Home

High-Tech Communications

image

Contents

1. E Internet Protected Mode On Copyright April 2010 J Carlton Collins CPA all rights reserved 62 High Tech Communications www CarltonCollins com FaceBook Discussion Points 1 FaceBook Statistics General Growth More than 300 million active users 50 of our active users log on to Facebook in any given day The fastest growing demographic is those 35 years old and older User Engagement Average user has 130 friends on the site More than 6 billion minutes are spent on Facebook each day worldwide More than 40 million status updates each day More than 10 million users become fans of Pages each day Applications More than 2 billion photos uploaded to the site each month More than 14 million videos uploaded each month More than 2 billion pieces of content web links news stories blog posts notes photos etc shared each week More than 3 million events created each month More than 45 million active user groups exist on the site International Growth More than 70 translations available on the site About 70 of Facebook users are outside the United States Platform More than one million developers and entrepreneurs from more than 180 countries Every month more than 70 of Facebook users engage with Platform applications More than 350 000 active applications currently on Facebook Platform More than 250 applications have more than one million monthly active users More than 15
2. File Options View Help Screen 00 00 Show My Stop Change Keyboard Presenter Screen 64 1 GB remaining Settings Attendee List 4 Max 15 amp TE NAMES ALPHABETICALLY r tN Karen Lynx Organizer Presenter Me Louise Dobsen John Jacob Vanessa McBride PETA Eime Audio Audio Mode Use Telephone O Use Mic amp Speakers Dial 605 722 3715 Access Code 430 746 386 Audio PIN 53 If you re already on the call press 534 now eeting Name Meeting ID 626 343 443 GoToMeeting 173 High Tech Communications fa Microsoft Office 2003 Launch Conference Center File Edt View Inset Help eo g 4 eu aia Great_Moments Slide 45 66 Web Side A A Nordea X Business Process Evolution H InfoPath H Business Automation FH Transforming Information Work X Managing Email A Our Commitment to Information A Microsoft AH Great Moments in Work H The Next Great Moment at Work H Top Great Moments A Today s Challenges X Ongoing Investments Z Information Worker F Slide 53 Z Slide 54 amp Slide 55 amp Slide 56 a Previous Next Attendees 11 E Not Recording No Questions www CarltonCollins com ny e New York Microsoft Office Live Meeting Microsoft Windows SharePoint Services Microsoft Office Live Meeting Chapter 20 Copyright April 2010 J Car
3. The Distracted The Neverending There are always those who easily become distracted while on the phone with things like internet TV or other duties Conversation gr Out of politeness one or both of you will keep a What was that noise Are you at conversation going way past its expiration date a wategslide park love waterslide parks on YEAH it s a waterslide alright A wad mexican food waterslide Jivva vlae vlah Vivvita vlagg LoL vlarty vlam ome vlarty vag RA RA Wut Hours later ioe jug jav ee vluhin vlag 2 2222 vluggit i vlig voluggity j The Lecturer Cry v mhhhh ane BED on To some people the phone is an opportunity to lecture not to converse Usually you can just set the phone down and they won t even notice The Anxious blah vlah vlah Raisins vlah vlah vlah If you re like me you can t relax on the phone because lightning stoains vlah vlah wlah waffles you re constantly looking for an opportunity to say goodbye vlatg vlah wlah wlah cat torpedo vlah vlah vlah mango scented candles wlah wlah wlah ditagons ulah ulah wlah wlah ulah wlah lah lah vlah vlah wlah 0 that s Why don t eat cantaloupe anymore Neat Carl So anyway appreciate the call Hey you ever try ollegilading in the nude it pretty much changed my life Beats the hell out of yoga Cool yeah VIL look into it Well it s ween nice chatting with My ju
4. Copyright April 2010 J Carlton Collins CPA all rights reserved 20 High Tech Communications www CarltonCollins com Major Factors in Hermann s Typologies of The Four Selves Cortes Te Feu daar Es E its a ene j on a feet la ee a A Left cerebral gaiher facts analyze ie veg prablem solve logical y argue fatigaially maasume precaaly uTidwestantd technical Aen ats consider finascal aspects Sorcateen E Left Limbs find overiguked kawg appro h pran s oracticaly stand fimm oF isaues manii a gandard af consistancy provide stable bead rsh p and supervision read fina print it documents andor contracts develop defaied plans and procedures maena projects in tmely manner artiqukate para in order way kaet trangia records stra ght aganaga built ov Copyright April 2010 J Carlton Collins CPA all rights reserved Gtobus Patlidus 2 Ly yor La ZA ge A EE Seet few O Right cerebral aea the big piciu e tolerate ambig Lily read signs of coming Hange Peg ite new poss bilities modem soye i rtenive ways irdegrate dees and forces bendfehalicnga established polishes synthesize unlike elements into ney Wa Pcl Graie Slew C Right Lembic engl Ate persuade leach gans ce Alles engender arthusias reco ZA interpereonal ASL hos understaac cmolional taments gn cipate how others will feel intulively undergtard how others feel pick up nat warda CLE OT in
5. a F 12 Evaluating Body Language Judging And Deciding About Something Copyright April 2010 J Carlton Collins CPA all rights reserved 30 High Tech Communications www CarltonCollins com Power Body Language Demonstrating One s Power r r 3 L a f l J j i i j lt D y a Serious expression Looking down nose Looking over glasses Steepling fingers Crossed arms Fist pumping Leaning in without smiling Ready Body Language Displeased With What They Are Hearing Grimacing Eyes shut Scratching Looking away Lips pursing Teeth gritting Silence Relaxed Body Language Comfortable And Unstressed Big smile Comfortable posture Legs crossed Fingers interlocked Aror arms up Romantic Body Language Showing Attraction To Others A 7 Slight smile not showing teeth Whispering Giggling Winking Touching hair or face Getting close Copyright April 2010 J Carlton Collins CPA all rights reserved 31 High Tech Communications www CarltonCollins com The Most Important Non Verbal Signal When it is all said and done there is one key piece of body language that stands out from all the other signals and that key is a smile If you want to come across to others in a positive manner make sure you smile If you study the pictures above the smile is the single most important factor that dictates whether a person is projecting a negative devious bored cautious uncaring
6. As of early 2010 the iPhone only runs on AT amp T networks However expected in the summer of 2010 Apple iPhone s will be available for Verizon customers Copyright April 2010 J Carlton Collins CPA all rights reserved 161 High Tech Communications www CarltonCollins com iPhone vs BlackBerry vs Droid BlackBerry howe Cona r i T g Dinar As mobile phones continue to improve three of the top monster cell phone s out there are the older Blackberry the newer iPhone and the brand new Google Droid Here is a brief look at these three smart phone options Will the latest Android 2 0 based iPhone killer kill the iPhone Is the cheaper HTC Droid Eris smartphone what Apple should be concerned about There are now six smartphones on the market that will appeal to business and professional users each with different strengths and weaknesses as follows aS Se i Apple iPhone HTC Droid Eris Motorola Droid Palm Pre Research in Motion BlackBerry Bold RIM BlackBerry Storm 2 PC World s buying advice is simple as follows 1 f you want a mobile device that takes full advantage of Web connectivity applications and personal media that you can also use for business connectivity such as e mail and calendaring get the iPhone even with the inferiority of AT amp T s 3G network If you re subject to high security requirements such as for regulatory compliance need to manage lots of devices or just ca
7. always on meaning customers can receive Skype calls instant messages and see friends presence anytime Skype usage won t be charged against customers monthly Verizon Wireless data plans or minute allowances Copyright April 2010 J Carlton Collins CPA all rights reserved 46 High Tech Communications www CarltonCollins com 22 As of January 2009 Skype is available for Android and over 100 Java enabled mobile phones 23 Skype has become the largest international voice carrier International computer to computer traffic between Skype users in 2005 was 2 9 4 4 in 2006 and about 8 in 2009 24 Skype is a secure communication encryption cannot be disabled and is invisible to the user Skype reportedly uses non proprietary widely trusted encryption techniques RSA for key negotiation and the Advanced Encryption Standard to encrypt conversations 25 In October 2008 it was revealed that Skype sends content of text messages and encryption keys to monitoring servers So governments are listening in Skype Milestones April 2003 Skype com and Skype net domain names registered August 2003 First public beta version released September 2005 SkypeOut banned in South China October 2005 eBay purchased Skype Oct 14 December 2005 Video telephony introduced April 2006 Number of registered users reaches 100 million January 18 2007 Skype changes pricing structure charges for all S
8. ASA Research High Tech Communications Master the New Technologies that are Changing the Way We Communicate J Carlton Collins ASA Research Atlanta Georgia T 770 734 0950 _ASA RESEARCH Carlton ASAResearch com High Tech Communications www CarltonCollins com High Tech Communications for CPAs Table of Contents Course NITICIIVAUIOUD tise gec seer aces ana acancncacooeneesteoeaseaicadasseatsAdansearacieaeatasensessaqananentuanteeaeae 3 1 ARNO UC CO N eane EE EE E 6 2a OVE U NEW e E E E EE E E E 11 Bis HOW WO EO ii eesi E E E N 15 A Non Verbal CommMmMUnNICAtION S sssrin E 23 5 Low Tech Communication MethodS seseessseessserssserrssrerssresssrresseressreessereseereses 34 6 Voice Over IP amp Video Conferencing s eseessseessserssseersseresrrerssrresseressrerssrreseereses 37 7 Remote Desktop CONtrOl wisecessdacuceswacavendescsaiendsiacnespesqeevadesestwsadedy R 52 Bs Social NetWorkiNg sscensecte ewe sacaddencariviaesvectecwesesbadus vena r naair ennai 62 T Sle LC CII ON oera E 63 De EKEGREN set 75 C PIO a E E E a a a 79 d TN O a cs E A EE E E A A E 81 9 High Tech KIOSK essari A E 83 O vey lUO a a E E E A 90 TL MIO ORE TOP at eranen E E AEAEE 96 EZ Instant MessagiNhg carers cenaiensaaatenaeenasaniateatenendesaenatnasaneantaanseneaanedenteauteenaes odes Ei 101 13 COMMUNICATIONS Equipment ssisscaissasscnssrresanssannsenndsreserersnesunesconedesasedecssnnedeeesas eras 107 14 Building A S ccessful
9. By J Carlton Collins Thousands of CPAs and many state CPA societies are now using Facebook to help establish and maintain relationships even the AICPA now hosts a highly active forum on Facebook As more CPAs continue to embrace this new venue privacy concerns are on the rise In particular Facebook s new default privacy settings introduced in December 2009 makes most of your FaceBook content viewable by everyone In the wake of these dramatic changes CPAs need to adjust their Facebook privacy settings in order to protect their information This can be a rather difficult task for two reasons as follows 1 The FaceBook privacy settings are scattered throughout Facebook CPAs must visit multiple areas in order to change those settings and this can be a confusing process 2 In some cases Facebook offers conflicting privacy settings in two different areas and when this occurs Facebook obeys the less restrictive setting unlike Microsoft Windows which obeys the more restrictive setting For example if you restrict the visibility of a photo but fail to also make the photo album private then the picture may still be visible To help you protect your FaceBook privacy this article provides a list of twelve privacy setting adjustments you should consider 1 Friends Only CPAs should consider changing all of their settings throughout FaceBook to Friends Only This measure will help ensure that the only people that can see your Faceboo
10. Carlton Collins Atanta City carlton collins hp Language All languages x carltoncollins Debbie Forrester Desiree Knight 99 people on Skype 1 people on MySpace Diana Valldejuli Meacham Full name Skype Name Country Region Marie Hall fred amfredy United States newyork mary lou collins Fred araiguma666 Japan Tokyo Mary Lou Collins HP Fred bartho fred FE Belgium bruxelles eae Fred bbcc401 E China SL Age range All Choose the person you re looking for and click Add Contact Call phones 4 Directory Shop To search for a person simply enter their name and click the FIND button You can also add users from Outlook MySpace or phone numbers in your contact list Notice that there are many search options which allow you to narrow your search For people interested in potentially dating through Skype simply leave the name field blank and search for persons of a specific gender age country state and city You can also add MySpaceIM contacts Enter their MySpaceIM name and click Find Country Region United States Gender State Georgia Do not specify Age range 33 39 City Norcross Choose the person you re looking for and click Add Contact Full name Skype Name Country Region Profile Tamara Waller tamara Waller f United States Norcross Copyright April 2010 J Carlton Collins CPA all rights reserved 48 High Tech Communications ww
11. Priced by tier attendees attendees attendees Mac and PC Compatible Sf vi vi Essential Features va vi va Desktop or Application Sharing va vi va Instantly Change Presenters vA vi vi Share Keyboard and Mouse Control vA vi va One Click Recording va vi va Drawing Tools vA vi va Includes Audio Conferencing va vi va via telephone and computer Instant Online Meetings vA v va One Click Meetings Sf vi va Schedule in Advance or Meet Now va vi va Start Meetings from MS Office Email and vA vi wa Instant Messaging Tools Audience Management v v Customizable Invitation and Registration vi wa Automated Reminder and Follow up v wa Emails Polls and Surveys vi vi Attendees Raise Hands J vi Dashboard to Monitor Attendee v wa Participation Detailed Reports pre and post session vi va Large Group Events vi Invite Guest Panelists vi Audio Subconference vi Monitor Q amp A v Practice Sessions vi rehearse your presentation Interactive Training va Online Course Catalog Sf Configurable Class Size vi Tests and Materials before during and vi after Content Library store tests and materials v Break Timer count down break minutes va Share Recorded Sessions Online vi Flat Fee Pricing per Organizer Starting at Starting at Unlimited sessions A9imo or AGBiyr 99 mo or QABiyr 449 imo or i 428 iyr Integrated audio conferencing View Pricing View Pricing View Pricing Copyr
12. b ei Telephone calls do not result in a hard copy of notes that can be refereed to later Both parties must be available at the same time There is a cost to phone calls particularly long distance phone calls Disadvantages of Face to Face Meetings Studies show that most people consider face to face meetings to be a huge waste of time The cost of meeting space Documenting the information conveyed in a meeting is often labor intensive and time consuming Finding time slots where all parties are available can be tough to accomplish Physically bringing people together can be costly especially where airfare is involved Dynamics of Face to face meetings can be anti productive one person may dominate the meeting while others are afraid to speak up Exchanging information at a meeting often does not give recipients adequate time to read digest and prepare to discuss the information The focus of this session is to suggest that technology now offers us many new ways to communicate and these new communications can often save money save time and produce better results Copyright April 2010 J Carlton Collins CPA all rights reserved 12 High Tech Communications www CarltonCollins com Why Focus on Communications believe that everybody fully understands the importance of focusing on communications no explanation is really needed Nonetheless just to ensure that these materials are complete here are a few reasons why
