Positioning of the Images Position Auto Arrange Images Ctrl a automatically positions as many loaded images as possible on the working surface Beforehand images which were already positioned on the work surface are removed The type of positioning can be selected in the Merger properties 6 4 8 Automatically Positioning New Images Position Auto Arrange New Images Ctrl h automatically adds the loaded images to the compilation on the working surface Already positioned images are not removed 6 4 9 Removing Images from the Working Surface Position Unplace all Ctrl u removes all images from the working surface The images are not unloaded 6 4 10 Displaying File Names Windows Display Names shows the file names in the images positioned on the working surface 6 5 Working Surface and Status Bar The working surface shows the available area on the plate It is not necessary to enter the upper and lower borders as the entire working area is shown The loaded images are pulled from the right queue on the working surface by holding down the left mouse button ESKO T sss F e Stat Poson Template Windows Options Help O Mn S tre Q wc Effective size 1189 078 821 356 mm 28 5 used 71 5 waste totai 1 598sqm waste 1 1445qm LG In addition
15. E DFH 1 70 day DFH635 UV Main Exposure UV Main Energy Using the right mouse button to click the plate entry displays information on the plate properties Only the plate types which fit the selected drum are displayed For more information refer to chapter Managing the Plate List 3 Selection of the required Kongsberg settings If activated a yellow bar is visible on the left or on the bottom in the Merger ESKO The cutting file for the Kongsberg is stored in the directory which was selected for this setting For more information refer to chapter Kongsberg Output XL CUT 4 Selection of the output device CDIs and TIF output devices are listed separately 6 3 11 e Expose 6 3 12 EK Displaying the Job List of the CDI Plate DPN 1 14 045 DPR 1 14 045 DFM 1 14 045 x DPN 1 14 045 DPN 1 14 045 s x k x DFH_67 Wa DFH_67 gt Sending a Job to CDI or Creating a TIF File opens a dialog window in which the job name can be entered By pressing OK the job is sent to the CDI or a TIF file is created in the output directory displays the job list of the connected CDI In the Action column the job can be deleted by clicking on the cross The job status is displayed in the Status column An explanation of the icons can be found in the Grapholas user manual 6 3 13 Cropping and Rotating Images 1 Automati
16. Fl Hofoldar iv RE Support Menge Options Image Manipulation i image Cropping Ie Step amp Repeat z Allow Preferences FF Load i Save Job el Allaw Overlay Partial Plate F Partal Plate Tools Is Staggered Cut iv Rotate Testiorm e Edit Working Fodder fr Partial Plate Database vi Line Editor Please restart the program after selection has been done NewPasswors Repeat Password 5 2 Changing the Password Left clicking on Change Password opens a new window in which the current password is entered once and the new password is entered twice Close confirms the input pss New Password i Repeat Password 5 3 Entering a Password to Change Settings Left clicking on Unlock opens a new window in which the current password is entered Close confirms the input and enables the input mask Partial Plate di Partial Plate Partial Plate Oatabase fel ina Enter el Lime eabar w Staggered Cut Please restan the program after selection has been done Cancel EK 6 Merger The Merger is used to load the image data from the local hard drive or from the network and to send it to the preselected CDI In addition simple tools such as mirror crop and rotate are available A description on how to use the functions XL CUT and Staggered Cut is provided in the chapters of the same name 6 1 Qu
17. H Knife lift angle U Rigid Material Knife 179 i gt Bi tege 1 Ink Tool 246 a mi s wires 12 MM E No tool Y More More V Notch W No tool Ignore 0 00 0 00 MM Perf pattern r cmo se 11 3 2 Setting the Bevel Knife 45 Knife Before using the Bevelknife 45 knife the option Single cut must be activated in Job Setup under Extended Setup as the step will otherwise not be performed properly The Knife speed for the BevelKnife should not exceed a value of 30 ESKO Job setup Job setup Board size Reverse score Iw Single cut Extended Knife lift angle cS f Lift angle 4 _ Use Defaut Default angle i E Pert pattern hi Test line 2 eee T No tool Ignore Gecke Sbaent om 0 00 MM Knife before crease coed se 11 3 3 Drill Setup In order for the drill to drill independent of the plate thickness to the table top the drilling depth must be limited by entering T 1 The speed should be set to 1000 2 Job setup Job setup Board size Cumerit job selup uma ai me Line Tool tan ay H i x Holon RI Ji TUB RE 724 ji 8 No tool E No tool PEEEE ala alla More fe Ma boo lge 11 4 Optimisation To use the cutting lines at best the Sequencing option should be activated in the XL Guide settings Optimization Iw Sequencing P P e r Normal Default
18. Jobs 12 4 1 Searching for a Job It is possible to filter the overview by entering text in the Jobname field Only jobs which start with the first letters of the entered text are displayed T Jobname Job Name i Plate Type DPS45 12 4 2 Sorting According to Availability When a plate type 1 has already been selected and the plate is to be filled with more images the overview can be sorted in that way 2 that it only shows jobs for the plate type currently set 3 ESKOG H Dr my l rdo ud H n Plate Frame Image Properties Repeat z Plate Type DPI Status DPI 1 14 e DPL 2 84 a 11 BE GE o EHA 25400 ODPN 1 14 a DPS45 4 W e E DPU 1 14 G DPU 2 84 FAH 1 14 OFAH 1 14 neu Plate Tvpe DPN112 Thickness 2 58 Edit Plate List 12 4 3 Sorting According to Plate Type By clicking on the column header Plate Type 1 the list is sorted by plate type DPN112 25400 By clicking on the column header Job Name 2 the list is sorted by job name 12 5 Sending JDF Files After sending a job all positioned JDF images are removed from the Merger This ensures that the images will not be sent again If the Merger contains images which are not positioned yet the plate type cannot be changed EK 13 Additional Programs With Digital Flexo Suite two additional programs are installed which can be foun
19. be opened Start in the Manual Step area 5 starts a simulation of the cutting and drawing process In the Settings area 6 the line thickness can be changed Additional information can be displayed in the View menu If the ACM Viewer of the Digital Flexo Suite is used LEN files can also be displayed Cutting information of Staggered Cut and CAD information of Flexrip are displayed in addition ESKO wd ACM iew D Bbsitest esl data Yogurilid thr stagger fhitsheet klen Fie View Help EJ D bstestiBSLidata test crop vmir tif Yogurtkd_ftbr sta er fitsheet mjen Yogurtiid_fbr_stagger_fitsheet_y Jen INFORMATION Programs 387 00 mm Height 479 49 mm Stag height 310 00 mm Stag shrink 0 00 mm MANUAL STEP 1486 1466 start autorun Using the function File Overlay File it is possible to place the according LEN or TIF file over the ACM file Holding the Ctrl button you can move the contour of the ACM with the left mouse button until both register marks are above each other Then you can check the cut Several LEN files are created when the output is performed on a CDI with ABS A revision of the images is no longer possible ESKOG 13 2 CDI Monitor The CDI monitor displays the current job the status and the remaining time for the current imaging processes of the CDIs in the network CDI Monitor cdi 70 Not Connected no job
20. guides can be pulled from the grey frame area by holding down the left mouse button The images cannot be positioned in the red area The guide can be removed again by clicking with the right mouse button on the grey frame area Using the right mouse button to click the image file displays information on the image The status bar shows the current settings and the number of loaded images 6 6 Displaying Plate Use Using the right mouse button to click on the work surface displays information on the plate size and the use of the plate The Partial Plate line shows the values for the marked area The Full Plate line refers to the entire work area 6 7 Managing the Plate List Selecting Edit Edit Plate List opens a new window where you can delete change and create new plates Cancel aborts the process no data is changed By pressing Quit the window is closed Next shows the next window EK 6 7 1 Creating a New Plate First select the desired medium Plate Type 1 then check New 2 and press Next 3 to go to the next menu Plate Sleeve Plate on Sleeve Steel Base Film e Plate Flexo Plates e Sleeve print sleeve of DuPont and Flint e Plate on Sleeve Flexo plates mounted on a print sleeve e Steel Base metal backing plate for magnetic drum e Film Film If Grapholas 10 1 or higher is installed on the CDI a plate database is shown Wh
