LGCEN-40 88
Contents
1. Dimensions x L mm 38 2 x 105 7 Tube Type Adapter Tube per Rotor 6 Max RCF 6 597 radius mm 92 2 boring Q x L mm 38 5 x 90 Color Material Max length x L 38 5 x 110 gt lt gt 5 GoGl X ZI eSI X 0 VSI X Z S ISI X c9 S ISI XG 8E GIGI XOSE SISI XG9L SL X ZL OSLXEI 1X6 uiBue Xey OZ SLd1 Oc 0SH L L OOSHL L 0S8cH L L 00LH L v 0Su L 6 SIH lL 6 0IH L 6 Sd L ON IED enig Kei U9BID IEH JEN 10109 SS6 X ZI 06 X 0 LOL X Z 001 X c9 Gg v9 X G 8 9 98 X 0 G8 XG9l Y9 X Z4 VOXEL ww 1 x Buuoq 000 t rSL 000 v S 061 000 7 061 000 v 261 000 t S 68l 000 t S 68l 000 v S 681 000 v S 681 000 7 681 000 7 881 uidJ uw snipe SG z 80r 66 verve 06 06 06 06 L8E E 9 JOu XEIN v 8c ol v v 9 9 1010H Jad qn L Z L L y 1 1depv 1ed qn L Jo1depy C de adAL qn u ies Gu OND Ocl X ZI SLEX OE Sol X819 L S0L X 8 YOL X 6c YLLXO9L OO X 9 ww 7 XG suoisuauiiq V op SL 0S osz IWS8 001 0S GI 0l jur Aoede qn L yoedeo Uu00S LULUGG X DOE D H O wid OQ OQ yor e1jejd ow deeq pil 1uBn josoJe y2. L GCEN 405 USER MANUAL 3 Inspection of operation In case you open tube s lid for centrifugation by using a spin column please lean tube s lid against the edge of a rotor for exact centrigugation and make sure type of tubes are same and close the lid of rotor This instruction should be applicable just in case you use tubes provided according to purpose of kit manufacturer owing bucket rotor Make sure cleanliness of the inside of bucket and clean foreign substances with a dry cloth In case you use two buckets make sure the buckets are placed on a rotor properly and take a swing test manually Adatpers plates and tubes should be placed on a rotor symmetrically At this moment if volume of symmetrical tube is different a rotor and an axis of rotation can be damaged due to severe vibraiton during rotation 3 Safety Label attached to products A Mark indicating danger and waming Mark indicating a place in danger of electric shock Loads must be placed Symineiorically Warning In danger of injury due to asymmetric installation of a rotor Make sure a rotor is tightened up before start Make sure a lid of rotor is tightened up before start Make sure of tubes arrangement before start oame tube buckets and plates should be placed on a rotor symmetrically Make sure of use of adapters with suitable tubes or plates Make sure of use of same type weight material density volume of tube or plate all the time Make sure you chec
3. Material Max length Ox L LGCEN 408 USER MANUAL 6 Rotor and Accessories Guide A108 12 Rotor ID 2 Type Angle Rotor 736 Max RPM 8 000 rpm Max RCF 6 089 xg Radius 85 1 mm Dim O H 0179 9 x 82mm Tube Capacity ml Dimensions x L mm Tube Type Adapter Tube per Rotor Max RCF radius mm 85 1 boring x L mm 16 3 x 74 5 Color Material Max length xL 16 3 x 87 4 LGCEN 408 USER MANUAL 6 Rotor and Accessories Guide A15S 12 Rotor ID 4 Type Angle Rotor 725 Max RPM 8 000 rpm Max RCF 6 876 xg Radius 96 1 mm Dim O H 205 x 110mm Tube Capacity ml Dimensions Ox L mm 18x 100 Tube Type Color Material Max length xL 19 x 109 LGCEN 408 USER MANUAL 6 Rotor and Accessories Guide A1 5S 12C Rotor ID 8 Type Angle Rotor 725 Max RPM 8 000 rpm Max RCF 7 105 xg Radius 99 38mm Dim O H 219 x 122mm Tube Capacity ml 15 Dimensions Ox L mm 17x120 Tube Type Adapter Tube per Rotor Max RCF radius mm 99 3 boring O x L mm 17 x 115 Color Material Max length x L 17 x 121 5 LGCEN 408 USER MANUAL 6 Rotor and Accessories Guide A50S 6 Rotor ID 5 Type Angle Rotor 730 Max RPM 8 000 rpm Max RCF 6 876 xg Radius 96