13. eaan a In most cases the Wireless Channel B 2442GHZ acvanced celia on Wires Snin Enabled Disabled this screen should Broadcast remain at their default values More Cisti Systems Cancel Changes Save Settings 6 Do Not Auto Connect to Open Wi Fi Networks Connecting to an open Wi Fi network such as a free wireless hotspot or your neighbor s router exposes your computer to security risks Although not normally enabled most computers have a setting available allowing these connections to happen automatically without notifying you the user This setting should not be enabled except in temporary situations Here s how To verify whether automatic Wi Fi connections are allowed open Control Panel Click the Network Connections option if it exists otherwise first click Network and Internet Connections and then click Network Connections Right click Wireless Network Connection and choose Properties Click the Wireless Networks tab on the Properties page Click the Advanced button Find the Automatically connect to non preferred networks setting If checked this setting is enabled otherwise it is disabled 7 Assign Static IP Addresses to Devices Most home and small business networks use dynamic IP addresses because DHCP technology is easy to set up and use Unfortunately this convenience works to the advantage of network attackers who can then obtain valid IP addresses from your n
14. Camera The iPhone 3GS has a 3 2 megapixel camera manufactured by OmniVision featuring autofocus auto white balance and auto macro up to 10 cm It is also capable of capturing 640x480 VGA resolution video at 30 frames per second although compared to higher end CCD based video cameras it does exhibit the rolling shutter effect The video can then be cropped on the device itself and directly uploaded to YouTube MobileMe or other services The older iPhone and iPhone 3G featured a built in Fixed focus 2 0 megapixel camera located on the back for still digital photos It has no optical zoom flash or autofocus and does not support video recording however jailbreaking allows users to do so Moisture Sensors Like many modern electronics devices the iPhone has moisture sensors to indicate whether water damage has affected a device The sensors on an iPhone include a small disc located in the headphone jack and an area near the dock connector The sensors are often used by Apple employees to determine whether the device qualifies for a warranty repair or replacement and if the sensors show that the device has absorbed moisture they may determine that the device is not covered However the moisture sensors might be tripped through routine use and if a device is worn while exercising the sweat from an owner may dampen the sensors enough to indicate water damage On many other mobile phones from different manufacturers the moisture sensors are
15. Copyright April 2010 J Carlton Collins CPA all rights reserved Pee MY PC G Internet A RORE 11 44 4m 180 High Tech Communications www CarltonCollins com In this SharePoint web site shown above the tasks have been set up to prepare 24 chapters on an accounting software system You can see all the chapters listed as separate tasks along with an indicator as to percentage complete Below you see the home screen in which the participants are listed the shared documents are available the tasks to be completed are accessible and links to relevant information is provided Z http portal boxlink com Home SBA Team Web Site Microsoft Internet Explorer File Edit View Favorites Tools Help Q sack z h x a A s Search Pe Favorites 4 2 K LJ 3s Google microsoft live meeting v P Search Web GH PageRank f2 Autor Options E microsoft QJ live G meeting Links 4 1 Googe 4 Home SBA Team Web Site Administration 4 One Liners AdvisorCPE asa boortz carton 4 Consulting 4 Control Center Sign In Shared Documents v Members Type Name Modified By Administrator m HDR FINAL Chap 11 Cash Management Yogi m test Leonardo Atienza mw HDR FINAL Chap 2 Users and Security Yogi wh HDR Figure 2 3 Original Yogi W HDR Table 2 3 Original Yogi Team Exec wi Backup and Data Utilities Carlton Yogi m Financial Reporting II Carlton mw Financial Reporting
16. Dell B Austin Drudge Riverfield Movies A Test10 yp Portfolio Google lig Weather 8 Boortz Th Mike w we BB yf Proxy Lists Sorted by type Setup Setup 2 fp y Ay wm vl a s peed Stream 2604 Password LAN The password protects the configuration data Password Once set recommended you will be prompted for the password when you Saha nisi P Advanced TN maisia Verify password ceceo 2 Turn on WPA2 or WPA Encryption All Wi Fi equipment supports some form of encryption scheme as follows WEP Wired Equivalent Privacy Found to have serious shortcomings in 2001 WEP 2 Also found deficient WEP2 mutated into TKIP WEPplus Lucent s attempt to correct WEP shortcomings but this fell short Dynamic WEP 3COM s attempt to correct WEP shortcomings which fell short WPA Wi Fi Protected Access the answer to WEP WPA2 0 Better than WPA but does not always work with older devices WPAPSK TKIP Software driven WPA2PSK AES Hardware driven WPA2PSK TKIP Software driven za moans Encryption technology scrambles messages sent over wireless networks so that they cannot be easily read Several encryption technologies exist for Wi Fi today Naturally you will want to pick the strongest form of encryption that works with your wireless network However the way these technologies work all Wi Fi devices on your network must share the identical encryption settings
17. For the best results add information weekly or even daily to your web site Deep Information Your web site can contain almost an infinite amount of information for almost no additional cost For this reason you should supply the user with as much well organized information as possible For example consider posting a 5 page biography for each officer or Partner in your organization Consider adding pictures of all employees to your web site in an effort to help the user associate a face with your company Add a complete history of the company information on every product and information on all of your services Reference letters can be a great addition as users can view those letters without necessarily bothering the person who wrote you the reference Include Prices While some people may disagree we think it is a good idea to clearly state your fees and prices for products and services People on the web are often shopping around for the best price available With no price to go on they may not give your site further consideration Some companies report to have even received e mails complaining that because no pricing is included the sender has elected not to do business with that company Because web users use the web 24 hours a day it may be unreasonable to expect them to be able to call easily to obtain prices On the other hand it may be dangerous to allow your competitors to see your prices Multiple Web Pages Perhaps the
18. One loudspeaker is located above the screen as an earpiece and another is located on the left side of the bottom of the unit opposite a microphone on the bottom right Volume controls are located on the left side of the unit and as a slider in the iPod application Both speakers are used for handsfree operations and media playback The 3 5 mm TRRS connector for the headphones is located on the top left corner of the device The headphone socket on the original iPhone is recessed into the casing making it incompatible with most headsets without the use of an adapter While the iPhone is compatible with normal headphones Apple provides a headset with additional functionality A multipurpose button near the microphone can be used to play or pause music skip tracks and answer or end phone calls without touching the iPhone The iPhone Battery The iPhone features an internal rechargeable battery Like an iPod but unlike most other cell phones the battery is not user replaceable The iPhone can be charged when connected to a computer for syncing across the included USB to dock connector cable similar to charging an iPod Alternatively a USB to AC adapter or wall charger also included can be connected to the cable to charge directly from an AC outlet Battery Life Apple s website says that the battery life is designed to retain up to 80 of its original capacity after 400 full charge and discharge cycles which is comparable to iPod batter
19. Skype ooVoo GoToMeeting SightSpeed GoogleTalk Gizmo project iChat VoIP Buster Jajah Amicima ComBOTS OpenWengo Vbuzzer Majic Jack Vonage OS ZT ATT TRAM AN TD 2 Remote Desktop Connections GoToMyPC LogMeln WebEx pcAnywhere Remote Desktop Connection RemotePC Citrix Terminal Services Array Networks gt OoOaQanons wa Copyright April 2010 J Carlton Collins CPA all rights reserved 7 High Tech Communications 3 Electronic Forms a Example GSCPA CPE Course Evaluation Forms b QuickBooks c InfoPath 4 Social Networking a Linked In b Plaxo c FaceBook d Twitter e MySpace 5 Web Conferencing or Teleconferencing Tools a WebEx b GoToMeeting c Yugma d Acrobat 6 Collaborative Environments a Wikis b WetPaint c PBWiki d MediaWiki e Wrike f Basecamp g GoogleDOCs 7 Meeting Facilitation Solutions www CarltonCollins com a Participants may gather in a single room but sit at separate terminals b Participants may be located miles apart c Advantages 8 Using Computers in Presentations a PowerPoint b Projectors c Presentation Tips 9 Pictures a Digital Photography b Photoshop 10 Videos a YouTube b GoogleVideos Copyright April 2010 J Carlton Collins CPA all rights reserved High Tech Communications c FlickR 11 Microsoft Outlook a Setup Tips b Managing Groups c Meeting Requests d Sharing Calendars e E Mail
20. Windows Terminal Server results in a very fast solution 5 This well proven solution is widely used by larger corporations Microsoft Remote Desktop Connection gm Remote Desktop Connection Remote Desktop Connection General Display Local Resources Programs Experience Advanced Logon settings A Enter the name of the remote computer a Computer Cartons Windows Vista Computer Username Carton Collins You will be asked for credentials when you connect Allow me to save credentials Connection settings l Save the current connection settings to an RDP file or open a P h saved connection Save Save As Open E e Microsoft Windows XP Windows Vista and Windows System 7 provides a built in thin client utility called Remote Desktop Connection which can be used to connect remotely to other Copyright April 2010 J Carlton Collins CPA all rights reserved 56 High Tech Communications www CarltonCollins com computer running any Windows operating system based on the use of an IP address The connection wizard is shown above Additional comments follow 1 Host users invite remote clients to connect via email or NET passport 2 Host computers can specify time of invitation and duration of assistance There are many other remote connection options as well for WSETP example WSFTP can be used to connect two computers together for transferring files back an
21. i Internet Protected Mode On 5 iChat Mac OS X application that offers PC PC calls between iChat and AIM users Put ona photo slideshow click through a Keynote presentation or play a movie in full screen accompanied by a video feed of you hosting while your buddy looks on AOO 5 Chars He Hane wenger UB woua you me to gee tune today ill Bell E Goro Whai me yau in o mond ANT Yl cA Todd Billips amp foun EF Aki Watanabe y Diay agree FA Want to go back to your tinvorite pince arcund the comar amp hte too Yeah Gove tart peice Tumi al Whai Gma do you wieni io ge al 6 Amicima Publishers of a soft VoIP application called amiciPhone that offers a combination of user presence file transfers photo sharing and instant messaging However in 2009 this solution was acquired by Adobe and is being overhauled look for it to come out even stronger than before Copyright April 2010 J Carlton Collins CPA all rights reserved 42 High Tech Communications www CarltonCollins com 7 VoIP Buster Windows app offering free PC PC calls and 120 days of free calls to landlines amp VoipBuster r DEK File Tools Help Rivivie 8 Jajah It connects you using your existing phone Web based VolP interface where you enter your phone number and the number of who you want to dial Jajah calls the caller and the person you are calling
22. or new startup Apply the Sort By filter to Relationship in order to see the people closest to you first 11 Ask For Advice LinkedIn s product LinkedIn Answers aims to enable this online The product allows you to broadcast your business related questions to both your network and the greater LinkedIn network The premise is that you will get more high value responses from the people in your network than more open forums For example here are some questions an entrepreneur might ask when the associates of a venture capital firm come up blank Who s a good fast and cheap patent lawyer What should we pay a Vice president of business Development ls going to a Demo worth it How much traffic does a Google Ad generate Copyright April 2010 J Carlton Collins CPA all rights reserved 77 High Tech Communications www CarltonCollins com plaxo Plaxo is an online address book and social networking service with 20 million users Plaxo provides automatic updating of contact information Users and their contacts store their information on Plaxo s servers When this information is edited by the user the changes appear in the address books of all those who listed the account changer in their own books Once contacts are stored in the central location it is possible to list connections between contacts and access the address book from anywhere J Collins j net TS 1 D plaxo a Messages Settings
23. touching or dragging their fingers across the screen or by setting real world items tagged with special bar code labels or identification tags 5 000 A restaurant might use this technology to communicate with guests take orders and even collect the bill A radio Shack might use this to educate customers about the products placed on the table A hotel might use this as a concierge to provide guests with restaurant suggestions driving directions and even to make reservations Copyright April 2010 J Carlton Collins CPA all rights reserved 87 High Tech Communications www CarltonCollins com Codename Milan Allows a user or users to manipulate digital content by the use of gesture recognition It was announced on May 29 2007 at D5 conference Targeted towards the hospitality businesses such as restaurants hotels retail public entertainment venues and the military for tactical overviews 5 The preliminary launch was on April 17 2008 when Surface became available for customer use in AT amp T stores 6 Surface was used by MSNBC during its coverage of the 2008 US presidential election 7 Surface is used by Disneyland s future home exhibits 8 As of March 2009 Microsoft had 120 partners in 11 countries that are developing applications for Surface s interface 9 Microsoft Surface has a 30 inch reflective surface with a XGA DLP projector underneath the surface which projects an image onto its underside while five cameras
24. 000 websites devices and applications have implemented Facebook Connect since its general availability in December 2008 Mobile There are more than 65 million active users currently accessing Facebook through their mobile devices People that use Facebook on their mobile devices are almost 50 more active on Facebook than non mobile users There are more than 180 mobile operators in 60 countries working to deploy and promote Facebook mobile products 2 Free of Charge Takes About 4 minutes to Set Up 3 Finding Friends Copyright April 2010 J Carlton Collins CPA all rights reserved 63 High Tech Communications www CarltonCollins com a Use Friend Finder tool to Search by high school college business or groups to find old friends b Refer to your friend s friend list to find old friends you have in common your friends might have already done a lot of the friend finding work for you c Search for new friends based on profile data more like a dating site you find potential new friend who share your same interests religion location etc 4 Its all about the Pictures and Videos a A picture is worth a thousand words right b Like sharing your photo album complete with all the comments your other friends have made about your photos and videos c Provides starting points for opening dialogs d This is why Facebook beats Linked in 5 Facebook Mobile a Allows you to stay up to date on Facebook a