21. in the basic settings of the Merger under Edit Preferences giving the plate more stability in the washer The left and the right border are now shown in white When the TIF output is negative the border is displayed in black EK Hp Em A A win D I Dee 127001 VW Do Weil woning Fotger C FILES sobname Mia Destin EI Piate Type G r 6 10 Templates If these functions are not displayed they can be activated in the basic settings The positions image sizes image resolution and plate parameters are stored in the template in order to position images quickly at a later time This working mode is interesting for register pinwheels such as e g for Letterpress 6 10 1 Creating a Template To create a template you first position the required images onto the working surface and then select the plate type This compilation is then saved by pressing Template Save Template 6 10 2 Loading a Template Template Use Template loads the template This is only possible when no other images are loaded in the Merger ESKOG The stored positions and sizes are shown as yellow fields After loading the images they can De positioned in the yellow fields The images must be within a certain size tolerance in order to be assigned to a field 6 10 3 Modifying a Template After loading the template and positioning all the images the mask can be opened using Template Edit Templat
22. labelling The text can be positioned at the bottom or on the left Mirror Plot Text As an option the labelling on the back can be output as a mirror image Translate Space The file name determines the labelling of the image If this function is active underscores are converted into spaces ESKO me e 4 Text Orientation Three positions on the left and lower side can be used to label the image On the back the text can be set to Center Bottom Left l u Bottom Genter Bottom Right F Left Top E Left Center k Left Bottom Center LI Center Vertical 7 7 Overview of Output Channels Channels provides an overview of the output channels All displayed channels must be set up on the Kongsberg table By pressing the Print button the overview can be printed E Kiss Cut Cut 3 e Centerines lines Kiss Cut or Pen Microcross from the back side of the ac e o Kie Bounds of the image Label of the ima s ee Drill tool gt Kie Kisslutorpen x Pn Center Lines for plainimages knife S Uneb ier conor Drill Digital idee o o Kwe ___LineEditorimage bounds KE 7 22 23 For more information refer to chapter Kongsberg XL Guide 6064 EK ESKOG reg 2501 reg 501 reg 5010 Negativ reg 10010 Negativ reg 502 c reg 5015 h 25mmx25 mm
23. using Sample Step and the distance to the object contour can be set using Line Distance If negative values are entered the cutting line will be drawn in the design ESKO 8 6 Cutting Margins ki cuts the margins This function is only available if the entire image is displayed and no bear bars have been defined yet Staggered Cut S IS Ve E oe 38538 E GE G eR Boa oB inttitrtrintztittiirtriitataittrlirirtatatiirtrirtztitatrirttrtitntiitrititztiatztiti1 8 Reset Cancel 8 amp 8 me ANEI EA dete tbe tebe tbe tab tet etd tet NA chebethtutadbetetitatebitithivtibetethtetyl o 2 8 o 422 14 180 180 200 j AZZDPE 200 280 300 320 340 360 350 DD Yoourtic_for_stagger_fitsheet_m jen he red areas on the right and left of the image show the unused space The cutting line is automatically moved to the lateral margins of the image changes the margins This function can also be called up by right clicking the red area A new window is opened in which you can enter the Left Gap and the Right Gap of the margins ESKO mmm OK applies changes Reset removes the frame Cancel cancels this change 8 Detecting the Bear Bars Automatically detects the bear bars automatically This function is only available if no margins have been defined yet and an area was enlarged praa A A ar B a MA IL IA Left Outer Border 3 0
24. 3 Jen 1020 JDF M c003 len 1020_JOF_C_c002 len 1020_JDF_Y_c002 len 1020_JDF_M_cO02 len 1020_JDF_K_c002 len VX USB uu ww 12 1 Setting up the JDF Connection The computer name or the IP address of the DFS server is entered in the Merger options Edit Preferences in the DFS Server field Basic Units mm Digits 8 E Lock Circumference Post Colon 3 sl File Copy Method Copy Move E Check Images before start Bleed 0 0 mm Show Ruler Expose frames W Autoload Job Archiving interval 14 days DFS Server 192 168 1 150 Reset Jobcount Auto Arrange Images Autoplace Mode SORTED a Rotate Level 1 5 FI Auto Rotate 12 2 JDF Window When the Merger is connected to the DFS server an additional window opens and shows the JDF files FI a KT Jobname Plate Type DPI Status DPS45 4000 0 _DPS45 4000 e r je aaa he pI je j wal DPUSZ _ 4000 mA _ i DPUSZ 4000 WA DPUSZ 4000 SA _ DPUSZ 140000 MA DPN112 4000 DPN112 4000 0 __ Area 1 contains the load and filter functions ESKOG Jobname Loads the marked job Loads all jobs that have same resolution and plate type as the marked job Filters the job list according to entered text Resets all filters Shows only jobs which correspond to the selected plate type in the Merger display is green In Area 2 the job list ca
25. AM TEMI LA LETI LE ee Oe LENE EI LEEST TN EA EAEA LA TERA ET EA 1AT LaL b 8 GR SS g 8 Shrink 2 00 S 8 3 Jo Yogurtlid for_stagger_fitsheet_y len 8 8 Creating Vertical and Horizontal Lines E creates an additional vertical line at the desired position by clicking the left mouse button OI creates a horizontal line at the mouse position ESKO Ka Aliran la E 00 lilii titala CH 8 ti Gliti tetehi tahdil tattita laititi gla Sla Design Height 390 0 mm 380 008 20 Cancel Right clicking on a line opens a new window in which the Position and the Line Width can be changed Remove removes the line When a line width of 0 is entered only one line is created When 2 or more is entered two lines will be inserted having this distance Position 380 008 Line Width 00 Remove OK Cancel 8 9 Creating Lines Automatically detects the desired position for the vertical cutting line automatically The section containing the object must be enlarged beforehand ESKOO Enter gaps Position Line Width e Wid Remove Design Height 390 0 mm OK Cancel OK Cancel WideWeb len The width of the first detected object is automatically used as line width for all vertical cutting lines If not requested the line width can be changed by right clicking the vertical line ESKOG 9 Line Editor Staggered C
26. S TO THE OBJECT CONTOUR oosssssssssseeesssseesseseorereeseorenessrerseessoreseesroreresororereseerrseesroreresseerereseeeesee 54 8 6 GUTTING IMMA GIN E 55 8 7 DETECTING THE BEAR BARS AUTOMATICALLY u l l l l uu Su igiiope tit bra nd ko bnot ta inte dibz intatti ied add di 56 8 8 CREATING VERTICAL AND HORIZONTAL UNES llli E KEE ANA NE MET ANN TEMI NE NENTEEEZENEZENENZ NEE ZENEZEEEzZEEEZETEI 57 8 9 CREATING LINES AUTOMATICALLY E 58 9 LINE EDITOR STAGGERED CUT LICENSE ll a EES 60 91 USING MAK n L 61 9 1 1 Applying a Mask to the Entire JOD scccesisiccsevisreccovasenssndensdechonseoaessaewessuvaevensedaanvenventhecsrdenssacevenrsacositese 61 9 1 2 Applying a Mask to One INK Only 61 92 CONTOUR een ue 62 9 3 EREATING RECTANGLE riran nunan uauiqayasauawaayusawaypiqaaaqay 63 9 4 CREATING LINES cicacesencotdecseccutncdtectwiast ls IAE E EEEE AAE EAEE NAERATA 64 9 4 1 MOVNO SE 64 SY ummm ee 65 9 5 DELETING SEVERAL TEE 65 9 6 EREATINGA Eege 65 9 7 LOADING A T EMPIATE uuu sasa u sasaamankaiaqauahupuaaappanaqanahapaqasaakuwaunpiusaqazapaaa qana haquwapaqkhaaqawkhusuaaiapasaqauqaaaapa 66 98 LOADINGAN RE 66 9 9 SAVE INFORMATION BE 66 9 10 P PORT IIAP ED zu s suro Z etic eet es ee eee 66 10 HOTFOLDER ease cece u u us m us u uuu 67 10 1 WORKING WITH THE HOTFOLDER INTHE NIERGER RI l R a akakaqaaasasqkaskakasayqaasahausulkuqpaywaspaqkaskiusqna 67 EENHEETEN 68 11 KONGSBERG XE aoa uuu cw eee ape tw si ew a see one sar ee aise ance ee wee vee enema ee