4. R m 4 000 196 5 8 000 1157 8 000 7 076 8 000 6 097 2 3 8 4 Angle Rotors L GCEN 405 USER MANUAL 6 Rotor and Accessories Guide 6 2 Rotor and accessories A0 2S 48 Rotor ID 18 Type Angle Rotor 745 Max RPM 8 000 rom Max RCF 6 361 xg Radius 88 9m m Dim O H 0200 x 56mm Tube Capacity ml Dimensions Ox L mm Tube Type Adapter Tube per Rotor 6 tube Strips Max RCF 6 361 radius mm 88 9 boring x L mm 6 5 x 15 Color Material Max length x L LGCEN 408 USER MANUAL 6 Rotor and Accessories Guide A1 5S zs 24 Rotor ID 1 Type Angle Rotor 740 Max RPM 8 000 rpm Max RCF 5 81xg Radius 80 8mm Dim O H 0168 x 64mm Tube Capacity ml Dimensions x L mm Tube Type Adapter Tube per Rotor 24 Max RCF 5 781 radius mm 80 8 boring x L mm 11x375 11 x 37 5 Color Material Max length x L LGCEN 408 USER MANUAL 6 Rotor and Accessories Guide At 5S 36 Rotor ID 14 Type Angle Rotor 745 Max RPM 8 000 rpm Max RCF 8 279 xg Radius 115 7 mm Dim O H 0238 6 x 64mm Tube Capacity ml Dimensions Ox L mm Tube Type Adapter Tube per Rotor 36 Max RCF 8 279 radius mm 115 7 boring O x L mm 11 x 37 5 11 x 37 5 Color
5. 1 mm Dim H 204 3 x 110 mm Tube Capacity ml 50 Dimensions x L mm 28 7x104 28 8x 107 Tube Type Adapter Tube per Rotor 6 Max RCF 6 876 radius mm 96 1 boring Q x L mm 29 x 100 Color Material Max length Ox L 29 x 109 LGCEN 408 USER MANUAL 6 Rotor and Accessories Guide A50S 6C Rotor ID 6 Type Angle Rotor 423 Max RPM 8 000 rpm Max RCF 6 576 xg Radius 91 9 mm Dim O H 0206 5 x 122 mm Tube Capacity ml Dimensions Ox L mm 29x115 Tube Type Adapter Tube per Rotor 6 Max RCF 6 5 6 radius mm 91 9 boring O x L mm 29 5 x 108 6 Color Material Max length O x L 29 5 x 116 5 LGCEN 408 USER MANUAL 6 Rotor and Accessories Guide A50S 8 Rotor ID 7 Type Angle Rotor 230 Max RPM 8 000 rpm Max RCF 7 076 xg Radius 98 9 mm Dim O H 0213 x 110 7 mm Tube Capacity ml 50 50 Dimensions x L mm 28 7x104 28 8x 107 Tube Type Adapter Tube per Rotor 8 Max RCF 7 076 radius mm 98 9 boring x L mm 29 x 100 Color Material Max length x L 29 x 109 R Oz 408 USER MANUAL 6 Rotor and Accessories Guide A85S 6 Rotor ID 9 Type Angle Rotor 725 Max RPM 8 000 rpm Max RCF 6 597 xg Radius 92 2 mm Dim H 6198 2 x 109mm Tube Capacity ml
6. 76 col X 8 9 vO X 6c vIEXO9IL OOl X EL 0Sc 0S SL Ol SL yor d m deeq 0S Dil 1u60 joso1ey 0S4 Kyoedeo uu0S yeyong punoy 0Sc 0S SL WUGG x GOES ww S961 Bx Gic e wd 000 r 0067 10 0H Duis Ol H Q wiq snipey JOH Xen INdH Xen d L
7. Rotor sterilization and disinfection Rotor its lid and bucket can be autoclaved 121 C 20mins LGCEN 408 USER MANUAL 4 Cleaning and Maintenance 4 2 Maintenance 1 Check and clean a rotor used for a centrifuge 2 General check points Please check it out for the followings Shaft spindle hub do not separate a spindle hub or bend a shaft Check whether they are worn out e Motor bearing Check whether it makes noise or rotates smoothly e Control board Main board Check its connection and function Electrical connection Check whether its connection is loosened e Rotor Check whether it is cracked cleaned and worn out 3 Speed Install a rotor relevant to a centrifuge and set RPM Measure its actual RPM whith a tachometer 4 Time oet time as 10 minutes and measure it with a stopwatch 5 Imbalance senser system Check whether Imbalance Error message with warning sound comes out before RPM eachs to the appointed value in case you operate a centrifuge with a imbalanced rotor 6 Lid lock system 1 If you close a lid lock system operates and if you operate a centrifuge door light is off and lid does not open though you press DOOR button 2 f lid opens door light is on and a centrifuge does not operate 3 In case a lid closes and lock system is connected switch power off and insert T wrench 6mm provided into an emergenc lid hole of the front panel and turn it clockwise to open a lid manually 7 Wast
8. hexagon wrench after you install a rotor on a motor spindle When you take a rotor out turn a rotor screw counterclockwise with a hexagon wrench 1 Applying load to a rotor Tubes should be placed on a rotor symmetrically Recommended tubes should be only placed on a rotor Weight difference between tubes containg samples should be as small as possible to minimize noise and extend life of drive Same type of tubes should be placed on a rotor due to a reason of mechanical stability Clean rotor holes before you insert tubes Rotor tube rack adapter tube and adapter set recommended by manufacturer should be used Make sure that you place all the tube racks adapters properly and they moves well In case of big sze of