25. 12345 Statement of Work Purchase Order Schedule This Statement of Work Purchase Order Schedule SOW is between Contoso Corporation Contoso and Jessica Arnold Contractor If this SOW is being entered into under the Contoso Corporation Purchase Order Terms and Conditions the PO this SOW is effective as of the start date listed in the PO If this SOW is being entered into under an agreement other than the PO this SOW is effective as of 2005 12 14 The PO or such other governing agreement as applicable are referred to in this SOW as the Agreement The parties agree as follows 1 Detailed Description of Work The following describes the project expectations and specifications Contractor activities and reporting requirements for goods services products and or other items or materials that Contractor shall perform and or deliver to Contoso under the Agreement as a work made for hire collectively the Work The integration capabilities of Office InfoPath 2010 and the Microsoft Office system enable InfoPath to extend into other programs to improve information gathering for databases documents and more Copyright April 2010 J Carlton Collins CPA all rights reserved 99 High Tech Communications www CarltonCollins com Instant Messaging Chapter 12 Copyright April 2010 J Carlton Collins CPA all rights reserved 100 High Tech Communications www CarltonCollins com Introduction to Instant Mess
26. Copyright April 2010 J Carlton Collins CPA all rights reserved 108 High Tech Communications www CarltonCollins com accuracy no screen door effect as with an LCD due to its micro mirror construction compactness and higher contrast they are sometimes not as bright as LCDs but images often look smoother DLP Projector Limitations 1 Just as with LCD each DLP chip has a finite number of pixels It is always best to conform to this native resolution 2 A DLP projector can exhibit what is referred to as the rainbow effect This aberration is exhibited by a brief flash of colors like a small rainbow when the viewer rapidly looks from side to side on the screen or looks rapidly from the screen to side of the room Fortunately this does not occur frequently and many people do not have sensitivity to this effect at all Although DLP isn t perfect the DLP projector has become an instant hit amongst home theater enthusiasts InFocus IN24 DLP Projector BenQ MP511 DLP Projector 800x600 2100 Lumens 2 100 1 442 99 Sharp PG MB66X DLP Projector 1024x768 3000 Lumens 2000 1 995 BenQ SP820 DLP Projector D 1024x768 4000 Lumens 2000 1 J 1 439 Copyright April 2010 J Carlton Collins CPA all rights reserved 109 High Tech Communications www CarltonCollins com NEC NP4000 DLP Projector 1204x768 5200 Lumens 2100 1 35 pounds 3 019 cake aka a ae Panasonic PT D5700U DLP Projector
27. Mr Collins has been married for 25 years and has two children He devotes his leisure time to family travel tennis fishing snow skiing and riding motorcycles dirt and street Mr Collins is president of his home owners association participates in the Gwinnett Clean and Beautiful program and volunteers for Cooperative Ministries food drive Selected Positions Awards amp Accomplishments Internet Protected Mode On Copyright April 2010 J Carlton Collins CPA all rights reserved High Tech Communications www CarltonCollins com Preface While this course it titled High Tech Communications for CPAs it is certainly not my intention to throw older traditional communication methods out the door just the opposite believe that older proven communication techniques must be obeyed even when employing newer communication techniques For example just because you are speaking over a video web camera does not mean that you need not sit up straight make good eye contact or convey positive body language these old communication methods are just as important today as ever perhaps even more so because today s newer high tech methods sometimes make it harder to communicate clearly and convey the best impressions My goal for this course is simply Communications Any communication topic old or new is fair game At the completion of this course hope that you will have compiled a list of communic
28. Narrator reads dialog boxes and window controls in a number of the more basic applications for Windows While Microsoft recommends that the visually impaired purchase a full function screen reader for general computer use Narrator is a significant piece of software for a number of reasons Narrator is included with every copy of Microsoft Windows providing a measure of access to Windows without the need to install additional software as long as the computer in use includes a sound card and speakers or headphones Narrator can assist a blind person in installing a full function screen reader assisting the user until his her screen reader of choice is up and running As well because Narrator is a lightweight screen reader that requires minimal hooks into the operating system Narrator can provide speech when a full function screen reader might be unable to do so such as during the process of updating hardware drivers Copyright April 2010 J Carlton Collins CPA all rights reserved 217 High Tech Communications www CarltonCollins com J Carlton Collins CPA ASA Research Carlton ASAResearch com 770 734 0950 J Carlton Collins CPA is a Certified Public Accountant with experience in technology tax auditing accounting systems financial reporting and bond financing He is an author lecturer and technology amp accounting systems consultant He has published more than two dozen books two hundred articles and thousands of web pages A
29. Peeriieeine InfoPath Forms Services is fully integrated with Office SharePoint Server 2010 to help ensure organizations can centrally manage and deploy electronic forms View a larger image Streamline Forms Driven Business Processes Office InfoPath 2010 integrates with your current business applications and systems using industry standards so you can automate existing business processes without having to reinvent them InfoPath form solutions provide an way for your organization to gather and present information from your existing line of business systems using the familiar Office interface Office InfoPath 2010 Office SharePoint Server 2010 and Microsoft BizTalk Server 2006 combine to deliver a comprehensive solution for optimizing business processes Advanced form design and development tools enable Office InfoPath 2010 to streamline complex processes using dynamic interactive forms that connect users to the right data Copyright April 2010 J Carlton Collins CPA all rights reserved 98 High Tech Communications www CarltonCollins com Working Contract doc Microsoft Word 72 aw HE Sao AE BELT gaencene AaBbC AaBbCc AaBbCcl AaBbCel Ae E mamma eret rem in j m Heading Heading Hesding3 Emphari 5 ee Fired le Select Cen brat Aami 55000 uso Contractor Contact Name Jan i amp Flathee Manimum Amount Contat Emaii Alan tabrikam com MB Soues This document needs to be signed L LEN 121Contract
30. Quickcam Orbit 112 99 Copyright April 2010 J Carlton Collins CPA all rights reserved 112 High Tech Communications www CarltonCollins com Building A Successful Web Site Chapter 14 Copyright April 2010 J Carlton Collins CPA all rights reserved 113 High Tech Communications www CarltonCollins com Why are so many CPAs Are Missing the Internet Boat Take a deep breath Do you smell that That smell my friend is the smell of opportunity Today the Internet offers more opportunity than any other time in our history including the Industrial Revolution Unfortunately think most CPAs are completely missing the boat There are many many ways to take advantage of the Internet to find out if you are doing all that you can on the web answer these questions 10 11 12 Your Web Site Do you have a deep rich web site with lots of valuable content i e not a simple 4 panel brochure regurgitated to the web Does your web site have a submit page where readers can submit their information to you and perhaps request follow up information Does your web site provide checklist articles case studies or advice to your readers Does your web site provide a bio and contact for each key employee Does your web site provide driving directions including a map to your offices Does your web site provide a calendar of events including classes you hold to help educate your clients on various topics such as taxes financi
31. Sign Out e e Home Address Book a Stream eoo More 7 Plaxo Premium o elco 4 Upgrade Your Account Address Book 1 930 Contacts Contact Info See Full Profile Search Contacts J Collins Your profile is 95 complete Edit Search Py ASA Research No Location Added Contact and Event De Duper Import Contacts Work Email carlton asaresearch com Home Email carlton accountingsoftwareadv Work Phone 770 734 0950 Home Phone Add Now Work IM Add Now Home IM Add Now Plaxo Premium Try it for 30 days free Postmessage Add photos E Share link Show Everyone New stuff Wayne Schulz posted a blog entry 290 e You have 3 new messages How To View PDF Files on an iPad You have 17 new notifications When Apple announced the iPad immediately imagined that it would be a superior way to read PDF books in a tablet style format On the Apple iPad Specs page there is a single mention of PDF support for the iPad in the Mail application as an attachment However there must be a ae way to view more Birthdays Add comment likeitt More v April 15th Randolph P John Send an eCard S Wayne Schulz posted a blog entry iii Element Case Introduces the Joule for iPad Brian Austin Send an eCard le This has certainly got to be one of the most elegant iPad stands I ve vet seen Element Case has ug OBEZ Done Internet Protected Mode On fa v 100 v Plaxo supports major address books
32. Survey Software Pricing Sign Up NOW gt Start your personal account today for FREE or get advanced survey features starting at 19 a month View our online survey software pricing and features Top Surveys E Powerful Features 5 What s New at Zoomerang Customer Satisfaction Surveys Survey Text Import Just Released Import Surveys from Word into Zoomerang in Seconds Check it out Send Your Survey to Our Panel of Respondents from 6 complete Order Online its l NEW Upcoming Webinar Intro to Zoomerang Consumer Surveys Statistical Analysis Enterprise Share and Collaborate Register Now Facebook Surveys IT Panelists Upcoming Webinar Intro to Zoomerang every eee MAT Me Employee Satisfaction Surveys Free Survey Templates Market Research Surveys Tag Clouds for Open Ends Educational Surveys General Population Panelists amp Internet Protected Mode On fa v 100 Some of the features offered by these survey applications are summarized below 1 Question Types Wizards help you create your survey questions which may consist of Yes No Multiple Choice radio buttons drop down selection check boxes fill in the blanks Polling Ratings table responses page piping question skipping response redirects question suppression linking question reordering Copyright April 2010 J Carlton Collins CPA all rights reserved 90 High Tech Communications www CarltonCollins com 2 Survey Delivery Surveys c
33. The cost of such a facility here in Atlanta presently runs about 90 000 to 120 000 a year A web site could then be established listing all of the products Users need only log on and click a check mark next to the items they wish to purchase In a matter of minutes the order is entered and within a time period specified by the customer a pizza hut type delivery person shows up to deliver the groceries In this case there is an extra 10 delivery fee however because Billy Bob s Grocery store has dramatically lower overhead costs their prices are dramatically lower as well and you save 24 compared to the retail store down the road In comparing these two models there are some important differences to note as follows 1 Billy Bob s overhead is much smaller other things being equal Billy Bob s prices can be much lower 2 Billy Bob s can serve a larger market covering a 15 to 20 mile radius instead of the 2 mile radius covered by many traditional retail grocery stores Copyright April 2010 J Carlton Collins CPA all rights reserved 131 High Tech Communications www CarltonCollins com 3 Billy Bob s customers save time Five minutes on the web versus 1 hour in the store is a major time savings The customer also saves gasoline does not risk having a head on collision does not risk being mugged in the parking lot and does not succumb to impulse buying when they walk down the candy aisle Grocery stores have all kinds of tri
34. Wep Site scccsisncncsstennscncrenysavaceaavanbeneansaattiaasvaeabavenandveneaasaens 114 B DEMING ONN E EEEE E OE 140 16 The Problems with Phone CommunicationS sseeseseesssenssseeesseesssersseereseersseeee 145 Moble PRON enun sen EE E E E E E A 150 Ba VOCON ZA OIT aaran ir E E A TEA 165 19 WeB Con erenCNE suiii a EA 170 20 Microsoft Office Live Meeting ssssesseeseseessssrresrerssressreresreressrersseeeseeresereeseeese 175 21 Microsoft Office SharePoint Designer 2007 sssseesenseseesssrersserrssresssrrssseresererss 180 22 NUCO SO E VI 9 ee ee E E E T 183 23 Microsoit PowerPoint seccssecpdcavanabovacencienncseededesaeanadeasnadaesacedueabedwesonebarerenearanentoences 190 24 Amazon KINA E ernie n AE AE 198 25 Wireless Networking amp Internet Hotspots seseesseeseseesssrersserrssresssrersseresseerss 200 20 Speech RECO CMIEOMiciercaniestescoenercnepenacnscecatedsssamuiexawacataewanadanssadentarunanauwadeunauatesiaes 216 Appendix A Instructor s Biography es ssssesseessseesssrereseeresresssresseeresereessereseereses 219 CPE C urse Evaluation OFM cernrssserccsaanaeetaecsonsntenarateberasteotsteesanninosuichaecseratorarsat 221 Copyright April 2010 J Carlton Collins CPA all rights reserved 2 High Tech Communications www CarltonCollins com High Tech Communications for CPAs Course Information Learning Objectives To help CPAs learn about the very best communication techniques available today Cour
35. a two way street while you are watching a person s body language he or she is simultaneously watching yours Study your body language in a mirror What messages do you send You might be surprised We establish a comfortable distance for personal interaction and nonverbal unconsciously define this as our perimeter Personal distance is just as much a part of non verbal communication as a smile or a snarl By the way notice if a smile uses all of the face muscles or just a few around the mouth More muscles equal a more natural unforced smile If one is distrustful e g paranoia his or her space will probably be larger If you find yourself moving back from a person you have probably picked up a warning signal at a subconscious level Pay attention If a person moves into your personal space it may well be a sign of aggression or implied intimidation Facial Indicators Here are a few obvious facial signals Nostril flare arousal anger Grin happiness affiliation contentment Grimace fear Lip compression anger high emotion frustration Canine snarl disgust Lip pout sadness submission uncertainty seduction Sneer contempt intimidation Frown anger sadness concentration Brow raise intensity curious slight surprise Big pupils arousal fight or flight drugs Small pupils rest and digest Direct gaze affiliate threaten deception Gaze down submission deception distractio