27. aJob tO CDlOr Creatina a TIF i u uu a e i d 25 6 3 12 Displaying the Job List of the CDI tna nn ran rna tna n rna n nn 25 6 3 13 Cropping and Rotating ITMAGES cssecccnnescccnaeseccseesecsasecssaseccauueeessusecssausecesauecessuasessauaeessaussesagagss 26 6 3 14 Manual ClO GOING aa ssuatpaaciand deat eabeseaniancondiucbedenaantaceteaneeosmienteesean 26 6 4 IVIENU BAR u ua aqa ausaakukasaakhukaiapukuaqalaskuqaaaawkunquysshiaqaytukuaqaaqkuqaqawakaqauyqhiuayiykanququshasaqasqkustuakhayaiahunaa qaq 27 C41 E ee ee n 27 642 E Ee ee Postonea ee 27 643 Selecting the Working RE 27 6 4 4 Saving the Image Arrangement 27 6 4 5 Loading the Image Arrangement 28 ESKOG 6 4 6 Deleting the Image Arrangement eelere EA Een 28 64 7 Automatic Positioning OF eeler 28 6 4 8 Automatically Positioning New Jmgoges sscccssseeseccesnesseeccnneesecssnaeseecsssaussecesaaueeesssauusecsssauseesssaees 28 6 4 9 Removing Images from the Working Surface 28 6 4 10 Displaying File Names r 28 6 5 WORKING SURFACE AND STATUS BAR EE 28 6 6 DISPEAVING PLATE USE sirsie niin rE E EEEE it AAEE 29 6 7 VIENAGING JI PPK TE L a 29 Z CRC CIO G NEW PIO EE 30 67 2 lnongma the Fale u u ma een nT ee AE nT eC Tone mene nm ee eT 31 6 3 VOCE tee PIO l ae a 32 6 8 F OUTPUT secre E EE A EEA AE AE E 32 6 9 EE 33 oU TEMPLATE uu
28. c cropping of the selected images Unused frame areas are removed Right click the icon to undo the changes The distance to the Bleed pixels can be set in the Merger properties If the image contains Staggered Cut information the image is cut on the cutting line 2 Opens a new window in which the image can be cut For more information refer to chapter Manual Cropping 3 Rotates the selected images by 90 The rotated files are generated when sending the data to the output device Depending on the resolution this may take some time 6 3 14 Manual Cropping 4 opens a new window in which the image can be cropped A Starting from the frame area a lasso can be pulled open by pressing and holding down the left mouse button and pulling the mouse across the working surface or the exact lasso size can be entered in the four input fields on the right hand side 1 KA The distance between two positions in the image can be measured bv pressing and holding the left mouse button down ESKOG i YY s a EA Individual sections of the image can be enlarged with a square magnifier by pressing and holding down the left mouse button and pulling the mouse across the section of interest The magnified image section can then be positioned using the arrow keys on the keyboard oO displays the entire image ES performs the automatic cropping K sets back all cutting edges E saves the current imag
29. cut marks are added in the corners of each image Distance between cut marks and image oF O N Font 4mm w TextTESTJOB 1 G G Allows to activate the text function for the selected image A frame is automatically added to all images Allows to switch the position top or left Allows to add an image name together with a date and time stamp Selection of the text size Input field for the text The text should not be longer than the image width or height The position and width of the text is marked in yellow on the working surface The text can be deleted by clicking on the X at the end of the input field 6 3 6 Information on Grids and Image Position ESKOG LPI Testform H 10 0 mm P 205 94 mma LI GaelicGhost_k_7 len v Allows to enter the raster count and the angle if they have not yet been included in the image Images without this information are marked in red on the work surface Allows to mark an image as a test wedge For this image the output optimisation function is deactivated to increase productivity If highlighted in grey these two fields are irrelevant for the selected CDI Allows to display and change the current image position Confirmation of the changed image position The image is not positioned until the changed image position is confirmed Allows to activate the overlaying option The images can be positioned on top of each other Using the arrows the selected image can be positione
30. d above or below another image Allows to display and change the image to make further changes 6 3 7 Step amp Repeat and Seamless Option for Sleeves G OG moO gX Hi 0 0 mm ka 1 0 0 mm 0 0 mm H 0 0 mm Drop user defined e B o G 1 Allows to enter the number of repetitions in horizontal and vertical direction It is possible to set a gap between the images Displacement of the image above the zero point of the sleeve 5 activated Offset of the images to each other when horizontal repetition is selected 5 activated Predefined offset of the images to each other 5 activated Activates the seamless option If the image is smaller than the circumference a gap will be automatically added and repeated in vertical direction if possible 6 3 8 PreMount Output e UO s e x e aw Carrier Sheet 0 35 v mm Tape 0 1 v mm Support 0 2 w mm P O g To ensure the dimensional accuracy and the focus on the CDI for PreMount output the thickness of the glued materials must be specified 1 thickness of the mounting film 2 thickness of the adhesive tape 3 thickness of the support such as for example an airbag The thickness of the mounting film of the adhesive tape and of the support can be changed by selecting the Premount Support function in the Edit menu Should one entry no longer be required select this entry and remove the value by pressing the Delete key on the
31. d on the working surface rge Merge Start Position Template Help File Start Position Template Windows Options Help W ww B Q Dh A Bi wher d ar o fost 127001 X 0 D 1040 D D pe ees 80 160 240 320 400 460 560 640 720 800 e En 80 160 240 320 400 460 560 640 720 800 e Working Folder d ibsitestibs datal Jobname Not Defined Go Plate Type other Loaded Images 11 Working Folder d bsitestibs data Jobname Not Defined Go Plate Type other Loaded images 11 0 ESKO ug 10 2 Setting up the Hotfolder Before using the Hotfolder for the first time it has to be set up using the Hotfolder program Windows Start Menu Esko Digital Flexo Suite System EA Editor for Merge Hotfolders D bsitest BSL run hotfol k OX EA Editor for Merge Hotfolders D bsitest BSL run hotfol CI X Directories Style Plate Gaps Directories Style Plate Gaps Identification Result Directory Input File Type Hotfolder directory working Dir Minimum filled _ Full Automated fille Target Host AAA SA LI Remove Images Lasel Accept Cancel Accept Cancel Identification The Hotfolder name specified here is displayed later on in the Merger Hotfolder directory A directory from which the LEN or TIF files are loaded has to be selected using the Browse button Working Dir All the files are copied from the Hotfolder automatically into a working directory
32. d out by pressing Ctrl and the left mouse button oO displays the entire image R opens the Digital Video Drill module if the respective license is available For a detailed operating manual of this module refer to document Digital Flexo Suite Tools el MA activates or deactivates the split screen which displays the upper and the lower cutting line simultaneously gt moves a point By pressing this button and the Ctrl button the distance to the original position is displayed in addition moves the upper line For this purpose a point is moved with the left mouse button By pressing this button and the Ctrl button the distance to the original position is displayed in addition gt sa adds a point Le Ki deletes a point fei eg J marks the points in an area These can then be deleted by pressing the DEL button Tt centres the points vertically between two objects centres the points horizontally between two objects a adapts the points to the upper object contour KA The distance between two positions in the image can be measured bv pressing and holding the left mouse button down corrects excessivelv acute angles so that the plate will not crack in these areas ESKO cuts the margins This function is only available if the entire image is displayed ji changes the margins This function is only available if margins were automaticallv created befo