tube take a swing test first with empty tubes Do not use rotor and bucket with a visible cossosion or mechnical fault 2 Tubes arrangement Angle rotor oame volume of sample should be put on tubes after you measure it exactly Tubes should be placed on a rotor symmetrically At this moment if volume of symmetrical tube is different a rotor and an axis of rotation can be damaged due to severe vibraiton during rotation Location of centrifuge tubes facing each other should be symmetrical even though tube s quantities are same If tubes are not symmetrical in quantity new tubes should be inserted to keep balance User is encouraged to use a scale to minimize the difference of volume between tubes containing samples
9. spindle inclined 2 Check voltage to be used before centrifuge is connected to power supply Wrong voltage can damage equipment 3 Use rotor provided by MRC Co Ltd and parts and accessories recommended MRC Co Ltd is not responsible for damages of equipmet and accidents caused by using parts and accessories not recommended 4 Understand property of matter fully and take needful safety actions in case you perform centrifugation of dangerous materials such as pathogenic toxic and radioactive substances 5 Remove contaminants completely and take needful actions such as ventilation or isolation of centrifuge in case centrifuge is contaminated with dangerous materials such as pathogenic toxic and radioactive substances 6 Do not perform centrifugation of materials capable of producing volatile and explosible steam 7 Do not operate equipment more than maximum RPM allowed by rotor installed 8 Do not decelerate or stop rotor rotating with hands 9 Rotor should be used after balancing of symmetry between weight of samples to be used 10 Rotor should be fixed into shaft and its lid should be tightened completely Otherwise the lid can be taken off during rotation 11 A trained and qualified technician should perform repairing directions not mentioning on this user manual 12 User should remove contaminants completely in advance in case user requests repairs to a qualified technician 13 Rotor and chamber should be kept dry all the time before
10. use of centrifuge to make long period use of centrifuge and maintain the best operating conditions 14 Pay attention that aluminum rotor has a chemical reaction and starts to be corrosive if aluminum rotor contacts laboratory cleaning liquid cesium silver and especially chloride ion of strong acid strongly alkaline or strong alkali L GCEN 405 2 Installation Directions 2 2 Installation directions Installation on hard and flat ground omooth air circulation Constant temperature and humidity Place unable to produce corrosive gas Balancing USER MANUAL Centrifuge should be installed on hard and flat ground In case centrifuge is located on inclined place spindle can be bent due to heaw weight of rotor as centrifuge is rotating in condition of spindle inclined for long period of time Centrifuge should be located in leaving 30 cm of room from both sides and the back for smooth air circulation Especially air circulation is not going smoothly if air vent on the case Is covered with cloth or blocked by other equipment Avoid dusty place to install centrifuge Centrifuge is influenced by external environment such as temperature or humidity as it is controlled by a high degree of electromagnetic controller Do not install centrifuge close to direct light or heater Keep centrifuge in proper temperature and humidity Install centrifuge on the place unable to produce corrosive gas Rotor and spin