36. all rights reserved 10 High Tech Communications www CarltonCollins com mitans Messen e 9 S IP voice Seaain W Roaming PC to Phone op Voice Mail Missed Call Old versus New Chapter 2 Copyright April 2010 J Carlton Collins CPA all rights reserved 11 High Tech Communications www CarltonCollins com What s Wrong with the Old Style Communications Letters Telephones amp Face to Face Meetings are the top three traditional approaches to communicating and all three still have their rightful place today Personalized letters are often appreciated a telephone call can be a great way to engage someone and in many cases there is no substitute for a face to face meeting However each of these methods has disadvantages as well 1 2 3 Disadvantages of Letters O O m hopa They take time to be delivered sometimes days It cost money to mail or FedEx a letter There is physical labor involved stuffing envelopes applying postage calling for pick up or delivering to a mailbox The recipient cannot easily copy and paste information from the letter The recipient must start from scratch when replying ie there is no reply button The recipient must then shred scan or file your letter away all of which involves labor Computers cannot later search for text within that letter for easy identification unless OCR scans are applied Disadvantages of Telephone Calls a
37. brochures e mails social networking voice mail greeting phone conversations face to face meetings etc Wouldn t you always want to make the best impression possible via all of your communications Goals of Communicating The following bullets were helpful to me for establishing a foundation for discussing the new communication methods listed below We communicate for different reasons For example 1 Information Dissemination We communicate to deliver or exchange information 2 Creativity We communicate to spark and identify new ideas creativity brain storming 3 Test Our Reasoning We communicate to articulate our points of view to articulate our reasoning to state our positions out loud to see how they sound to others to gain feedback and to refine our positions 4 Education We also communicate to educate one another Copyright April 2010 J Carlton Collins CPA all rights reserved 13 High Tech Communications www CarltonCollins com 5 Marketing It is said that marketing is really a simple matter of educating potential customers about your products and services via various communication channels 6 Relationship Building We communication to facilitate dialogue the exchange of ideas and the expression of human emotions which help build and maintain relationships both personally and professionally 7 Decision Making Communication facilitates the process of decision making be it an
38. conversing in text messages back and forth Later ISP giant AOL designed its own Instant Messaging program using the same basic format for communication as ICQ and every other IM client Due to its built in client base of AOL subscribers the new program quickly outpaced pioneer ICQ to become the most popular tool for sending Instant Messages All the current IM programs perform basically the same functions with a few special features enabled for each system MSN Messenger comes preinstalled with Windows XP and actually requires some effort to remove however this program offers the best support for real time voice conversations when both parties involved use a microphone and Copyright April 2010 J Carlton Collins CPA all rights reserved 101 High Tech Communications www CarltonCollins com speakers headphones AOL IM or AIM offers a java based program which does not require the downloading or installation of software thereby offering infinite access points for mobile users AIM also became the first Instant Messaging program licensed to cell phone companies for inclusion in their digital products In response to the incredibly large Instant Messaging community programs like OMNI and Trillian offer users a method to consolidate and manage user accounts from all the various providers in one simple interface While Instant Messaging IM is likely to be viewed more as a time waster for teenagers and lonely geeks a lot can get done via IM IM all
39. create your own forms from scratch Some of these basic tools include text boxes drop down list boxes check boxes and drop down calendars InfoPath allows validation rules to be assigned to data fields to ensure that all fields are properly completed and meets specified criteria An advantage to InfoPath is that all submitted data is automatically stored in XML form in an awaiting database which makes it easy to retrieve the data in other XML based applications InfoPath forms can also be integrated into Word or Excel files so that data entered into these documents are delivered electronically using the InfoPath delivery engine Presented below is an example of a health insurance claim form prepared in InfoPath Copyright April 2010 J Carlton Collins CPA all rights reserved 5 Rich Text Box H Drop Down List Box IB Combo Box ZH List Box H Date Picker Check Box Option Button Button of Section Microsoft InfoPath s Standard Tools 59 High Tech Communications www CarltonCollins com Health Insurance xml Microsoft InfoPath Enterprise Edition J aes Fie dit Wew Insert Format Tools Table Help NOTICE Any person who knowingly files a statement of daim containing any false incomplete or misleading linformation may be guilty of a criminal act punishable under law and may be subiect to civil penalties I authorize the release of any medical information to process this caim I also request p
40. depressed evasive image versus a positive cheerful trustworthy likable believable interested image K So the next time you are communicating with someone be them your employees colleagues kids parents spouse neighbor whomever put on a smile And if the situation calls for it extend a hand of friendship not negative body language that turns people off before you open your mouth Copyright April 2010 J Carlton Collins CPA all rights reserved 32 High Tech Communications www CarltonCollins com Body Language on the Dating Scene To illustrate the power of body language consider this advice when meeting people in a bar or social setting the web site eHOW suggests that sending out the following five non verbal Signals is often more effective than throwing out a pick up line 1 Posture is Important Be sure to stand tall Posture is the first thing that sets you apart in a room full of slouching or uptight individuals Use Your Eyes If you have down a good flirty wink you may wink however if it looks unnatural stick to the smiling eyes tactic Show Some Teeth Give them a teeth flashing smile Show Some Tongue Whether taking a sip of a drink or licking your lips allowing your tongue to wet your lips garners attention Move Closer Move in closer to let him her know that you re interested Once you get closer you ll be able to tell if the body language is reciprocal From there you l
41. development tool such as Dreamweaver or Microsoft Front Page These web page development tools not only provide tools for developing web pages but also contain tools that make it far easier to develop and manage a web site on an ongoing basis Microsoft Front Page is discussed later in these session materials Web Site Mistakes ver the past seven years many companies have erected web sites and web stores only to fail miserably Unfortunately a large percentage of the companies behind these failed efforts have concluded that there must be little or no market for e commerce web stores believe that they are wrong dead wrong believe that their failures can be chalked up to a multitude of mistakes missteps and misconceptions regarding web stores This article discusses some of the most common site blunders Poor Web Design e Too Much Clicking am amazed by how poorly some web sites are designed In many cases users must click five six or even eight clicks deep into the web site to find what they are looking for My rule is to build web sites in which the entire contents of the web site are only one click away from the home page unless you have hundreds of pages on a given topic and then will allow two clicks deep but no more e Hidden Contact Info Contact information should be displayed on every page in the web site You never know when that reader will want to print the page forward the page via e mail or pick up the phon
42. due to manufacturing defects Coupled with an enlarged view of this black or discolored pixel an LCD projector can become frustrating to watch 3 Also like similar monitors LCD projectors typically have a native resolution which enables their best viewing characteristics Using a higher or lower resolution source than the projector s native resolution can lead to distortion illegible fonts and eye strain NEC MT1075 4200 Lumens 6 995 New 4 995 in 2006 2 995 in 2007 3 890 in 2008 3 298 in 2009 2 328 in 2010 In terms of sales the fastest growing type of video projector used today is the DLP projector As with LCDs the actual image is displayed on a chip however the chip used in a DLP projector is different The chip in a DLP projector is referred to as a DMD Digital Micromirror Device In essence every pixel on a DMD chip is a reflective mirror The advantages of this system make the DLP projector suitable not only for business and home theater application but DLP technology is also in use in some movie theaters for feature film projection The micromirrors on a DLP projector s chip tilt very rapidly as the image changes This process produces the grayscale base for the image Then color is added as light passes through a high speed color wheel and is reflected off of the micromirrors on the DLP chip as they rapidly tilt towards or away from the light source Advantages of the DLP projector include excellent color
43. for example that you are launching a new grocery store Consider these two examples e The process of launching a typical retail grocery store is rather expensive It typically starts with the purchase or lease of prime commercial real estate property Here in the suburbs of Atlanta the typical grocery store sits on roughly 12 acres of land costing 300 000 per acre or 3 6 million Leasing that same real estate runs approximately 8 00 to 12 00 per square foot for stores which typically run from 60 000 to 85 000 square feet which translates to 480 000 to 1 020 000 per year in lease fees These rates reflect favorable pricing afforded to grocery stores which are considered to be an anchor for most shopping centers From here the grocery store expends fees for a paved parking lot cash registers customer shopping carts attractive flooring fancy lighting decorations etc The costs are staggering and the overhead associated with the typical grocery store today must be recaptured through higher product prices The grocery store then serves the immediate community which is usually a couple of miles or so e By comparison today a company could erect a cinder block building in an industrial park setting located 15 miles outside of town We will call it Billy Bob s Grocery Store The building may have a dirt road and unpaved parking The building provides concrete floors and ordinary lighting There are no decorations and cash registers are basic
44. functionality of the popular BlackBerry email solution for an annual subscription Yahoo offers a free push email service for the iPhone IMAP although not Push IMAP and POP3 mail standards are also supported including Microsoft Exchange and Kerio Connect E Mail Syncing The iPhone will sync e mail account settings over from Apple s own Mail application Microsoft Outlook and Microsoft Entourage or it can be manually configured on the device itself With the correct settings the e mail program can access almost any IMAP or POP3 account Jailbreaking The iPhone s operating system is designed to only run software that has an Apple approved cryptographic signature This restriction can be overcome by jailbreaking the phone which involves replacing the iPhone s firmware with a slightly modified version that does not enforce the signature check Apple in a statement to the United States Copyright Office in response to EFF lobbying for a DMCA exception for this kind of hacking claimed that jailbreaking the iPhone would be copyright infringement due to the necessary modification of system software Some jailbroken phones are at risk of an iPhone worm created by Ashley Towns a 21 year old Australian technical college student He told an Australian media outlet that he created the virus to raise the issue of security The virus exploits a default password in SSH of jailbroken units to rickroll users of infected devices iPhone on Verizon
45. good content content content Good Clear Navigation Easy to use menus that guide readers around and through the site is a must The navigational elements icons arrows etc should be consistent Moving around on the page and among the pages should feel intuitive You should be able to see where you are going and return easily The Site Has True Value Added Services content products resources It is not just a place to market and sell Users should be able to get real information and perhaps some services for free The Site Maintainers Are Responsive They answer queries and trouble shoot problem links You don t get the dreaded 404 URL not found messages that mean that the document you are hunting for is not there Organizational Support The site should have organizational support This means that the site is not set up and maintained by a couple of guys and no one else in the organization knows anything about the site The site should have both budget and personnel support Feedback Forms The web site should be capable of gathering information about users through feedback forms questions surveys contests newsletters surveys etc so that the maintainers know who has been visiting the site Cross Reference Other Media The Web site is a marketing channel integrated with other channels such as print media TV radio for example Looks Professional The site has a structurally sound and aesthetically pleasing d
46. hand held mobile phone Motorola DynaTAC Cellular systems required several leaps of technology including handover which allowed a conversation to continue as a mobile phone traveled from cell to cell 2G Digital Mobile Communication The first modern network technology on digital 2G second generation cellular technology was launched by Radiolinja now part of Elisa Group in 1991 in Finland on the GSM standard The first data services appeared on mobile phones starting with person to person SMS text messaging in Finland in 1993 First trial payments using a mobile phone to pay for a Coca Cola vending machine were set in Finland in 1998 3G Wideband Mobile Communication In 2001 the first commercial launch of 3G Third Generation was again in Japan by NTT DoCoMo on the WCDMA standard These changes increased the maximum burst rate from 2 45 Mbit s to 3 1 Mbit s Also included were protocols that would decrease connection establishment time called enhanced access channel MAC the ability for more than one mobile to share the same time slot multi user packets and the introduction of QoS flags Further performance increases provide speeds of up to 42 Mbit s downlink and 84 Mbit s with Release 9 of the 3GPP standards 4G Broadband Fourth Generation The recently released 4th generation provides broadband wireless access with nominal data rates of 100 Mbit s to fast moving devices and 1 Gbit s to stationary devices 4G systems may be bas
47. has since been removed which is an indication as to how public Facebook allows your information to be Custom Privacy 4f Make this visible to These people SpedficPeople Glynn Academy Only the people above can see this i Hide this from These people Enter a Name or List 10 Protect Your Albums facebook oer One of the facets that makes Facebook an interesting social tool AN E RES is the unique and easy ability to share tagged photos and videos 48 Photo Albums My Photo Comments albumPrvacy Of one another Although this concept is probably difficult for non Facebook users to understand the sharing of photos and videos truly helps you and your Friends get to know one another on a deeper level For this reason Facebook photos and videos Sear ar ma should be embraced not shunned However if you do decide to 57 photos P publish photos and videos to your Facebook you should take a Updated October 5 2009 ns moment to ensure that you are not also sharing them with the Edit Album View Album Delete Album entire world l i w Just because you ve enabled the privacy settings to hide your une he f re oo Bx nS Glynn Academy Reunion photos from public searches does not mean that your photos are 59 photos fully protected It is possible that the photo may still be viewable by others who are tagged in the photo and all of their Facebook Friends and Friends of Friends To full