33. d under Esko Digital Flexo Suite System 13 1 ACM Viewer This program is used to display and control the ACM files which were created by using the Digital Flexo Suite After the Digital Flexo Suite installation all ACM files are automatically linked to the ACM Viewer RE PoC Created by DFS version Version 7 5 Builc WNCM0 01 wd ACM iew Dr bsitest BSL data Output mount Ploty Gselic Ghost K acm Fie View Help rRe HDR DESIGNER PlatePrep Version 75 Buld 17 MHDR APPLICATION CIPFlexo HDR RDSI 0 0 HDR RD8ul 0 0 HDR THICKNESS 0 1 7 EI SLwatayputputmount iPtot SaelicGhost_k acm 4 C GaelicGhost_k PS G1X13930Y21242 D1 G1X46003Y21242 D2 G1X46567 Y22085 Di G1X46567Y107420 2 G1X13925Y108189 INFORMATION Programs all y dth 1331 40 mm Di G1X46003Y108263 I 02 Height 1294 98 mm G1X133427107314 D1 Thickness 0 10 mm G1X13342Y91413 D2 G1X47100Y 22085 D1 MANUAL STEP G1X70475Y22085 D2 848 848 G1X71007Y22085 D1 5 start autorun G1X71007Y107420 D2 Speed G1X47100Y107420 Di G1X70475Y107420 SETTINGS G1X71571Y108263 Line 100 mm kass The distance between two points can be measured by using the right mouse button hold pressed 1 The image content can be enlarged by using the mouse wheel 2 and moved by using the left mouse button hold pressed and pull 3 Double click one ACM file and an additional window 4 will
34. e Now you can change all parameters as required and save them using Template Save Template The modified template can now be loaded using Template Use Template 6 10 4 Moving a Template Template Correct Template opens a new program in which the template can be loaded using File Load Plate The position of single or multiple images can be changed horizontally using Across and vertically using Circumference The value is entered absolute or relative to the current position ENTER is then pressed and the value is set using Set Position Multiple images can be marked by pulling a square lasso around the required images with the left mouse button pressed The template is saved by clicking the Save button 6 11 Job Information An HTML or XML file with the respective job name is created in the HTM Target Folder output directory for each sent job ESKO All important information concerning the job is stored in that directory The output directory d files output html is preset 6 12 Loading Images via Drag amp Drop Image files LEN and TIF can directly be dragged into the right image bar of the Merger from the Windows Explorer First the data is copied into the working directory then it is loaded If the Ctrl key is pressed at the same time the files are always copied Df FILES Fie Edt View Fawnrites Took Help Qs ky a Search ij Folders fill Address E DAFILES b PE
35. e Data ESKOG 1 Opens the Bitmap Viewer Several files can be marked simultaneously by pressing the Control button together with the left mouse button to view these files each superimposed on top of the other in the Viewer Staggered Cut option Opens a new window to create user defined cutting lines PlatePatcher and Plato Staggered Cut tiles cannot be edited Line Editor option Opens a new window in which the cutting lines can be created manually PlatePatcher and Plato Staggered Cut files cannot be edited Display of the drum circumference This value can be changed for sleeves Switchover to partial plate In this mode the vacuum on the CDI is not analysed and is reduced to a lower safer speed Allows to set the plate width in partial plate mode Allows to set the plate height in partial plate mode Display of the list of partial plates Plate width and plate height are selected from a list 200 0 x 300 0 300 0 x 400 0 1200 0 x 900 0 1430 0 x 600 0 The data is entered in the format width x height New values can be entered in this format and can be added to the list To delete an entrv select said value and press the Delete kev 6 3 4 Frames and Cutting Lines ESKO O 0 0 mm C 0 0 mm Con mm ap Ww Allows to enter a frame area which is not available for the imaging process The area is marked red lf activated
36. e archived in a ZIP file JDF Server Enter IP number or computer name of JDF server Autoplace mode sets the method mode of how the images are automatically arranged on the work surface Permutation Random Sorted WDB and FFDH can be selected as mode MDB arranges the images which allows for easy cropping later on Auto Rotate activates the rotation of up to 7 images during automatic positioning The selection of these images is via the aspect ratio using Rotate Level In the Folder window the preset output directories can be changed The job information is saved in the HTM Target Folder directory Under Plugins the minimum size for Microcross and Centerline images can be entered The images are automatically enlarged to this size The Merger must be restarted after any change ESKOG 7 Kongsberg Output XL CUT In order to properly process the cutting data on the Kongsberg table at least XL Guide version 6064 must be installed The Kongsberg file is generated automatically after each transmission to the CDI or each time a TIF file is generated in the output directory The position the size of the images and additional information is made available on the Kongsberg table in the form of an ACM file Different settings can be created and selected in order to adjust the cutting settings on the Kongsberg table 2 The reserved area 1 marked yellow on the left side is needed for later a
37. e section as a new LEN file Manual cropping is not available for LEN files of the PlatePatcher and the Staggered Cut 6 4 Menu Bar Only the additional functions which are not listed in the toolbar are described The menu bar is situated above the toolbar 6 4 1 Unloading Images File Unload Image Ctrl u removes the selected image from the Merger The file is not deleted from the hard drive 6 4 2 Unloading Positioned Images File Remove All Positioned Images Ctrl d removes all images from the Merger which are positioned on the working surface The files are not deleted from the hard drive This is useful when the job was sent and several images are still in the queue 6 4 3 Selecting the Working Directory File Select Working Folder Ctrl w changes the working directory in which all images are copied or moved during the loading process This option is not available if images are loaded 6 4 4 Saving the Image Arrangement File Save Plate Ctrl s saves the compiled images and the exposure parameters as plate When the compiled images are sent to the CDI the plate is automatically saved under the entered name File Save Plate as saves the compilation under another name ESKOG 6 4 5 Loading the Image Arrangement File Load Plate Ctrl L loads a previously saved or sent compilation with all parameters All currently loaded images are removed 6 4 6 Deleting the Image
38. ed for Full HD Flexo Finish 16 saves the plate 6 7 2 Changing the Plate First select the desired medium Plate Type 1 then check Edit 2 and press Next 3 to go to the next menu ESKOO OFS 1 70 067 After setting the desired Plate 4 you can change all parameters except for the plate name Next opens the next menu 6 7 3 Deleting the Plate First select the desired medium Plate Type 1 then check Edit 2 and press Next 3 to go to the next menu Select a plate Select drive Edit O New The desired plate Plate 4 is set and removed by pressing Remove 5 6 8 TIF Output Edit Edit Device List opens the dialog window to subsequently add new TIF output devices special license required ESKO Edit Device List Host Preferences Other Devices Workflow Editor Device Width Height Tif Target Folder C FILES Output tif Tif Compression New in section Other Devices opens a new dialog box in which you can enter the name of the TIF output device Width and height can be set in the fields Width and Height Negative inverts the background colour for the output on film The output directory is defined in the TIF Target Folder field Remove deletes the selected entry Expose creates the TIF file 6 9 Exposing Plate Borders The Expose frames option can be activated