11. 4 Chamber This is where a rotor is installed and it rotates 5 Lid packing This closes off between inside and outside 6 Rotor This is connected to a spindle and hangs adapters containing tubes and rotates 7 Controller This is where you can set up data such as RPM TIME Temperature and etc Power switch This is where you can switch ON OFF after you plug in 9 Emergency Lid Open system This is where you can open a lid manually in case of emergency such as power failure ohort circuit breaker This shuts off power supply in case of short circuit of wiring or overload tb Cooling fan This emits air out of the product LGCEN 408 USER MANUAL 3 Inspection of Operation CD Chamber This protects the inside of the chamber and a rotor from coming out in danger 2 Motor cover It prevents foreign substance from coming inside 3 Motor spindle This makes rotor rotate O X There is a concern you can get injured if you try to close a lid grabing by its sides with hands Accordingly put hands up the lid and push it down for about two 2 seconds Then operate equioment after you make sure the lid shut LGCEN 408 USER MANUAL 3 Inspection of operation Clean a motor spindle and rotor holes with a dry cloth before you install a rotor 3 3 Rotor When you tighten a rotor on a motor spindle temperature of a rotor and a motor spindle should be between 10 C and 30 C Tighten a rotor screw turning clockwise with a
12. Laboratory Equipment Manufacturer www mrclab com C Ne g Multy purpose Centrifuge Max Capacity 4X750ml Operation Manual LGCEN 408 PLEASE READ THIS MANUAL CAREFULLY BEFORE OPERATION 3 Hagavish st Israel 58817 Tel 972 3 5595252 Fax 972 3 5594529 mrc mrclab com MRC VER 01 5 14 Contents LGCEN 408 USER MANUAL 1 General Considerations 4 Cleaning and Maintenance 1 1 Components 02 4 1 Cleaning s 14 1 2 Using amp Storage Condition 02 DD MINE nee araeir aka tini viai DRE 16 2 Installation Directions 0 1 Sa ale tedulretmehlls ssashuwassashasu 03 5 51 Sete OBI aus 17 2 2 Installation directions esses 04 5 2 Additional Errors 18 PESCE Se 5 S uuu ns OE 05 2 4 Electrical requirements 06 3 Inspection of Operation 6 Rotor and Accessories Guide Ot Goa ecient uisum bendumi 07 6 1 Rotor specification table sss 19 93 2 Stnyeture GESCTIOT ONS sentseisaessnnacncsnansins 07 6 2 Rotor and accessories Q 20 De DOLO rn ee eee DD EE 09 SA Funcion IGGL seirene 11 3 5 DeetboclorjS duussssresuesssusUunpevaseuasazxsbsasksmns 11 LGCEN 408 USER MANUAL 1 General Considerations As a bench top centrifuge user manual is for who leams equipment for the first time This user manual gives informaton of troubleshooting amp maintenance and precaution amp
13. PM RCF gt button and input the desired RPM by using numerical key and press ENTER button Press lt TIME gt button and input the desired time You can set time up to 1 hr 59 min 59 sec and it moves in order such as hour minute and second by pressing ENTER button You can set time at desired mode by using numerical key Press lt ACCEL gt button and input the desired acceleration step by using numerical key and press ENTER button Press lt DECEL gt button and input the desired deceleration step by using numerical key and press ENTER button Set all the desired values and press SAVE button oelect number to store programs by using numerical key You can select Number to store from O to 99 You can complete save mode by pressing ENTER button In standby mode press lt RPM RCF gt button and input the desired set value by using numerical key In case the initial screen indicates the mode of inputting RPM the screen indicates the mode of inputting RCF by pressing lt RPM RCF gt button twice briefly In standby mode press TIME button and input the desired set value by using numerical key You can set time up to 1 hr 59 min 59 sec In operating mode you can set TIME 1 In standby mode you can check current time by pressing TIME button for about three 3 seconds 2 Method of current time setting In standby mode Check RTC gt is displayed on the screen by pressing TIME button for about three 3 secon