48. have to both be available at the same time You send me an e mail when you have time will respond when have time No time is wasted scheduling a phone call 7 Accompanying Data Often phone conversations are weaker because one party has a report or data that is relevant to the conversation Unfortunately there is no good way to share that report or data via a phone call Therefore the phone call conversation relies on the one party reading reciting or interpreting the report or data accurately for the other party Had it been an e mail conversation instead all relevant reports and data could have been attached Copyright April 2010 J Carlton Collins CPA all rights reserved 145 High Tech Communications www CarltonCollins com 8 Ability to Hear sometimes have trouble hearing phone conversations Sometimes the problem is background noise poor cell phone reception Other times am a little hard of hearing or have trouble understanding someone s foreign accent especially when cannot see their lips moving All of these problems evaporate when e mail instead of phone calls are the method of communication 9 Long Winded People Another problem have with telephone calls is talking to long winded people who take forever to get to the point or have no point If they had to send me an e mail instead they would not be so long winded and if they were they would be wasting their own time and not as much as mine Some
49. i oe Oe a M WAYLOAdS O1dVY SHL SNOILVOOTIV AONSNOAYS SALVLS QSLINN 25 0 3408Y CGSINDSVN HIE WNYLOJdS OldVY SHL 7H 200 aM 202 Copyright April 2010 J Carlton Collins CPA all rights reserved High Tech Communications www CarltonCollins com Wi Fi MIMO and N Wireless technology has become the de facto networking standard from hotspots to homes even small businesses are beginning to reap the benefits of low installation costs and convenient fast throughput While any Wi Fi connection even a Weak one is adequate to surf the Internet and transfer data if distance and obstacles sap too much bandwidth from a network high volume or streaming content such as video can begin to break up or degrade With the growing popularity of home theatre personal computers HTPCs Personal Video Recorders PVRs such as Tivo and voice over internet protocol VOIP and other bandwidth intensive applications the need for a long range stable wireless standard is more apparent than ever One technology that has delivered greater range and faster more reliable throughput is an innovation called MIMO short for multiple input multiple output This new technology was originally referred to initially as Pre N and later as DRAFT N and now as N or MIMO It uses a number of antennas to overlay the signals of two or more Wireless G compatible radios MIMO effectively increases the wireless data rate from 54 Mbit s to
50. important measure we all can take is to be careful not to share sensitive information when using your cell phone Copyright April 2010 J Carlton Collins CPA all rights reserved 156 High Tech Communications www CarltonCollins com The Apple iPhone The iPhone is a line of Internet and multimedia enabled smartphones designed and marketed by Apple Inc and released in 2007 An iPhone functions as Mobil Phone Camera phone Text messaging Visual voicemail Portable media player equivalent to a video iPod Internet client with e mail web browsing and Wi Fi connectivity SY 2 a a a The user interface is built around the device s multi touch screen including a virtual keyboard rather than a physical one Third party applications are available from the App Store which launched in mid 2008 and now has well over 100 000 apps approved by Apple These apps have diverse functionalities including games reference GPS navigation social networking and advertising for television shows films and celebrities Screen And Input The touchscreen is a 9 cm 3 5 in liquid crystal display 320x480 px at 6 3 px mm 160 ppi HVGA with scratch resistant glass 40 and 18 bit color rendering 262 144 colors Gestures The touch and gesture features of the iPhone are based on technology originally developed by FingerWorks The iPhone 3GS also features a fingerprint resistant oleophobic coating The display responds to three sensors a
51. including Outlook Outlook Express Mozilla Thunderbird and Mac OS X s Address Book Additionally Plaxo can also be maintained through an online version Plaxo 3 0 was released on June 24 2007 and provides automated multi way sync Social Networking Plaxo Pulse was launched on August 4 2007 which is a social networking service which enables sharing of content from multiple different sources across the social web including blogs photos social networking services rating services and others Users can Copyright April 2010 J Carlton Collins CPA all rights reserved 78 High Tech Communications www CarltonCollins com selectively share and view content according to either pre determined categories e g friends family business network or customized groups Charges On July 30 2009 Plaxo began charging for Outlook synchronization service Founders Plaxo was founded by Napster co founder Sean Parker Minh Nguyen and two Stanford engineering students Todd Masonis and Cameron Ring The company was named by David Weekly Plaxo based in Mountain View California is currently privately held and supported by venture capital including funds from Sequoia Capital On May 14 2008 Plaxo reported it had signed an agreement to be acquired by Comcast Criticism Plaxo received criticism from technology journalist David Coursey who was upset about receiving a number of requests from Plaxo users to update their contact information si
52. is not widely used L o fi GoloMecting GoToMeeting is a remote meeting and desktop sharing software that enables the user to meet with other computer users customers clients or colleagues via the Internet in real time Highlights of the GoToMeeting product are presented below 1 Avoiding Firewall Problems With software installed on the host and client computers transmissions are passed through highly restrictive firewalls 2 History GoToMeeting was developed in July 2004 by Citrix Online of Santa Barbara CA 3 Two Editions GoToMeeting is sold in two editions Personal and Corporate 4 GoToMeeting features In all editions include End to end 128 bit Encryption Application sharing 24 bit color Multi monitor support for a client PC Meeting recording and playback Audio supports both toll based phone or conferencing via VoIP GoToMeeting hosts up to 15 users and one organizer Copyright April 2010 J Carlton Collins CPA all rights reserved 171 High Tech Communications www CarltonCollins com GoToMeeting Corporate offers up to 25 users with multiple organizer option GoToMeeting Features are summarized below GoToMeeting GoTloVWebinar GoTo raining Includes GoToMeeting Includes GoToMeeting Key Uses Sales demos Marketing presentations Customer training Collaboration Company events Employee education Meeting Capacity pakas Up to Up to i ee 15 100 500 or 1 000 25 or 200
53. it is important to study adopt learn and utilize the best communication avenues possible 1 Organizational expert Kelly Krauskopf answers as follows Communicating is important because you can t do anything without it Communication is necessary in order to avoid confusion It s vital to any successful organization to be clear When you communicate you eliminate mistakes Everybody understands his responsibilities within the system so that he can carry them out 2 Communication student Uttara Manohar says Communication is a very important aspect of the human life since it is the communication that helps human beings to connect with each other as individuals and as independent groups Communication is the very basis which drives the process of development in all the fields Here are some of the reasons which explain why communication is important 3 Carlton Collins says We are always communicating whether we intend to or not If you have no web site you may be inadvertently communicating that you have not fully embraced technology If you do have a web site but it is a poorly designed web site with feeble or old content you may be communicating an even worse message However a nice well designed web site with good current information can help you make a good impression This same concept is conveyed through all of your outward appearances be them your letter writing your company logo and colors your marketing
54. join newly discovered Wi Fi networks and prompt for the password when required Alternatively it can join closed Wi Fi networks manually The iPhone will automatically choose the strongest network connecting to Wi Fi instead of EDGE when it is available The iPhone 3G has a maximum download rate of 1 4 Mbps in the United States Furthermore files downloaded over cellular networks must be smaller than 10 MB Safari is the iPhone s native web browser and it displays pages similar to its Mac and Windows counterparts Web pages may be viewed in portrait or landscape mode and supports automatic zooming by pinching together or spreading apart fingertips on the screen or by double tapping text or images The iPhone supports neither Flash nor Java Consequently the UK s Advertising Standards Authority adjudicated that an advertisement claiming the iPhone could access all parts of the internet should be withdrawn in its current form on grounds of false advertising MAPs The maps application can access Google Maps in map satellite or hybrid form It can also generate directions between two locations while providing optional real time traffic information During the iPhone s announcement Jobs demonstrated this feature by searching for nearby Starbucks locations and then placing a prank call to one with a single tap Directions Support for walking directions public transit and street view was added in the version 2 2 software update but no vo
55. keyword list then the resulting ranking is still a little lower If the search words are contained only in the body of the home page then the resulting ranking is still lower If the search words are contained in sub pages this applies to some but not all search engines then the resulting rank is lower still In the event that search words are contained in the title keyword list home page and sub pages an algorithm is used to calculate the resulting rank based on some allocation method In the example below a user has used the Google engine to search for International Tax Consulting which resulted in over 1 380 000 hits The 3 from the top hit was to the KPMG Copyright April 2010 J Carlton Collins CPA all rights reserved 117 High Tech Communications www CarltonCollins com Address http www google com search hl entie UTF 8 amp 0e UTF 8 amp g International Tax Consulting amp btnG Google Search Google ternational Tax Consulting amp Search Web go PageRank Dh s blocked Options 4 GJ International GJ Tax E Consulting Links Google Port ORUDGE Boortz Mike jAnn G jThomas Lary 4 David 4 Fred Stump Advanced Search Preferences Language Tools Search Tips Google International Tax Consulting Google Search Images Groups Directory News Searched the web for International Tax Consulting Results 1 100 of about 1 380 000 Search took 0 96 seconds PHONE SOFT INTERNET DIRECTO
56. know matters right That s exactly why use Facebook have reconnected with past colleagues and old friends as well as established new relationships through Facebook believe that Facebook has enhanced my life in many ways both personally and professionally That said am amazed at how vulnerable my Facebook information is by default and strongly recommend that all CPAs who also use Facebook take time to lock down their information using the steps described above Copyright April 2010 J Carlton Collins CPA all rights reserved 73 High Tech Communications www CarltonCollins com Linked In Linked ff LinkedIn is a business oriented social networking site Launched in May 2003 it is mainly used for professional networking As of February 11 2010 LinkedIn had more than 60 million registered users spanning more than 200 countries and territories worldwide of which approximately half are in the United States 11 million are from Europe With 3 million users India is the fastest growing country as of 2009 The Netherlands has the highest adoption rate per capita at 30 Corporate Info LinkedIn is headquartered in Mountain View California with offices in Omaha Chicago New York and London LinkedIn s CEO is Jeff Weiner previously a Yahoo Inc executive LinkedIn reached profitability in March 2006 Goal The purpose of the site is to allow registered users to maintain a list of contact details of people they kno
57. leave immediately so do you Often we leave because we usually shop during non business hours and therefore the web store s instructions to call for a price quote at 11 00pm doesn t cut it In most cases we conclude that because there are no prices listed they must be high prices or else why wouldn t they list them right In any event for one am not willing to go through the extra effort to determine the price it is far easier to just move on to the next click e No Competitive Information Most web sites do not include detailed lists of competitive products What a mistake You have an interested shopper reading your web site but because you don t inform that shopper about all of their alternatives and the pros and cons of those alternatives you force them to go elsewhere on the web to find the answers they seek To do this they must leave your web site and visit your competitor s web site Now they have them and you don t People want to be informed shoppers If all you sell on your web store is a toaster that s fine But you should consider providing the shopper with a list of every toaster available along with their prices descriptions and pros and cons By doing this you ve squelched the need for the shopper to visit any further web sites They now have all of the information they need to make their decision and they are now on your web site a web site in which you control the content doesn t this sound like a g
58. leverage this technology along with their combined services offerings to springboard past their competitors The cable companies will provide media services to other partners while gaining access to the wireless network as a Mobile virtual network operator to provide triple play services Copyright April 2010 J Carlton Collins CPA all rights reserved 204 High Tech Communications www CarltonCollins com The Basics What is Wi Fi Wireless Fidelity hardware uses radio technology in the 2 4GHz or 5GHz range Wi Fi technology currently supports three main standards called 802 11a b and g each with varying degrees of compatibility and connectivity Wireless Frequency Range Maximum Possible Standard Interference Throughput 802 11a short range easily obstructed 54Mbps 802 11b 2 4GHz long range high signal integrity 11Mbps 802 11 2 4GHz long range high signal integrity 54Mbps Super G 2 4GHz long range greater vulnerability 108Mbps G standard to interference due to using Only possible with using dual greater amount of available other channels spectrum Super G devices 5 0 GHz 802 16e 10 GHz to long range covering 18 to 34 1 000 Mbps 802 16m 66 GHz miles and 2GHz to 11GHz Bluetooth 2 45GHz No native support for IP so it 2 Mbps Typically used does not support TCP IP and to connect wireless LAN applications well cellular phones Not originally created to and wireless headsets support wireless LANs Best suite