39. en the desired plate manufacturer Brand 4 or the plate type Plate 5 are not available the option other can be selected Select a plate family and a plate DFQ 1 70 067 ji DFS 1 14 045 DFS 1 70 067 A DFS 2 54 100 DFS 2 84 112 DPC 2 84 112 DPC 3 18 125 Name 7 determines the display name in the plate list and Thickness 7 the plate thickness For sleeves the circumference is entered in the Circumference field 7 ESKO Name FAST Round Classic gt Circumference Distortion 0 0 Additionally the output in the Distortion field 7 can be distorted in circumference direction The input is made as a percentage If you enter 5 0 the output is enlarged by 5 percent in circumference direction Entering 5 0 would downsize the output accordingly Under Manual 9 enter the values for Speed 10 and Laser Power 10 The setting Energy 9 sets the laser energy Laser Energy 10 and speed and performance are selected automatically according to the resolution With Inline UV enter for the front exposure the values UV Main Exposure 13 and UV Main Energy 13 and with automatons enter for the back exposure the values UV Back Exposure 14 and UV Back Energy 14 You can deactivate the UV exposure by checking No UV 12 UV2 exposure parameters are specified in section Full HD UV Parameters 14 when the CDI has been prepar
40. erensssiienaneeaees 9 3 1 ENTERING THE LICENSE KEY ee 9 3 2 SETTING THE e 10 3 3 SETTING THE OUTPUT DEVICES E 10 4 MANAGING DATA SOURCES a i NE 12 441 ADDINGA LOCAL DATA SOURCE TT 12 42 ADDING AN FIP DATA SOURCE iii iii iii tr ei e rali ea 13 4 3 CHANGING AN ERY E 14 4 4 DELETING AN ENTR V ET 14 4 5 EEN 14 5 ADJUSTING THE MERGER USER INTERFACE 15 Dal PASSWORD PROTECTING FUNCTIONS ull uapa uasssuasaskupaspiqpimeqpaqhtpaqhuqhas qasaa apuawanqaspwqayahikuqiyuassyqaqaqkiaasa 15 5 2 CHANG NG EENEG 16 5 3 ENTERING A PASSWORD TO CHANGE SETTINGS sscsissiacanonwricasaisuslecutsannhnatalaaaledumiasnientaaaalncslevadd ERENER REAA 16 6 MERGER sieran ji kab ni kk nig akivika sikwit tubi ak iai gkai tai tibironakotigkizietja usti kit eku 17 6 1 Eeer 17 62 PE RI SER INTER ECE tilka in ENE E AEE ENE E A 18 SC A IO 19 Col E ege Le ee i uu uu umum E u ua 20 6 3 2 Displaying and Modifying Image Doto ss enennnnnnnnnnnnnnnnnn nanna nn nanna artna nn rna rnnn tna nn nn nanna 20 6353 Fates Ee 21 6 3 4 _ Frames AN Cutting Lines 21 o 5 ee T E 22 63 6 Information on Gridsand IMAGE Posion EE 22 6 3 7 Step amp Repeat and Seamless Option for Sleeves r 23 BIS oO T TX IT ee 23 6 3 9 Mirroring Inverting Lenticular iMask ss sseesnnnnnnnzonnnnzannennnznnnnnzantnnnzantrnnzzntenzzntnnnzzntnenzznnnnzza 24 6 30 EE 24 63 11 Sending
41. es If no output device such as e g a CDI has been set up yet the Edit Device List window in which you can define various output devices is displayed when the Merger is started for the first time Edit Edit Device List opens the dialog window to subsequently add new output devices Preferences Workflow Editor Hosts Host 10 332 155 25 Remove Other Devices Device TIF Output 1 gt 0 l 20 00 Eet Height Tif Target Folder C FILES Outputitif Tif Compression A TIF license is required in order to create TIF output devices New in section Hosts opens a new dialog box in which you can enter the IP address or the computer name of the CDI Press OK to search for the CDI on the network Accept accepts the new CDI Test checks the connection to the CDI ESKO EEE New in section Other Devices opens a new dialog box in which you can enter the name of the TIF output device Width and height can be set in the fields Width and Height Negative inverts the background colour for the output on film The output directory is defined in the TIF Target Folder field Remove deletes the selected entry f an old CDI SUN computer is to be connected you must enter the IP address 127 0 0 1 In addition service needs to adapt the LEN output format for the SUN EK 4 Managing Data Sources The ima
42. es not recognise halftone screen areas as a contour To write the corresponding cut contour into a file with halftone screen areas a file with a solid area is required for each job or ink The file with a solid area is loaded and edited using the Line Editor When pressing OK the information is additionally written into the desired file with the halftone screen areas provided that FREECUT is used in the file name as follows 9 1 1 Applying a Mask to the Entire Job Mask job name_FREECUT len Ink 1 job name_ink1 len Ink 2 job name_ink2 len 9 1 2 Applying a Mask to One Ink Only Mask 1 job name_Ink1_ FREECUT len Ink 1 job name_ink1 len Mask 2 jobname Ink2 FREECUT len ESKOG Ink2 job name_ink2 len 9 2 Contour Recognition K activates the contour recognition feature Left clicking selects the desired contour OJ WE 100 200 300 400 500 600 700 800 900 Testi 2540DPI K x 117 0 mm y 911 571 mm The first black to white change to the left of the selected mouse position is used as the starting point for the contour The distance to the selected contour can be set in the Line Distance field To maintain this distance the corners receive a round contour ESKO 9 3 Creating Rectangles Automatically creates a rectangle around the objects in the visible area when left clicking this option ej Line Distance 10 0 IPA IA A A TAT JA A AM BA A PA AT JAP PA PA JA A BAT IA A 8
43. etc These documents replace all previous versions Grapholas is a registered trademark of Esko Graphics Imaging GmbH Cyrel Cyrel Digital Imaging System and Cyrel Digital Imager CDI are registered trademarks of DuPont Microsoft and the Microsoft Logo are registered trademarks of Microsoft Corporation in the U S and other countries The Esko Graphics software may include the RSA Data Security Inc MD5 Message Digest Algorithm JDF and the JDF Logo are trademarks of the CIP4 Organisation Copyright 2001 The International Cooperation for the Integration of Processes in Prepress Press and Postpress CIP4 All rights reserved Java and all Java based trademarks and logos are trademarks or registered trademarks of Sun Microsystems in the U S and or other countries Some parts of this software use technologies of JGoodies Barbecue Copyright 2003 International Barcode Consortium and Jakarta licensed by Apache www apache org licenses LICENSE 2 0 txt All other product names are trademarks or registered trademarks of their respective owners ESKO Ne 1 SYSTEM REQUIREMENT3S sesgeuegsetesegegkg geg ge kESeNN SNE SENGER raient uiia aa aao r Ee rna enanar V ANNER 7 2 DIGITAL FLEXO SUITE SERVICE uuu usuyasa susupusaaqawas usqawapsiwquswankawqupuskuqsusasqaususpsaaquwaunkaqauaushaqsusasaaqqusppuus 8 3 FIRST START UP OF THE SOFTWARE isssicssicinccsssiacpccsssivanserivenensadiecesndineiseaiaieaneadieinsadenianidiaauea
44. formation in a template ESKO e 9 7 Loading a Template loads a previously saved template In case the dimensions of the image are correct the information is applied to the loaded job 9 8 Loading an Image The menu item File Load Image shows the Load dialogue 9 9 Save Information After all lines have been set the information is written into the LEN files with OK 9 10 Export Finished Files When the Export option is activated the job is copied or moved automatically to the output folder l E Export Load image Strg O 7 Export Folder 171 Edit Strg P I Move In the File Edit menu under Export Folder the path of the output directory is specified where the files are copied to Using the Move option you can move the files into the output folder EK 10 Hotfolder LEN and TIF files are loaded into the Merger automatically from a predefined directory Positioning on the working surface and transmission to the CDI is performed manually 10 1 Working with the Hotfolder in the Merger The Hotfolder is activated after starting the Merger if active Hotfolders were set up Files are loaded automatically and lined up on the right The Hotfolder icon in the toolbar activates and deactivates the Hotfolder Hotfolder ON Hotfolder OFF The Hotfolder must be deactivated by clicking on the Hotfolder icon before the loaded images can be positione