14. dle can be corrosive and metal parts can be damaged if centrifuge contacts pyrosulfuric gas and chloric gas Centrifuge should be leveling for spindle of equipment to be vertical to the ground Balance a centrifuge by using a water level if required L GCEN 405 USER MANUAL 2 Installation Directions 2 3 Check points Check any damage of goods very carefully after arrival of centrifuge Contact MRC Co Ltd immediately if damages found You can get contact details on outer cover of manual Do not open a lid manually when a rotor is rotating Do not use emergency lid lock device except emergency Do not operate equipment more than maximum RPM allowed by rotor installed If centrifugal force more than allowable tensile strength is applied to a rotor corruption or break of rotor can happen as its shape is designed as per its allowable tensile strength 1 Short circuit breaker is installed into a centrifuge 2 If overload or overvoltage flow from a centrifuge voltage is cut off to prevent it from damage by thunderbolt or overvoltage Short circuit breake 1 If alid opens rotation of rotor stops rapidly by a lid control sensor and if a lid does not close equipment does not work 2 Automatic lid lock does not open during operation expect intentional open by tools Lid lock system 1 If a centrifuge moves seriously out of balance more than a certain standard during rotation of rotor motor also moves At this moment a ce
15. ds Then press ENTER button and input current date amp time and press STOP button In standby mode press lt ACCEL gt lt DECEL gt button and input the desired step of acceleration deceleration by using numerical key and press ENTER button NOTE Step of acceleration deceleration is O 9 0 is the slowest step and 9 is the fastest step and 0 is natural brake when decelerating Recommended step of acceleration deceleration is 5 LGCEN 408 USER MANUAL 3 Inspection of operation 8 Manual Rotor Recognition A If you press lt ROTOR gt button for about three 3 seconds in standby mode rotor ID is recognized at 100rpm Do not change rotor ID intentionally as rotor ID provided by MRC is recognized automatically 9 PULSE RUN MODE 1 If you press lt No 5 for about five 5 seconds PULSE RUN mode comes up 2 Centrifuge runs by RPM of standby mode for example if the display show 4000rpm a rotor goes up to 4000rpm and it decelerates immediately You can use PULSE RUN MODE after you set a particular RPM for using the particular RPM 10 Automatic Rotor Recognition If you press START button rotor ID is recognized automatically Accordingly centrifuge distinguishes automatically and decides whether it operates or not after it compares with the initial rotor ID If rotor ID is different each other input the current rotor ID by pressing lt ROTOR gt 2 button for about three 3 seconds 11 Trial operat
16. e disposal This centrifuge should not be scraped for household and you are forced to comply with local wastes laws LGCEN 408 USER MANUAL b Troubleshooting 5 1 Waning light Not reach to 200RPM within 2 Check connectors Check a lid lock chain and lid plate Door open error A lid opens during operation Switch power on otf alter it stops Operate it again T Check temperature of motor stator SUC TRE 20 C 5 C Increase im tie inside tTempenrdiune Switch power off and leave it for of motor l am hour and operae i aii Lack of bimetal cable Check electrical requirements of an outlet Below 10 of set RPM during Switch power on oll and operate pasan operation Switch power On Ol and operate it again Over speed RPM 109 Over 10 of set RPM during Contact MRC customer service center operation Switch power on off and operate it again System error Sy jcHirrOr im controller 3 AE Asymmetric arrangement of tubes Check whether a rotor is tightened Asymmetric arrangement of tubes completely Imbalance error Irregular sample volume of tubes Check whether tubes are arranged Rotor is not tightened completely properly on the motor shaft Check whether equipment is installed on the safe worktable e Error in reduction motor or lack Ched conme tor Lift door of cables f Open a lid manually through an emergency lid does not open after operation Jd hole x ih a T wrench finishes Pes A sa pen a lidl reet through an emo Do