59. long to load adding background music that slows down the loading process and making the web page difficult to read Your web page should get right to the point without a lot of hype Often a short introductory summary followed by a well designed menu of links is the best way to pull someone into your page The information should not be buried too deep in the web site if a user feels that they are on a tiger hunt for the information they are seeking they may leave your web site altogether Other mistakes include fonts that are too small fonts that are too large backgrounds that make it tough to read the text and formatting that does not work well with a wide variety of browsers Conclusion A clean fast web site will help keep the prospect interested in exploring your web pages Don t get too fancy on the home page for example link to impressive slower movies and voice in sub pages and warn the user by advising them how big the files are so they can judge whether they want to wait for this information Don t Hide Your Company Info Some web pages make it virtually impossible to find the company name address telephone and e mail information Our advice is to add this information to the bottom of every web page you create With this approach the moment the user decides that they would like to contact you your information will be close at hand Content Content Content Sometimes it pays to give away the farm in order for the cows
60. low atomic numbers Energetic ejection of core electrons in heavy elements Compton Gamma rays scattering for all atomic numbers excitation of atomic nuclei including dissociation of nuclei Creation of particle antiparticle pairs At very high energies a single photon can create a shower of high energy particles and antiparticles upon interaction with matter High energy gamma rays While not technically accurate it helps to visualize communications this way Electrons vibrate more slowly at one end of the EM spectrum and faster at the other end of the EM spectrum When you speak through a cell phone to a person in New Zealand your voice is converted into digital signal which is then carried to New Zealand by atoms vibrating at the same speed Each vibrating electron affects the adjacent electron with the same digital signal and so on and so on all the way around the world This happens eloquently like the silver balls in the Newton s Cradle pictured below Copyright April 2010 J Carlton Collins CPA all rights reserved 201 www CarltonCollins com High Tech Communications The Electromagnetic Spectrum http www ntia doc gov osmhome allochrt pdf EEN i i E i i m a Pami rapa HOLVA 0 S MOLL SOT PE tnj a En TH fo ie Ld be ee ela oe Hi IE altel gah a at mam un mete ced ee oe mE ta REN E i a m EL ne a EE E CS te Ea ss iTA siri CL La Ee oe PEF Faas Ea o w
61. low energy around femto electron volts These relations are illustrated by the following equations E he f or f or B where c 299 792 458 m s is the speed of light in vacuum and h 6 62606896 33 x10 34 J s 4 13566733 10 x10 15 eV s is Planck s constant Electromagnetic radiation interacts with matter in different ways in different parts of the spectrum The types of interaction can be so different that it seems to be justified to refer to Copyright April 2010 J Carlton Collins CPA all rights reserved 200 High Tech Communications www CarltonCollins com different types of radiation At the same time there is a continuum containing all these different kinds of electromagnetic radiation Thus we refer to a spectrum but divide it up based on the different interactions with matter Region Of The 6 Main Interactions With Matter Spectrum Radio Collective oscillation of charge carriers in bulk material plasma oscillation Microwave far e ee Plasma oscillation molecular rotation infrared Near infrared Molecular vibration plasma oscillation in metals only Visible Molecular electron excitation including pigment molecules found in the human retina plasma oscillations in metals only f Excitation of molecular and atomic valence electrons including ejection Ultraviolet l of the electrons photoelectric effect crave Excitation and ejection of core atomic electrons Compton scattering for
62. many different vendors 13 Fraud And Security Concerns Given the lack of ability to inspect merchandise before purchase consumers are at higher risk of fraud on the part of the merchant than in a physical store Merchants also risk fraudulent purchases using stolen credit cards or fraudulent repudiation of the online purchase Secure Sockets Layer SSL encryption has generally solved the problem of credit card numbers being intercepted in transit between the consumer and the merchant Identity theft is still a concern for consumers when hackers break into a merchant s web site and steal names addresses and credit card numbers A number of high profile break ins in the 2000s has prompted some U S states to require disclosure to consumers when this happens Computer security has thus become a major concern for merchants and e commerce service providers who deploy countermeasures such as firewalls and anti virus software to protect their networks Phishing is another danger where consumers are fooled into thinking they are dealing with a reputable retailer when they have actually been manipulated into feeding private information to a system operated by a malicious party 14 Assurances Quality seals can be placed on the Shop web page if it has undergone an independent assessment and meets all requirements of the company issuing the seal The purpose of these seals is to increase the confidence of the online shoppers the existence of many diffe
63. most important step you should take is to develop multiple web sites to represent each product or service you sell For example a given CPA firm might have a web site devoted exclusively to individual tax preparation another for Pension and Profit Sharing another for corporate tax write up services systems work etc This will allow you to design a web site that will come across as right on point for the user searching for your particular service or product Designing Your Web Site The design and layout of an effective web site can become quite confusing especially over time as the web site is improved and new personnel are brought in to manage the site For this reason you should approach the design in an organized manner Your first step might be to use a large grease board or poster board to sketch out your general desired layout complete with arrows to indicate links For example you initial rough draft may look like the following Copyright April 2010 J Carlton Collins CPA all rights reserved 120 High Tech Communications www CarltonCollins com Company Order Form i Llictaryw Once you have sketched out the basic design of your web site the next step is assign persons to develop the content for each site This content can be developed in any standard word processor spreadsheet or database application However once you begin to actually develop your web site it is highly recommended that you use a common web page
64. of Electronic Commerce research shows that the higher the level of education income and occupation of the head of the household the more favorable the perception of non store shopping 2 At first the main users of online shopping were young men with a high level of income and a university education This profile is changing For example in USA in the early years of Internet there were very few women users but by 2001 women were 52 8 of the online population 3 One third of people that shop online use a search engine to find what they are looking for and about one fourth find websites by word of mouth 4 When an online shopper has a good first experience with a certain website sixty percent of the time they will return to that website to buy more 5 Am Shocked By This About one fourth of travelers buy their plane tickets online Only 1 4 You ve got to be kidding me What do the other 3 4ths do Stand in line at ticket counters Purchas tickets over the phone I can t think of poorer use of my time or a poorer way to price shop for the best value 6 Shopping Cart Software Most online retailers use shopping cart software to allow the consumer to accumulate multiple items and to adjust quantities prior to completing the purchase 7 Market Share E commerce product sales totaled 146 4 billion in the United States in 2006 representing about 6 of retail product sales in the country The 18 3 billion worth of clothes s
65. on their Facebook page which is automatically displayed on your Facebook Wall page To protect against this possibility Facebook provides the ability to customize the visibility of your wall postings To access these settings select Options Settings from your Wall page Make the appropriate setting adjustments as shown in the screen below Profile Story Comments Auto Expand Comments iY Comments on stories will be expanded by default Stories Posted by Friends Posting Ability wW Friends may post to my Wall Who can see posts made by friends Only Friends Combine Posts i Show posts from friends in the default view Application settings You can control which applications can post stories on your Wall on the application settings page Copyright April 2010 J Carlton Collins CPA all rights reserved 72 High Tech Communications www CarltonCollins com In addition to controlling who can view wall postings you can also control who can post to your wall as follows Select Account Privacy Settings Profile Information and make the appropriate adjustments under the Posts by Friends option Notice too that this page provides a checkbox allowing you to completely suppress all wall postings by friends from being displayed Conclusion As a CPA use Facebook both professionally and personally and admit that sometimes there is an uncomfortable blur between the two However who you
66. people have a fear of using their credit card over the internet This is ridiculous Using your credit card over the internet is one of the safest things you can do If you want to take a risk try pulling out your credit card at a Copyright April 2010 J Carlton Collins CPA all rights reserved 137 High Tech Communications www CarltonCollins com restaurant or convenience store that s where your number gets ripped off most Besides there is a federal law that limits your liability to just 50 5 Physical Inspection Many people want to examine and inspect the items before purchasing I ll give you that The Internet does not allow you to touch and feel items before purchasing However you can always find the items at the store and then shop them on line later Many web stores offer a 30 day money back return guarantee that helps a little In 2001 my wife and took our kids to see Santa Claus at the mall and afterwards we shopped for a couple of hours It wasn t until we walked out of the mall that noticed that we had not purchased a single item in the mall but we had compiled a list of items to shop online It was not intentional mind you it is just a habit that comes natural to us now certainly don t want those stores to go out of business but saving 20 to 25 is fairly important to me How about you 6 Fear Viruses Many people avoid Internet shopping because they fear fraud viruses and pornography It is true that the I
67. presentation skills were D B 2 Q 3 The learning objectives were met D 3 D D 4 The course materials were valuable and contributed to learning D B D D 5 The course content was relevant G 4 3 D l 6 Time allocations were appropriate D D D D 7 Please rate the quality of the facilities D B D S Were prerequisite requirements appropriate D D D D 9 Please rate the effectiveness of the audio visual systems D D D COMMENTS
68. protect you against inside employee abuse many people wonder if any governments might be listening in on your cellular phone calls It is true that the government can tap your cell phone this is accomplished at the network and is similar to the wiretap of land line telephone calls a warrant must first be issued for a cellular phone tap before the government can breach your privacy Even more alarming to some is the notion that the US Government is listening to all of your cellular phone calls using a program called Echelon This program was implemented several decades ago and is still in operation today Under this program the United States government works jointly with Australia Canada New Zealand the United Kingdom to operated the Echelon intelligence program which intercepts and inspects telephone calls faxes e mails satellite communications and other digital data across the globe The program primarily resides at the fiber optic backbone switches where all electronic communications are downloaded and disseminated which means that a software program looks for and flags communications that contain potentially threatening or illegal language The program is intended to search for terrorist plots drug dealers and political intelligence While governments have not publically admitted to listening in on cell phone calls it is widely suspected that they are For more information please see http en wikipedia org wiki Echelon signals intel
69. question You can use serial ports the default for older devices USB ports for newer devices infrared ports modems for dial up access or Ethernet PC cards and CompactFlash cards for j ActiveSync G T d o17 ok Options access over the corporate LAN Microsoft doesn t Choose the data you want to sync provide a server Windows PC 2 side ActiveSync G 7 40 17 X synchronization Windows PC 2 CoNtaEIS y d Synchronized 28 03 05 20 39 Calendar pro uct Windows PC L E mail comparable to Synchronized 28 03 05 23 04 ret mobile review com Hotsyne server Fk Notes The company relies gt Mica Favorites on third party mobile review com ls Files VE Media J Windows PC developers and solution providers to extend the enterprise features of its Pocket PCs and other mobile devices In my experience ActiveSync is almost as reliable as HotSync Occasionally however a user s PDA will refuse to synchronize with its host PC You can usually solve this problem by rebooting the PDA and if necessary restarting Windows on the host PC Copyright April 2010 J Carlton Collins CPA all rights reserved 166 High Tech Communications www CarltonCollins com Along with the release of the new OS for PocketPCs Windows Mobile 7 0 Microsoft is also unveiling a new and improved version of ActiveSync According to synthetic tests the synchronization speed has increased slightly by 10 15 Data access speed has also skyrocke
70. source onto a screen After that the two become vastly different Inside a video projector is a processor that converts an analog or digital video input signal into something that can be projected onto a screen and viewed not just by the family gathering to see home movies or pictures but typically by large groups in meeting rooms and auditoriums LCD vs DLP Digital Light Processing There are currently two competing technologies used in video projectors today LCD or Liquid Crystal Display common to many computer monitors and televisions and DLP which stands for Digital Light Processing An LCD projector basically works by passing a powerful light source Copyright April 2010 J Carlton Collins CPA all rights reserved 107 High Tech Communications www CarltonCollins com through a transparent LCD chip made up of single pixels to project an image through a lens to a large screen These types of projectors are highly portable well suited for multimedia use and feature high contrast and brightness capability as well as low power consumption LCD Projector Limitations 1 An LCD projector can often times exhibit what is called the screen door or window effect Since the screen is made up of individual pixels the pixels project in a pronounced manner when viewed on a very large screen thus giving the appearance of looking through a screen door 2 Just like their LCD monitor counterparts LCD projectors can contain dead pixels