45. g interval 14 Digits 8 PostColon 3 Check Images before start v Show Ruler v Autoload Job w days JDF Server rdtest Reset Jobcount Auto Arrange Images Autoplace Mode PERMUTATION Rotate Level 1 5 Auto Rotate Cancel Units switches between mm and inch Merge Folder Plugins Plate Patcher Patch Redo Folder bsitestibs files OutputiPatcherRedo Microcross Microcross Mount Folder ciworkibsitestibsifilestOutpufimounti HTML Job Info HTM Target Folder ciworkwbsitestibsifilesiOutpufibtmih Merge Folder Plugins Plugin Configuration Microcross and Centerlines Minimal Width 20 0 Minimal Height 20 0 Digits and Post colon set the amount of numbers and or decimal points Check Images before start checks the images of all outgoing jobs Browse Browse Browse File copy method sets the behaviour while loading images With the setting Copy the files are always copied if Move is selected they are deleted from the source directory Bleed sets the border during automatic cropping Expose left frame When activated the left border is exposed to provide more stability for the washer Show Ruler activates or deactivates the ruler ESKOS When restarting the Merger Autoload Job actuates automatic loading of the last job Archiving Interval determines the number of days after which the HTML overview files and the files of the directory Mergelog ar
46. g the back with the 45 knife is not recommended 7 5 Front Labelling of the Plate The image name for front labelling or the plate name for images from the PlatePatcher is carved into the frame area with a knife This option must be activated in the settings of the XL CUT or the PlatePatcher ESKO 7 6 Setting the XL CUT Options Templates can be created for the XL CUT options by calling up the XL Cut Workflow Editor under Edit d it V e g pe Cut Channels ek rm rm e rm rm em rm KT WR Workfiow q UU Workflow XLCut e d Basic l Register Mark reg 5021en Knife Type Safe Distance 5 mm Cut Gap os mm Comer X oo mm Corner Y nn mm Reserved Area 5 mm MAT Info GA 4 Point Registration MI Landscape Align Vertical _ Mirror X Mirror Y Text Text Height 5 0 mm Mirror Job Name Mirror Plot Text Translate Space Safe cut e open Sae The XL Cut Workflow Editor can be divided into five areas Allows to switch between XL Cut settings and channel overview Schematic view of the selected options Selection of the saved settings Options for the current selection OI O NN Save delete and create new settings EK 7 6 1 Adding Settings By selecting New a new window appears in which you can enter a name for this setting
47. ge data can be loaded from the local hard drive over a network release or via FTP With regard to data security transmission via FTP protocol is to be preferred over network release The path entered during installation for the User Data is already released as a network drive Additional data sources can be set up under Edit Data Source 4 1 Adding a Local Data Source Local data sources can be located on the hard drive of the computer or accessible in the network via share function FA Editor for the drive setup file Fa Editor for the drive setup file Select ta edit an existing entry or to add a new one Enter an alias name for ihe new drive choose local or ftp Select drive O Edit New DrveName ESKO k Drive Type Local FTP F Editor for the drive setup file Enter a disk name and folder for accessing files Disk D Sub Folder ESKO Disk and Sub Folder 6 designate the drive letter and the directory containing the data Clicking Test 7 opens a new window with the data source set up Finish 9 completes the process You can always switch to the previous page by pressing Back ESKO EE l 4 2 Adding an FTP Data Source The FTP server of the data source requires a virtual directory For a detailed installation manual refer to Digital Flexo Suite 101 Installation FA Editor for the drive setup file L Editor for the drive setup file Select t
48. i be wk DIGITAL FLEXO SUITE 12 0 FOR FLEXIBLE PACKAGING USER MANUAL 19 11 2012 ESKOG es ga Copyright 2012 Esko Graphics Imaging GmbH 25524 Itzehoe Germany All rights reserved This document and all information and instructions contained within are the property of Esko Graphics These documents contain the product descriptions according to their current state at the time of publication but no responsibility whatsoever is taken for the correctness of this information Based on the information in these documents guarantees will neither be granted nor uprated Furthermore Esko Graphics does not guarantee the illustrations relating to the usage of the products or for the results from using the software or the use of the information contained herein Esko Graphics will accept no responsibility for direct indirect consequential or latent damages caused by using the software or by making use of the information contained herein or by failing to do so The technical data contained herein and the content of this manual are subject to change without prior notification Revisions which point out such changes and or supplements may be issued from time to time Without express written consent no part of this document may be reproduced transferred electronically stored or published irrespective of the reasons and irrespective of the method or means used i e electronic mechanical by printing microfilm
49. ick Start File Start Position Template Windows Edit Options Help e EW Est Im ci wx V4260EC3 e DPS45 e XL XL Cut v Queue v Device 10 31 155 86 x we Expose g A A wi CH A 1 4 E me 8 testen Lome net sr hh Bes eee eter estes probe bcc 8 ee Cee mee ak 7 A noniGny gt TCH MR mm o 200 400 600 800 Working Folder c workibsitestibsiifiles Jobname ESKO_JOB2 E E o Drum V4260EC3 E AR U Loaded Images 7 1 Start the Merger and load the required images They are displayed in the image gallery on the right 2 f necessary select the CDI or the TIF output device All important parameters are updated in the Merger 3 Position the images on the working surface Click on the images or the working surface with the right mouse button to display additional information Select the required plate Right click on the plate to display additional information Send the job to the CDI or the TIF output device ESKO 6 2 The User Interface The Merger can be divided into four areas File Start Position Template Windows Edit Options Help 10 B e ig 9 X V4260EC3 e DPS45 Y XL XL Cut x Queue Y Device 10 31 155 86 Area 1 Area 2 Area 3 Area 4 ESKO tere kee WA l A 8 59 at kB een eters eee probe bce ee fee mee d x IF A notgtn 7 P TCH mai KL Loaded Images 7 menu bar toolbar with icons for the most important options wo
50. icking the left mouse button then the cutting lines must be added one after another with the left mouse button Angles larger than 90 cannot be entered The contour can only be further edited when the line was created for the entire width The distance to the lower cutting lines can be set in the Design Height field ESKO Digital Flexo Gute for Flexible Packaging 12 0 8 3 Centring Points centres the points horizontally between two objects A frame can be pulled around the relevant points using the left mouse button hold pressed and pull If there is no graphic object on one side top or bottom the frame is used as border AJOMJIJE DASI ESKO Digital Flexo Gute for Flexible Packaging 12 0 Als centres the points vertically between two objects mms uman Ga s sy EE er nr SSES Fi We SE SE 8 4 Applying the Cutting Line to the Entire Job After creating the cutting line the Apply To Job button can be used to automatically transfer the cutting line to the entire job To this end the other separations must already have been loaded into the Merger oti 0 0 mm Appiv To Job OK Cancel ESKO Digital Flexo Gute for Flexible Packaging 12 0 8 5 Adapting Points to the Object Contour RH adapts the points to the upper object contour o this end a frame is drawn around the desired area by pressing and holding the left mouse button down The distance between the points can be set
51. istration should be performed with the camera 3 11 3 Setting the Tools The knives can be set in the Job Setup window which is opened via the Options menu Each element in the ACM file is assigned to its own channel line 1 The speed and the acceleration 3 must be determined on site Since Digital Flexo Suite 7 5 the ACM file contains more channels which can be selected at the Kongsberg table Therefore the No tool Ignore 2 option must be activated ESKO Job setup Board size Current job setup lobsetw z Line qm Rigid Material Knife 179 v e E No tool 7 More More V Notch 2 v No tool Ignore 11 3 1 Front Text Labelling For the Front Text labelling a knife must be set up on channel 12 In order to crave the text only into the surface the Depth Unit 4 is set to WM and the cutting depth of the knife is reduced 5 The exact value for T must be determined on site An initial value of 0 7 mm b may be used This value must be entered in both fields 11 3 1 Setting the Knife for Staggered Cut The angle for the lifting of the knife has to be set to 14 to achieve the ideal soeed when cutting the Staggered Cut contour Go to Job setup under Extended setup where you will find the field Lift angle in which the desired angle of 14 can be entered Extended setup for line 2 Job setup Board size Current job setup oe a A D mg lt Bevel Knife 93