17. instruction for user to start equipment Read this user manual carefully to make full use of performances Keep this user manual on a convenient place so that you can refer to it immediately when you need explanation about particular function of equipment or you face difficulties This user manual shows notice for safety instructions Read this user manual before you control equipment and follow instructions 1 1 Components Main body User manual Hexagon wrench Packing Inspectio 1 Check packing conditions very carefully after arrival of centrifuge 2 Contact MRC Co Ltd immediately if damages found 3 You can get contact details on packing boxes and outer cover of manual 1 2 Using Using condition amp Storage Condition Room temperature within 5 C 35 C Maximum relative humidity 3096 85 Air pressure 500 1060 hoa Storage amp transportation condition Surrounding temperature 10 C 40 C Relative humidity 1096 9096 Air pressure 500 1060 hpa LGCEN 408 USER MANUAL 2 Installation Directions 2 1 Safety requirements Centrifuge involves elements of risk all the time as it utilizes a high speed body of rotation Follow precautions and all the safety requirements described on this user manual to prevent any damage and failure of equipment and loss of lives 1 Centrifuge should be placed on flat place to maintain level Big vibration is caused by operation of equipment in the condition of
18. ion sequence Trial operation sequence Store program No 2 with trial set value gt S750T 4B No 13 4000RPM 1min acceleration 5 deceleration 5 START Circuit breaker Switch on the circuit breaker on the back of equipment POWER S W Switch on the power on the left side of equipment Install a rotor and accessories on equipment after you clean foreign substances on a rotor and spindle Make sure that a locking bolt of a rotor should be tightened completely Press lt RPM RCF gt button and input 4000 by using numerical key and press NO a lt ENTER gt button Press TIME button and press ENTER button to move to input mininute and input 1 Then press ENTER button twice aa Press lt ACCEL gt button and input 5 by using numerical key and press ENTER button Press lt DECEL gt button and input 5 by using numerical key and press ENTER button Set all the desired values and press SAVE button and input 2 by using numerical key and press ENTER button e Press lt START gt button after you check set values with the naked eye Rotor Automatic Rotor Dis recognized automaticaly and centrifuge stats to run Recognition LGCEN 408 USER MANUAL 4 Cleaning and Maintenance Emergency lid In case a lid closes due to power failure activate emergency open system lid open system manually 1 Switch off main power Wait till a rotor stops through RPM measuring window 2 As the below picture
19. k balance of adapters tubes or plates Do not give any impact on operation by using a scale and they become symmetric L GCEN 405 USER MANUAL 3 Inspection of operation 3 4 Function test Perform a normal test toward maximum speed of a rotor Check out whether equioment works under a lid open and whether a lid opens during operation 3 5 Instructions 1 Controller a 2 RPM RCF LGCEN 408 BLDC LE mS gu System Setup DECEL ROTOR e l a ww lt Display gt mminayaiqamaayaisqyiwasqapaaiqa O information operating condition is displayed gie tee This button is to Ts button is to input RPM Itis alowed to input maximum amp 000RPM RPM It is allowed to input maximum 8 000RPM TIME This button is to input TIME It is allowed to input maximum 1 hr 59 min 59 sec lt ACCEL gt A gt It is allowed to input 10 steps of acceleration and input 0 to 9 by using numerical key ACCEL lt YES gt lt 9 is the fastest Step lt DECEL gt 01 5 It is allowed to input 10 steps of deceleration and input 0 to 9 by using numerical key S NO lt Q is the fastest step KEE U lt ROTOR gt This button is to input rotor data l lt START gt This button is to rotate a rotor lt STOP gt This button is to stop rotating a rotor D DOOR This button is to open a lid LEM ERRASSE asa KE JSK s jew o w LGCEN 408 USER MANUAL 3 Inspection of operation 2 Saving programs Ge Press lt R