71. submits their credit card and the map is e mailed to them T shirt and cap sales bearing our logo start moving as well Fulfillment is carried out by another company Fishing companies start paying us to advertise on our web site Based on our recognition fishing companies pay us to speak at their conferences for a fee We receive endorsement contracts and our empire continues to grow In this case we can see several clear differences between the process of launching a new magazine in 1990 and launching one today To recap 1 Today launching a web magazine has virtually no financial risk 2 With a web magazine there are no printing costs and no distribution costs 3 A web magazine is instantly accessible to millions of people around the world 4 Today the web makes automatic order receipt and forwarding to fulfillment companies a real possibility Copyright April 2010 J Carlton Collins CPA all rights reserved 130 High Tech Communications www CarltonCollins com This my friends is what call opportunity unprecedented opportunity Seize the opportunity Still not convinced Maybe you think that a magazine might have a good chance but that other companies who do business via the web are doomed After all print media is ideally suited for the web Well you are a skeptic and appreciate that Let me attempt to sway you further over to my point of view Let s take you to the complete opposite end of the spectrum Let s assume
72. to Build A Web Page Building Your Web Page The next several pages explain the basic procedures for building and posting a standard web page In the nineties building a web page involved the use of complicated HTML Hyper Text Markup Language tools such as HTML Editor or HotMetal Editor As far as basic tools go these products were complicated to learn and contained many limitations such as the inability to edit in WYSIWYG mode and a serious limitation on the size of the web page itself Today the process of developing a web page has been made much easier with the introduction of numerous new web development tools and the addition of HTML file format support in the popular word processing packages such as Microsoft Word Many of today s desktop publishing spreadsheet and database packages also support HTML file formats This makes the creation of a web page as simple as saving the file to the HTML format As an example this chapter on posting a Web Page could be transferred into a web page simply by selecting File Save As Web Page from the Microsoft Word menu as follows View Insert Format Tools Table Ctrl h Chril o Chri 5 Versions Word saves files to an HTML file format This action saves the file to the proper HTML format ready for uploading to a web server Even the pictures screen captures and graphic images included in this file would be converted to GIF images Of course the creative side of web development re
73. use To learn how to mitigate this problem please refer to my article entitled Web Impressions e Improper Page Title Most search engines award brownie points to your web page when the search term is part of the page title For example if the person is searching for toasters then Billy Bob s Toaster Museum page will receive more brownie points than the Wal Mart web site Herein lies a fundamental problem with large web sites that offer thousands of products they can t include all of the product names in their keywords and page titles In this case the advantage goes to the little guy Like keywords the title of a page is embedded into the page s programming code via a command line as follows lt TITLE gt Accounting Software lt TITLE gt Copyright April 2010 J Carlton Collins CPA all rights reserved 123 High Tech Communications www CarltonCollins com e Failure to Submit Once you ve built your web site and included all of the key parameters the next step is to visit each search engine and submit your web pages The process is fairly easy but submitting to multiple search engines takes time There are services out there that will submit your web pages for you for a fee Personally find that that you can simply submit your web page on your own to the top ten or twelve search engines and obtain good results Here is a link to my list of search engine submission pages e Failure to Submit All Pages Some compa
74. 1024x768 6000 Lumens 2000 135 30 pounds 5 129 Sanyo PLC XF45 LCD Projector 1024x768 10 000 Lumens 100 1 81 6 pounds 5 129 Specifications Whether you intend to use a projector for small business meetings large auditorium presentations or even as a high end display for your home theater system several factors are universally important 1 Resolution Like LCD monitors projectors have a native resolution outside of which their projected image becomes blurry and fuzzy The standard resolution is also 1024 x 768 with higher resolution models bringing a premium price though some lower resolution models which can project an 800 x 600 image are coming down in price and would serve as an adequate backup projector Brightness Measured in Lumens 1500 is a fine specification for small groups or moderate home theaters 3000 works for large meeting halls and home theater enthusiasts generally look for at least 2500 lumens in a fairly portable presentation unit Contrast Ratio This value has a substantial impact on image definition The greater the ratio the greater the disparity between light and dark areas higher numbers allow for virtually true blacks and whites 1000 1 good 2000 1 or higher excellent Bulb life Because the actual light source comes from a physical bulb projectors have a limited life span before the bulb must be changed Never let the bulb come into contact with skin or the oil residue will c
75. 3 Observing 13 Social Interaction 13 Demonstrating 12 Mediating 12 Writing or Drawing 12 Discussion 11 Viewing Film Video 10 Panel presentation Audio Listening Lecturing NI 0 Source B M Harris Keys to Success 15 believe the key to success is Aptitude 85 believe the key to success is Attitude Source Harvard Business School Study Copyright April 2010 J Carlton Collins CPA all rights reserved 17 High Tech Communications www CarltonCollins com The Four Quadrants of the Brain Different people favor a different quadrant of the brain This effects the way they think they way they learn and the way they communicate Upper Mode Thinking Processes E One of the many tools that are available to us to help better understand not only our preferences for communicating for how other individuals prefer to communicate is the Herrmann Brain Dominance Instrument HBDI Ned Herrmann developed the HBDI more than 25 years ago while he was working as a head of management education at General Electric The HBDI measures a person s preference for right or left brained thinking and for intellectual more visceral or gut oriented thinking The model combines these two dimensions to create four quadrants A through D Quadrant A is the Rational Self Analyze Quadrant B is the Safekeeping Self Organize Quadrant C is the Feeling Self Personalize Quadrant D is the Experimental Self Strategize Each quadrant rep
76. 600 Mbit s with the use of four spatial streams at a channel width of 40 MHz 8x 12x oe Faster Faster lt 2 p Wireless G Wireless G High Speed DY meiuireless N MIMO overcomes the weaknesses of other wireless networking technologies that are confused by signal reflections instead using reflections to increase the range and reduce dead spots in the coverage area The stronger signal allows for wireless connections up to 3 times farther than standard than those possible with regular G networks Additionally by utilizing the reflected signal MIMO can also hypothetically increase throughput about 8x more than regular G MIMO routers avoid interference by dynamically switching to the clearest channel available Copyright April 2010 J Carlton Collins CPA all rights reserved 203 High Tech Communications www CarltonCollins com MIMO technology uses multiple antennas to resolve more information than possible using a single antenna One way it provides this is through Spatial Division Multiplexing SDM SDM spatially multiplexes multiple independent data streams transferred simultaneously within one spectral channel of bandwidth MIMO SDM can significantly increase data throughput as the number of resolved Spatial data streams is increased Each spatial stream requires a discrete antenna at both the transmitter and the receiver In addition MIMO technology Diagram of proposed s
77. 7 High Tech Communications www CarltonCollins com The Amazon Kindle is a convenient portable reading device with the ability to wirelessly download books blogs magazines and newspapers Just over 1 3 of an inch as thin as most magazines and weighing in at 10 2 ounces you can wirelessly download books in under 60 seconds no PC required There are no annual contracts no monthly fees and no hunting for Wi Fi hotspots because the Kindle has built in cell phone that does tall the work The Kindle reads like real paper without glare even in bright sunlight and holds up to 1 500 books The battery life between charging is about 4 days The Kindle can also display PDF documents natively And has a Text to Speech feature so the Kindle can read newspapers magazines blogs and books out loud to you unless the book s rights holder made the feature unavailable Over 450 000 books are available including 101 of 112 New York Times Best Sellers plus U S and international newspapers magazines and blogs Additionally over 1 8 million free out of copyright pre 1923 books are available to read on Kindle including titles such as The Adventures of Sherlock Holmes Pride and Prejudice and Treasure Island Copyright April 2010 J Carlton Collins CPA all rights reserved 198 High Tech Communications www CarltonCollins com Wireless Networking amp Internet Hotspots Chapter 25 Copyright April 2010 J Carlton Collins CPA
78. A is a Certified Public Accountant with experience in technology tax auditing accounting systems financial reporting and bond financing He is an author lecturer and technology amp accounting systems consultant He has published more than two dozen books two hundred articles and thousands of web pages As a public speaker Mr Collins has delivered more than 2 000 lectures in 44 states and 5 countries addressing more than 500 000 business professionals including numerous keynote lectures at national and international conferences Key awards include AICPA Lifetime Achievement Award Tom Radcliffe Outstanding Discussion Leader Award GSCPA Outstanding Discussion Leader Award and Accounting Technologies Top Ten CPA Technologists Award As a consultant Mr Collins has assisted 275 large and small companies with the selection and implementation of accounting systems Mr Collins has a Bachelors degree in Accounting from the University of Georgia is a 26 year member of the AICPA and the Georgia Society of CPAs and is also a licensed realtor At the University of Georgia Mr Collins was elected President of the Phi Eta Sigma Honor Society was initiated into the BIFTAD Honor Society was a member of Alpha Tau Omega fraternity and served three years in the Judicial Defender Advocate program At Glynn Academy High School Mr Collins was Senior Class President Class Valedictorian and received a principle nomination to Annapolis Naval Academy
79. ASA Research www Carltoncollins com www ASAResearch com www CPAAdvisor us www AccountingSoftwareAdvisor com www AccountingSoftwareReports com www AccountingSoftwareAnswers com www AccountingSoftwareConsulting com www AccountingSoftwareNews com www QuickbooksAdvisor info www AdvisorCPE com www CarltonCollins com www ExcelAdvisor net www MBSAdvisor com www SBAAdvisor com www OfficeAdvisor us www CarltonCollins com We publish selected materials power point slide shows and downloadable example files on the web as a service to the CPA community Please feel free to learn about our other topics at these great web sites Thank you Sf brit Gaz ASA RESEARCH About Mr Collins Biography 2010 Courses amp Lectures Ratings Recent 2009 Ratings Books Published Articles Published Carlton Quoted Participant Comments Pictures Speaking Keynote Titles Topics Pricing Speaking Fees Consulting Awards CPA Certificate AICPA Certificate GSCPA Certificate GSCPA Discussion Leader Award Great Plains Reseller Solomon Advisory Council Epicor Partner Award ACCPAC Outstanding Partner Social Networking Facebook Carlton Collins Carlton on Wikipedia J Carlton Collins CPA Keynote Speaker Highly Rated amp Entertaining Speaker More than 2 000 Presentations Technology Expert J Carlton Collins CPA Biography ASA Research Atlanta Georgia Carlton ASAResearch com 770 842 5902 J Carlton Collins CP
80. Carlton Collins CPA all rights reserved 164 High Tech Communications www CarltonCollins com Synchronization Introduction l ape 2 ActiveSync Implementing a synchronization solution can be one of the best measures you can take to make you more productive In effect you can carry the equivalent of your Rolodex calendar and notebook with you wherever you go and l eliminate the need to rerecord on your PC the information M 3 30 PM you enter on your PDA and vice versa You generally will sync data to achieve two goals as follows Status Microsoft Exchange Server Retrying 1 You can sync data among the various computers and devices you use or 2 You can sync data between computers and devices y used by other people Sync Menu E Syncing Examples Sync your contacts emails calendar and to do list with your hand held device Sync your contacts emails calendar and to do list with your laptop computer Sync your contacts emails calendar and to do list with your cellular phone Sync your contacts with a master contact file maintained by your company k a a Microsoft ActiveSync K aloj x Fle View Tool Heb Hand Held Devices Let s face it inputting large volumes of data into a hand held device gt olga BB such as a Palm Pilot or iPAQ is a tedious Sync Stop _ Details Explore Options activity it is much easier to input this MobilePro_770 Connected informatio
81. Collins com Survey Software Solutions When was the last time you asked your customers business partners or employees to rate your products services professionalism It has been shown that the sheer act of asking for feedback has a positive impact even if the customers business partners of or employees don t respond The emergence of e mail and web based survey tools now makes it fast and easy to create and conduct your own surveys Today survey Tools like Zoomerang Survey Monkey and Survey Gizmo make it quick and easy to conduct surveys and the results are tabulate and updated automatically as results pour in Email Address Signin gt Buy Online A Password EONO Or call 800 316 0662 UA zoomerang aan Easiest Way to Ask Fastest Way to Know Home Online Surveys Online Sample Resource Center Online Surveys by Zoomerang inaa gt Start using the 1 The best survey software for fast easy feedback __ online survey tool today gt Powerful Online Surveys Zoomerang s online survey software helps you create online surveys with advanced reporting PowerPoint charts skip logic custom branding and more New Multi user functionality Advanced Consumer Survey Respondents l Zoomerang has over 2 million people ready to take your survey We ll gt Eye Catching Charts connect you with the people whose feedback matters the mostto your gt Export to Excel project Get a quote gt Skip Logic and more Flexible Online
82. Day Free Trial Consumer Video Calling Business Video Conferencing Ad Free Easy to Use 9 way video conferencing Administrative tools amp reporting New Streamlined interface Collaboration features Learn more 2008 SIIA Best 2007 IP Communication MCODIEY Beery Services Company of WINNER Solution enemas the Year Codie Awards May 20 2008 Frost amp Sullivan November 2006 Get to Know SightSpeed SiantSpeed is the award winning provider of Internet video chat and voice callina for friends and family and video conferencina solutions for Internet Protected Mode On fav 100 3 Google Talk A soft VoIP application for Windows that offers VoIP and instant messaging Mac users can talk with Google Talk users using Jabber enabled clients such as Adium and iChat Linux users can use Gaim See real time availability and status of friends online Send instant text messages Easily go from text to voice chat Chat right from your desktop or from Gmail shravan gt lt i a _ _ _ _ _ o sere J e cn NL l Send voicemail srw eel ee ee i te eel PPh hae Copyright April 2010 J Carlton Collins CPA all rights reserved 41 High Tech Communications www CarltonCollins com 4 Gizmo5 Make calls anywhere without downloading Add Gizmo5 to your Desktop Add Gizmo5 to your mobile phone Claims best per minute rates available to landlines and m