52. it an existing entry or to add a new one Select a Drive Select drive G Edit New After selecting the Drive 3 you can remove it by pressing Remove 4 4 5 Saving Settings Exiting via Quit a new window opens requesting whether you want to overwrite the current settings Pressing OK saves the current settings ESKO The user interface and some of the functions of the Merger can be customised and protected with a password Edit Configuration Basic Gu Plugin Selection Edior Selection f Hotfolder wi JOF Support z Worktiow Editor 7 Plate Editor Merge Options Device Editor Lei Data Source Editor Image Manipulation image Cropping Premount Support Editor 7 Mask Editor Step amp Repeat iv Rotate Templates Preferences le Allow Preferences ei Tes orm iz Templates Edit Template Workflow Editor e Load Save Job z Edit Working Folder CI Template Jobs Only Edit Device List Pata Piate Edit Data Source e Partial Plate l Partial Plata Database Tool Edit Mask Output Ke Sp Greng Configuration Please restan the program afer selection has been done Please r startth program afer selection has been done 5 1 Password Protecting Functions Left clicking on Enter Password opens a new window in which the password is entered twice and confirmed with Close Basic GUN Plugin Selection
53. keyboard New entries are entered in the desired field using the keyboard and confirmed by pressing the Enter key The values are automatically sorted If the value 0 is entered in a field this field will not be displayed in the Merger ESKOG 6 3 9 Mirroring Inverting Lenticular iMask e E en DH Ui 2540 0 DPI 8 w mages Mask Maski v Q B If this icon is not displayed it can be displayed by selecting Image Manipulation under Options Configuration 1 Allows to mirror horizontally or vertically and invert the selected image ymir xmir or inv is added to the new files 2 Lenticular output settings For more information refer to chapter Lenticular 3 iMask output For more information refer to chapter iMask Output 6 3 10 Output Options V4260EC3 w DPS45 Y XL XL Cut wv Device 10 31 155 86 v 1 Selection of the drum on the CDI This option is only shown if more than one drum or the drum and the sleeve have been set up on the CDI 2 Selection of the plate To ensure an optimum imaging result the right plate needs to be selected Additional information such as UV Inline and Full HD Flexo is stored on the plate Normal plates are marked with a circle and Inline UV plates are marked with a square Plate Type I dk Plate e other DFH 1 14 045 Thickness AFP DSF 1 14 045 AFP DSF 1 70 067 Job Type Energy G DEC 2 84 112 DEC 5 51 217
54. lignment of the plate on the Kongsberg table This area contains two marks and the ACM file name le Start Position Template Windows Edit Options Help d o m Gi 9 x V4260EC3 m DEC 2 84 112 Y XL XL Cut e Queue Y Device cantilever ML K Disabled 13 H t Premount cut safe XL Cut a wak vend 2 non fr Teal nnie z x lt ki gt O 400 850 900 Loaded Images 4 Depending on the plate thickness an additional frame is put around each image as soon as the 45 knife is activated 3 Once an image has been placed you can click on the image with shift the right hand mouse button to change the lettering EK 7 1 Cutting Accuracy Using the Kongsberg table it possible to reach a cutting accuracy of 0 2 mm depending on the kind of registration The camera is more accurate than the laser The 3 point registration can compensate the distortion of the Flexo plates resulting from the imaging process This requires the Kongsberg software XL Guide 6064 or higher 7 2 Activating Deactivating the XL CUT When Disabled is selected the XL CUT output is deactivated No ACM files will be created 7 3 Selecting the Type of Knife The type of knife can be defined in the XL CUT settings 7 4 Back Labelling of the Plate Using the pen the plate can only be labelled on the back For this purpose the Mirror X or Mirror Y option must be selected in the settings Cuttin
55. n be sorted by Job Name Plate Type or resolution DPI Area 3 shows the job with the according Status iy The job can be loaded The plate type complies with the plate type that is currently set The plate type of the job does not comply with the plate type currently set The plate type of the job cannot be found in the plate list The icon in front of each job shows all colours statuses of the respective job The icon removes the colour display 12 3 Loading JDF Files To load a file double click the according job or colour You can mark and load several files by using the Cirl button together with the left mouse button If the plate type is set to other all JDF images are available Otherwise only those JDF images are available which correspond to the plate that is currently set ESKOG Drum Plate Frame image Properties Repeat 4 Plate Type gt j Plate e FT e CDI Film DPC 2 84 DPC 3 94 DPC 3 94 neu O DPC 4 7 neu ODPH 2 54 neu e DPI 1 14 Plate Type other Edit Plate List KH RER WR Bibbibib a b ib pl E i d s P P P As soon as the files have been loaded to the Merger they are removed from the JDF overview and the according plate type is set automatically Now you can no longer change the plate type When the JDF files have been removed from the Merger they are shown again in the JDF overview 12 4 Sorting and Searching of
56. n sen enero 69 RTS POINT REGISTRATION EE 69 11 2 APOINIF REGISTRATION eiir arraie erer aT er dussar nee a oateeay setae dupenivem ETNE EE ETE E EERE 70 fs Wo S e E Eege 70 I Se E I A i u aa s nam aa ne Tt Rana Sua eee er eee ee 71 11 3 1 Setting the Knife for StQggered RTE 71 11 3 2 Setting the Bevel Knife 45 knitel r rr 71 HA te Dili lt a AT 72 tA OPFIMISA TO E 72 11 3 ASSIGNMENT OFTHEQUTPUT CHANNEL ll lll l i E quia sawBipalkasqqkuqassyipaakawqasnissq 73 RE O dipurendanelsor tne e 73 TLO ALIGNING THE PLATE ON THE KONGSBERG TABLE geegent eege EE 75 11 STARTING THE e 77 12 JD E 78 12 1 SETTINGUPTHEJDF CONNEDT ONUTLILL ISR S uu a husasaanaaiussaqastunqiwpaanasqquqqawayanaquwaqqaq asqusasqunquspaaqhqusasquanqapayanqusnqaq 79 12 2 WOE yD EE 79 12 LOADING IDEELE ea E AA A E Dum AE A EEE 80 124 SORTINGAND SEARCHING ee 81 ESKO er I AL Sedoc nno job AJOD rreran uum Dam a asa Q ua 81 12 2 Sorting eege ee e uwa un shasha a aspa aaquikasasaqaykanahyaq apawaq 81 12 4 3 Sorting According ee CA EE 82 12 5 SENDINGJDF FILES i e rr 82 13 ADDITIONALPROGRAM Si u u u u SS asss 83 1351 AGNI VIEWER Zeene ee 83 J o LCD Reie te E 85 14 SUPPORT EUROPE i 86 ESKO 1 System Requirements The following minimum requirements must be met Intel Dual Core 2 processor 2 GB RAM network board screen resolution of 1280 x 1024 pixels CD ROM drive 32 bit operating system Microsoft Windows XP disabled firewall
57. o edit an existing entry or to add a new one Enter an alias name for the new drive choose local or ftp Select drive Edit New Drive Name FTP Senerii lt e Drive Type Local FTP FA Editor for the drive setup file Editor for the drive setup file Enter FTP parameters host user name and password Enter a disk name and folder for accessing files Host RP1 d Disk UserName Sub Folder Passwort fx Enter the IP address or the network name in the Host field 6 Enter the User Name 7 and the Password 7 as shown in the illustration if the FTP server was installed as specified Disk and Sub Folder 9 designate the virtual drive and the directory containing the data Should no virtual directory be available leave the Disk field empty Clicking Test opens a new window with the data source set up Finish completes the process You can always switch to the previous page by pressing Back ESKO 4 3 Changing an Entry The settings of the data source can be subsequently changed BA Editor for the drive setup file BA Editor for the drive setup file Select to edit an existing entry or to add a new one Select a Drive Select drive G Edit New No drive selected C ESKO FTP Serveri After selecting the Drive 3 you can change the following settings 4 4 Deleting an Entry BA Editor for the drive setup file FA Editor for the drive setup file Select to ed