20. ntrifuge senses a danger by measuring vibration of motor and stops with an alarm This safety system prevents unexpected accidents while an experimenter is out after starting a centrifuge Abnormality of vibration L GCEN 405 USER MANUAL 2 Installation Directions Follow a rated voltage marked on the label of equipment for normal operation of equipment Contact a local electric utility company or customer service center marked on the outer cover of manual to check whether power supply in use is appropriate for a rated voltage of equipment 2 4 Electrical requirements Warning This product must be properly earthed Product is provided with plug including earth pin and this plug can be inserted to earthed system of electric outlqt In case this plug is not applicable to outlet in use change to earthed system of electric outlet At this moment be careful you do not receive an electric shock and contact an experienced eletrician if required Do not use earthed system of adapter plug for electric outlet without earth terminal Install an emergency switch on a distant place from centrifuge to disconnect power supply in case error happens It is good to be placed on the side or the outside of the exit of laboratory According to IEC61010 2 020 30cm of a safe distance around centrifuge should be assured during operation Nothing should be put on this safe distance in case it is destroyed N Electric salely Use a power cord
21. only provided with equipment information Do not use an extension cord Contact an experienced electrician in case you check earthed system of electric outlet You can receive an electric shock if you connect an earth wire of equipment wrong Install equipment not to be stepped on a power cord Do not put anything on a power cord Do not block a ventilating opening Do not insert anything into a slot or hole of equipment If you have the following emergencies shut off the power supply and pick out the power cord from outlet and contact our customer services Abnormal sound or smell from equipment Damage or wear of a power cord Breakdown of circuit breaker fuse or safety device If you spill liquid on equipment If equipment 1s exposed to water If Some of equipment has been damaged L GCEN 405 USER MANUAL 3 Inspection oft Operation 3 1 Specification Max C entrifugalr elative force Swing Rotor 3 515xg Fixed Angle Rotor 8 2 9xg Acceleration 10 steps Power consumption AC 220V 60Hz Single Phase 2 3KW Programmabili ty 100 Pr ogram m emories Weight 70Kg with S750T 4B B750 61Kg without S750T 4B B750 3 2 Structure Descriptions 1 Appearance CD Lid Lid protects the inside of the chamber and a rotor from coming out in danger 2 Lid lock This is a fixed part to keep the lid shut 3 RPM measuring window This is a part measuring speed of rotor by a digital tachometer
22. or can cause deformation of a shaft Then keep it dry upside down n case a rotor does not be pulled out of a drive shaft do not try to take it out by force Pull it out with tools that can ease pulling out 4 Rotor CD Corrosion of rotor and surface treatment f a rotor is exposed to acid or basic liquid it gets damaged In case rotor weight is imbalanced due to corrosion serious vibration and noise can happen when high speed rotating Furthermore it can damage a drive shaft e Rotor has good corrosion resistance in the atmosphere but its corrosion can be influenced by humidity salt content and impurities volume in the atmosphere Rotor is resistant to neutral aqueous solution such as carbonate chromate acetate and sulfide but it is not well resistant to chloride solution Also its corrosion is getting faster due to increase in hydrogen ion concentration and it is eroded by sulfuric acid and phosphoric acid and especially it is eroded faster by hydrochloric acid 2 Rotor maintenance e Cleaning In case a rotor is exposed to sample coming out of tube clean it with a soft cloth soaked with warm water immediately At this moment make sure do not scratch the surface specially treated Drying Keep a narrow groove of a rotr dry with care Hair dryer will be more effective for drying Keeping Keep a rotor on a clean and dry place Especially a lid of angle rotor should be separated and keep its body upside down 3
23. or lock error Lacko enor eps Woe witha L sr chun operare it again Check connectors Install a rotor again No rotor f f Remove foreign substances on rotor Unknow Rotor ID Error n drive or rotor sensing and sensor Apply methyl alcohol 99 to Rotor is not detected cotton swab Foreign substances on rotor and sensor Make a rotor detected repeatedly Ej Imb Not Connect E4 Low Speed RPM 71096 D m error imn imbalance sensor or lack ot cables o Check comnmnectors If you are not satisfied with the above troubleshootings contact MRC customer service center L GCEN 405 USER MANUAL bD Troubleshooting 5 2 Additional errors Check power supply cable Ns s Main power is not switched on Check main power fuse in the lab and main power fuse O alsplay Display cable is disconnected of equipment Check display cable No storing of program Contact MRC customer service center No braking Contact MRC customer service center Reaching to above or below Error in setting values of main Contact MRC customer service Genter o set RPM during accelerating board l Tight contact of between No pulling out a rotor rotor and spindle hub due to Contact MRC customer service centers poor cleaning L GCEN 405 USER MANUAL 6 Rotor and Accessories Guide 6 1 Rotor specification table Swing Rotors Capacity Rotor ID 750ml S 50T1 4B razon Eo XOT Conical ATSS T2c E MAX RPM MAX
24. turn a hole on the center of the front panel clockwise with T wrench 6mm to open a lid 4 1 Cleaning 1 Equipment outside Clean the outside of equipment with a soft and dry cloth If the outside of equipment is contaminated clean it with a soft soapy cloth Then clean the outside of equipment with a dry cloth to remove water Do not use chemicals such as alcohol benzene and thinner that can damage products Clean the damaged part with a cloth soaked with a good quality of a neutral detergent Make sure do not scratch the surface of equipment when cleaning it Do not use a metal sponge Make sure do not scratch the surface of equipment when moving it Equipment can be rusty if the surface of equipment is scratched If equipment becomes rusty as it is left with water for long after use remove rust with a neutral detergent and clean it with a dry cloth 2 Equipment inside Clean foreign substances on the inside of chamber or samples flowed out with a dry cloth to keep it clean LGCEN 408 USER MANUAL 4 Cleaning and Maintenance 3 Drive shaft Drive shaft of centrifuge should be kept clean In case rotation of shaft is unstable due to foreign substances imbalance happens during high speed rotating Take a rotor out of a drive shaft and clean it with a dry cloth to remove water after use and keep it dry e n case you do not use centrifuge take a rotor out of a drive shaft and clean it with a dry cloth as a rot
25. yeyong punoy t WW 761 snipey Bx 04v JOH Xen Oo pee u V o udi 000 7 Wdt Xen Ps o kunsa 9 067 J0 04 bums d L UJ z dc dy O cbs diced qr L00SS BE r o LGCEN 408 USER MANUAL od Io Gu 6 Rotor and Accessories 8vL X v4 SrL X c9 SrL X 6c SVL X C ZL 8SvL X GEL 8vLXEL oGl X ZL S 9vL X G 6c 894 X 66 GGL X GGL SS X c c9 GYL X c 6c ISL X ZL S cSL X L Gesl X El L OOSL L 0Sc L v OSL Zb ShL ve OlL 0 SL OrLI SLL S 0S 1 L 00S L L 0Sc L Z 0S L 6Lr SLL 9c 0LL 9c SL enigq ped eiuM u i MO 9A n g HyM Usa MOJI A 08 X vZ 08 X c9 08 X 6c 08X 7Zl O8xGel SSXEI 68 X ZI 9 66 X Sg 6c SOL X 66 66 X GGL 66 x c c9 I8Xc 6c S 66X ZL S 68 X L OLX EL 000 v G 91 00 v G 981 00 v G 981 00 v G 981 00 v S 981 00 r S 98L 00 v G 981 000 v 8 06L 000 7 6L 000 896 000 v 6L 000 v 9 6L 000 v 8 8l 000 7 26 L 000 v L61 000 7 6 161 Gc6c 9 9 9cE gece 9ze e gee e ElVv e oSV e GIG E g8sr egr e 88z e vere LLy cere r r r 94 6c ora 9S 0c L r r 8c vOl vOl L L ve vl S Z 9c 9c Eck X 819 vO X 6c YLLXOL 00L XEL Och X ZL SLLX OE oGl X
Download Pdf Manuals
Related Search