58. on This option activates the 4 point registration In order to balance the plate distortion four register marks instead of two are exposed on the plate This option requires XL Guide 6064 Corner X Corner Y The parameters for X and Y need to be specified see sketch if the edges are to be cut at an angle ESKOG X rrssI Landscape In order to cut for example a 4260 plate on an XL20 Kongsberg table it must be rotated by 90 before mounting it The options Vertical and Y Mirror are deactivated In this case the yellow reserved area is always on the bottom Align Vertical This option is activated to display the reserved area on the left of the working surface in the Merger If deactivated the reserved area is shown at the bottom Mirror X Mirror Y The coordinates of the cut on the X axis and or the Y axis can be mirrored depending on the alignment on the Kongsberg table Kongsberg Target Path Output directory of the ACM file Safe Cut lf plate pieces are lifted during the cutting process this option can be activated As a consequence the processing time of the Kongsberg table will increase Text Height When labelling the back of the plate the text height can be changed Mirror Job Name This option is used to mirror the job name on the plate Front Text This option activates the front labelling in the frame area using the knife This deactivates all options for back
59. rehand creates an additional vertical line at the desired position by clicking the left mouse button creates an additional horizontal line at the desired position by clicking the left mouse button detects the desired position for the vertical cutting line automaticallv The section containing the object must be enlarged beforehand ak detects the bear bars automatically This function is only available if the section with the bear bars was enlarged fei loads a saved cut D saves the current cut ge w Indicates that a new cutting line must be created ez Ke deletes the cutting line Design Height sets the distance between the upper and the lower cutting line Bar Height sets the height of the bear bars his function is only available if bear bars were detected Shrink reduces the lower line for a gapless mounting of the plates Sample Step and Line Distance are available if the adaptation to the object contour is selected With these functions the distance between the points and the distance to the object contour Is set Apply To Job applies the cut contour to the entire job For this purpose the cut contours must be loaded in the Merger OK applies the cut contour Cancel cancels the editing process ESKOG mmm 8 2 Creating a New Cutting Line If the file contains no cutting information the starting point on the left side of the image must be determined by cl
60. rking surface on which the images are positioned displav of loaded image data status bar displav of the most important settings 6 3 Toolbar All important functions are listed in this area The toolbar is subdivided into eight areas Opens a dialog box to load the image files Opens additional functions such as Bitmap Viewer and Staggered Cut Activates additional functions in area 7 to adapt the output A WwW N Allows to set the data output for example the drum the plate the Kongsberg cutting file and the CDI Opens an overview of the jobs lined up on the selected CDI Opens a dialog box to send the job to the CDI or to the TIF output device Allows to modify the image data for example rotating and cutting CO N O OI Area for the various functions selected in area 3 lf some required functions are not displayed they can be activated in the Merger configuration settings EK 6 3 1 Loading Images H calls up a file dialog box in which the LEN or TIF files can be selected 1 Selection of network shares 2 Display of directories 3 Display of files By pressing the Control or the CAPS button together with the left mouse button several files can be marked simultaneously they can then be loaded by pressing OK Single files can directly be loaded by double clicking them 4 Multiple loading of the files 6 3 2 Displaying and Modifying Imag
61. ter wizard is activated and some optimisation parameters are deactivated If the MAT Info field was filled in the XL CUT submenu the file with the knife settings is automatically loaded The setup of the plate is started by pressing the I button on the Kongsberg operating panel Move the laser pointer to the centre of mark No 1 and confirm this position by pressing T Repeat this step with mark No 2 If used the camera is moved in the general direction of the mark then the mouse is used to click the centre of the mark EK 12 JDF DFS Server 1 0 and Automation Engine 10 1 must be installed to use JDF The DFS Server can be located on the same computer as AE 10 1 The status of the JDF jobs is displayed in the AE 10 1 Pilot It is possible to integrate important data such as plate consumption in an existing MIS system AE 101 y DFS Server DF s E The AE10 1 Pilot shows the status and the parameter of the job EK DUPONT DUPONT DLIPONT DUPONT DUPONT DUPONT DUPONT DUPONT DPS45 DPS45 DPS45 DPS45 DPS45 DPS45 DPS45 DPS45 lt lt O A 24 04 11 08 38 21 04 11 08 38 21 04 11 08 38 2104 11 08 38 21 04 11 07 28 21 04 11 07 28 21 04 11 07 28 21 04 11 07 27 Multiple CDI connection Multiple DFS Canceled Canceled Canceled Canceled CDI State NEW CD State NEW CDI State NEW CDI State NEW 1020_JDF_C_c003 len 1020_JDF_Y_cO0
62. u ee i ee 34 O 10 1 E of 0 ge o EE 34 6102 LOGGING G Temp Q u a ua an a ua ia aaa i ape 34 6103 EE Ee 35 6104 MOVING RETTEN 35 TI EE 35 6 12 LOADING IMAGES VIA DRAG amp DROP 36 l DPI T EE 36 GIA IMAK OUTPUT OPTION NEE 37 6 15 LENTICULAR OUTPUT OPTION ull l u i EE 37 GIG BASICIVIERGER SETTINGS E 38 KONGSBERG OUTPUT XL GU Ti i A a ESE aE 40 7 1 CUTTING ACC UKA y uu G E au m fat 41 7 2 ACTIVATING DEACTIVATING THE XL CU T WEE 41 7 3 SEE l THE FO OP NE u earn cet i a asum eg 41 7 4 BACK LABELLING OF THE PLATE ba uu uu u a utasamayasqawshuqasapasaqnahapaqauqakuwapayhusaqasanaawqanakaqwapankhayqawkhausuqasapasaqauqhasuqa 41 7 5 FRONT LABEEUNCG OFTHE B LAT b E 41 7 6 SETTINGTHEALCUT OPTIONS O L t q sand je ea af dir rei Boat 42 Fod AONO ETO Su e EEEN E E EEN EOE N EEE ON EONO TONO AOON 43 P C O eE E EEE AE eae ee 43 E JDeletina Setlings E 43 TG POS EE 43 7 7 OVERVIEW OF OUTPUT CHANNEL ati l ia ia A ta EE EAE a Eaa 45 7 8 REGISTER MARKS AND MOUNTING MARKS FOR XL CUI 46 79 RECOMMENDED SETTINGS IN XL CUT E 47 STAGGERED CUT Le 41 Le WE 48 s Kee 48 8 2 CREATING A NEW CUTTING LINE eegene 51 8 3 EENTRING PONT i nne E 5 ees esate E EN 52 64 APPLYING THE CUTTING LINE TO THE ENTIRE JOB ege gett Eet 53 ESKO 8 5 ADAPTING POINT
63. ut License Cutting lines created by Plato cannot be edited with the Line Editor in the Digital Flexo Suite opens a new window in which the cutting lines can be created manually tan KOONKA p KKNKN ROKIT KOKOKN EN KN KOKOKO KOK KIKNKUKERA KNKNETKN KI KNKN KIENT ENKIEN KIEN AU u 100 200 300 400 500 600 700 800 900 i 7 Test1_2540DPI_K x 483 429 mm ly 910 286 mm LQ Individual sections of the image can be enlarged with a square magnifier by using the mouse wheel or by holding down the left mouse button and pulling the mouse across the section of interest Using the arrow keys on the keyboard or the right mouse button the image section can be moved in the desired direction The image section can be zoomed out by pressing Ctrl and the left mouse button U displavs the entire image KS a RE ESES activates the setting of lines using the left mouse button B activates the contour recognition feature using the left mouse button ESKOG EI automatically creates a rectangle around the objects in the visible area marks a line so it can be deleted marks a line so it can be moved marks several objects so they can be deleted loads a stored template saves the information in a template KA The distance between two positions in the image can be measured bv pressing and holding the left mouse button down Kx deletes the information 9 1 Using Masks The software do

Digital Flexo Suite for Flexible Packaging 12.0 User Guide

Contents

Download Pdf Manuals

Related Search

Related Contents