83. Graphics to show the data in richer more visual ways In the example below the Customer Satisfaction with the different call centers can be visualized as a speedometer data bar and we can also show a trend arrow indicating if customer sat is going up or down Los Angeles CA Newark NJ Seattle WA Calls 6 383 Calls a0 242 SolyeRate 3 49 SolveRate 4 03 14 091 5 37 Cat TT We could leave the PivotDiagram like this it s already showing us some important information in a visual easy to understand way But since this information is geographically related it Copyright April 2010 J Carlton Collins CPA all rights reserved 187 High Tech Communications www CarltonCollins com might be even easier to understand if we placed it on a map This brings us to another important point about PivotDiagrams you can easily customize the layout to better communicate the data While they start out looking like a tree diagram similar to an organizational chart this is just a starting point for you to customize to suit your needs In this case you can simply select and delete the connectors between the shapes drag out a U S map shape to the page and place the different PivotDiagram shapes in their appropriate locations around the map Support Center Customer Satisfaction Last Late Perey 24 2006 Once you end up with a graphic that you are happy with you can save it and refresh it on a regular basis as data change
84. I Carlton wi Inventory Pricing Receipts and Adjustments Carlton Links cy General Ledger Carlton URL a Customers Setup Carlton Microsoft Small Business Center F Microsoft XML Training wh Inventory Setup Carlton PC World Review of SBA PC Magazine Review of SBA More Items Microsoft SBA SDK Office 2003 Small Business Edition Carlton Debbie Mary Lou a Add new member Add new document o Add new link Tasks Title amp Assigned To Status Chapter 02 New User amp Security Yogi Completed Chapter 10 Sales Orders and Invoicing Carlton In Progress Chapter 09 Purchase Orders Bills amp Checks Carlton In Progress Chapter 24 Business Services Not Started Chapter 22 Time and Billing Not Started Chapter 23 Payroll Not Started Chapter 21 Job and Project Costing Not Started Internet yo Ba q 0 gt 0 11 58 AM Copyright April 2010 J Carlton Collins CPA all rights reserved 181 High Tech Communications www CarltonCollins com M icrosoft Visio Professional pg anal version 2002 Microsoft Office Visio 2010 Chapter 22 Copyright April 2010 J Carlton Collins CPA all rights reserved 182 High Tech Communications www CarltonCollins com Visio 2010 is a diagramming program for creating business and technical diagrams that document and organize complex ideas processes and systems Diagrams created in Visio 2010 enable you to visualize and communicate information clearly concis
85. Information t ia lemized Expennes eheripion ky T Other l 0 00 Ez Dieta Subetatad 6 00 Lee Canh ooo Oe bt Office InfoPath 2010 provides real time validation pre populated fields and connections to important sources of information Office InfoPath 2010 solutions are integrated with the Microsoft Office system to deliver powerful electronic forms capabilities in a familiar package Copyright April 2010 J Carlton Collins CPA all rights reserved 96 High Tech Communications x G G Personal M Weather www CarltonCollins com http jmoss 200 Pserver Laa yp Webmail cP Netscape com 5 Inside Netscape Ge E htip moss 200 7server _layouts FormServer aspx Xsnlocation Fo wa can ma Fie Edi Report Dake View Favorites Took Help eT Ri Home E Feeds i Send to OneNote Mi Print 7 5 2006 JE Business Purpose Employee Information Warr Daesgrtienaent E mail dddranas Manager Information MAA i itemized Expenses Date El Add Expense litem Details InfoPath forms can be deployed to many Web browsers for fill in including Microsoft Internet Explorer Description Subtotal Leas cash advance Total expenses Netscape Mozilla Safari and others Centralize Forms Management And Control Office InfoPath 2010 and Office SharePoint Server 2010 can be combined to centralize the dep
86. List feature allows you to organize your friends by groups These groups can then have individual privacy policies applied to each of them to extend or suppress your be aia Facebook information by List For example the screen below j shows that have set up several lists including Neighbors Relatives and Professional Relationships These three groups 5 News Feed can then be used to apply different privacy policies For iL Messages example may want your Relatives to see the photos from fit Events my vacation but don t want my Neighbors or Professional Photos Relationship friends to view them Please note that a single 20 Friends 9 friend can belong to more than one group You can create new Lists by selecting Create a List on the Facebook s Friends facebook Find Friends Status Updates page ATOS Childhood Course Attendees 3 Hide Your Friend List from Non Friends a i By default your Facebook friends list is viewable by everyone Imagine for a moment how an unscrupulous person might use Professional Relationships this information to steal your identity or discredit you in some Relatives way or how a competitor might use this information to target saint Simons Island your client list To hide your list of friends from the public click UGA the pencil icon in the Friends box on your profile page and uncheck the Show Friend List to Everyone box Thereafter non friend
87. Pane if Slide Layout task pane when inserting new slides i Status bar if Vertical ruler iv Windows in Taskbar Slide show i Show popup menu button if End with black slide Default view Open all documents using this view The view saved in the File Copyright April 2010 J Carlton Collins CPA all rights reserved 192 High Tech Communications www CarltonCollins com Controlling the Master Slide PowerPoint provides a slide master page which allows you to set up the background fonts and formats to be used for every page throughout your slide show Setting up the slide master page first makes it easier to then position your text and objects in an attractive manner as you create your presentation The slide master page is accessed under the View menu In the sample screen below you can see have inserted a washed out image of myself as part of the background this image will now appear on all slides a Mieresali PowoiPoind Presentathent G fle gdt view Insert Pomat Toos Stile Show Window heb Acrobat Ce a dEl trees n l 7 oo Sade Sorter J Notes Pape mer Bs lit Master title style Comoe Green ae Handa Muscches mae Title Ares for Rutol ayouts Tiik Pres Rohe Minster Toolbars Click to edit Master text styles os Second level irdd ard Goucher Fard lave Fourth level x Fifth level Maaa irati D biigiir ated Fb in Tari Object Ares for Autolaouts ois Humber ares Cus
88. Protect Yourself from FaceBook Advertisers Many of the advertisers who display ads on Facebook deposit tracking cookies on your computer to collect information about you and your computer habits To protect yourself somewhat CPAs should consider opting out of the placement of cookies by many of these advertisers at this web site http www networkadvertising org managing opt out asp CPAs may also adjust the cookie settings in their browsers to limit or prevent tracking cookies by Facebook advertisers and others Copyright April 2010 J Carlton Collins CPA all rights reserved 69 High Tech Communications www CarltonCollins com 8 Remove Your Facebook Content From Google By default all Facebook user profiles are indexed by Google and other search engines This means that some of your profile information is accessible through Google including your profile picture friends list and fan pages to which you belong Some CPAs may use their Facebook presence for generating new contacts and may therefore like being included in Google search results while other CPAs may not want their information to be that public If you prefer privacy you can remove your Facebook content from all search engines by selecting Account Privacy Settings Search and unchecking the Allow check box next to the Public Search Results option as pictured in the screen below Privacy Settings Search 4 Back to Privacy Facebook Search R
89. R ODOMMO S 8937 11312 Hwy 15 501 N CHATHAM CROSSSHIGS Chapel Mill NC DOMINO S TRACKER Ei SHARE ON FACEBOOK OUT FOR CELIVERY PERFECTION CHECK COMPLETE Matthew daute checks your rdw tr palaton at 6 32 PN EXCLUSIVES FROM DOMINO S GIVE US YOUR FEEDBACK 52 05 Conraue ro rome MOUSTI How likely ate pou to reccommend ut CONNECT 4 30 IN COUPONS We wami your orderning erperience to rock How was i ie yo Sai USE THIS HANDY BOX TO EXPRESS YOUR THOUGHTS AND FEELINGS ABOUT DOMINO S GETCOUPORS SEND EX CMP OFFERS Arby s sends out coupons and special deals to help keep their brand on your mind and to bring you into the store fi BibrT sia ii heita Cot Stee bad Seer hait etr DA badda Cer bie t kaaj Babli Livr abr bhi kite bafb a Boar be eb t ula bi hatim iai bial abl ees FREE BBO iti WITH ANY SOFT DRINK PURCHASE ROASTBURGER Tu k G UUI eee re AP Pe Pe PEL T anir gm Bbh beibe Coens RRR nai Feim Bij habtu Cee RRL i kilpa CMs TSE e nbn he de noe Oe Weri TREDE 5 ee mja ee ia pardi ee de i a p ain Copyright April 2010 J Carlton Collins CPA all rights reserved 140 High Tech Communications www CarltonCollins com Fat Wallet allows you to register an item and set a price point and when the price falls to your price point you are notified immediately so you can purchase that product for the price you want Facts amp Comments About Online Shopping 1 According to the Journal
90. RY INTERNATIONAL TAX CONSULTING Spunanned Luke Relocation Tax Services LLC specializes in tax preparation and consulting for relocated employees domestic or international and their employers Global tax guidance a a i i International tax data and analysis www phs2 neticwi L3 00964i htm 32k Cached Similar pages Essential for cross border planning www bnail com tax Canadian tax consultant with special interest in international tax interest who practices as an independent consultant on a on a wide variety of domestic tax issues his practice places special emphasis on international tax planning eet as Ta Comain Desc ription Toronto area PTCS Professional tax consulting Category Business gt Accounting gt Firms gt Regional gt Canada firm specializing in S amp U tax issues www taxca com 9k Cached Similar pages www taxcontracting com interest KPMG home 12 16 Billion 13 4 Growth In US Dollars KPMG International the global network Tax Planning of professional services firms providing audit tax and advisory services Tax minimization strategies Description Major international accounting and consulting firm s Category Business gt Accounting gt Firms www irstaxattorney com www kpmg com 14k Mar 23 2004 Cached Similar pages idea Notice that only a few of the web pages listed use the title International Tax Consulting The resu
91. Service Calls LIFT MILE Taking flexible quick and Ensuring best focused action to respond to practice logistics new challenges in production and supply chain and maintenance management e688 Very Important Process Repeat 3x Defwstrate Valve Covers Copyright April 2010 J Carlton Collins CPA all rights reserved 185 High Tech Communications www CarltonCollins com Wise 3DViewer C Program Files 3D Visioner sample v3d i UO xe eee opportunity_flowchart flo RFFlow A IEE IEOS H t ee File Edit View Insert Stencils Tools Zoom Help aS x a A Orientation Connected Connect Duplicate Delete Center Zoomin Zoom Out More Shapes Opportunity Flowchart Ci ie Text Opportunity Rowehart Order Processing Tur Aatert Added o Co ct Added Only New in Visio 2010 PivotDiagrams are similar to PivotTables in Excel They allow you to work with data where you want to see groups and subtotals An example of PivotDiagram is shown below Product Sales AllRev 2 316 069 Units 20 579 Direct Fart TEY AI Rev All Rev 118 511 All Rev 469 472 All Rev 5 744 212 Units Units 386 Units 3 957 Units 7 400 aad Direct Direct Part Direct Part Direct Part PivotDiagrams are great when you need to communicate the key pieces of information in your data to other people in a very visual way It s also easy to drill into your data with PivotDiagrams and find exactly the right parts of
92. The person who answers your phone is critical to your marketing success You can create powerful effective marketing in every area but if you have a weak person answering your phone you ve got problems You want the person who answers to be friendly informed and efficient The person calling your office can notice a weakness on the telephone in the first three seconds It s a negative impression you don t want to make Experts say that the person answering the phone should be the highest paid person in the office other than you When prospects call your office are they greeted promptly by someone who makes sure their calls get to the proper person without delay Copyright April 2010 J Carlton Collins CPA all rights reserved 35 High Tech Communications www CarltonCollins com 10 11 Voice Mail Message Some people hate reaching voice mail but actually like voice mail because it sometimes allows me to leave the information you requested without having to string out a longer conversation However what do hate are those long instructions Believe me by now we ve all learned what to do at the beep The best advice is to make sure that you telephone is answered during reasonable business hours within a few seconds Thereafter keep your voice mail instructions as short as possible When you re fortunate enough to have prospects calling your office make sure the message they receive even a voice mail message is pro
93. Therefore you may need to find a lowest common denominator setting Here s how you set up WPA j First verify that each computer is running Windows XP Service Pack 1 SP1 or later k On each computer verify that the client s network adapter is compatible with the Wireless Zero Configuration WZC service To do this consult the adapter s product documentation manufacturer s Web site or appropriate customer Copyright April 2010 J Carlton Collins CPA all rights reserved 209 High Tech Communications www CarltonCollins com service line for details Upgrade the network adapter driver and configuration software to support WZC on clients where needed For each computer download and install the Windows XP Support Patch for Wi Fi Protected Access walk through the installation dialog boxes and following the instructions m Continue following the instructions and configure all Wireless Access Points your wireless devices n Continue following the instructions and configure all Wireless Network Adapters your LAN cards Wireless network properties i x Association Authentication Connection Association Authenticati c cti Atherticaton Connection Network name SID SPCROUTER Lar y 3 aiii a homenet sd Wireless network key Wireless network key This network requires a key for the Following This network requires a key for the following oe a Open Network Authentication i Data encrypt
94. You both answer the calls begins and you can talk Does not require any new software or hardware English jajah catalan orem 20 Fm Sern Global phone to phone _ Need help Make a JAJAH call anywhere on your mobile or landline phone to save money and keep in touch with friends and family JAJAH can save you up to 98 on your international phone calls It connects you using your Introducing existing phone No contract no software no headset easy to use JAJAH IP Platform More than 15 million people all over the world already save with JAJAH so why not start saving right now JAJAH IP Platform the world s only complete IP voice and messaging 3 platform Now carriers internet Try it EP CALL NOW companies mobile operators and F service providers can deploy and manage new value adding services No contract first call is free easy to use and solutions fast and low cost and it will save you tons of money l 2 Works No software No headset Works on anywhere required required any phone See how it works gt Find out what you can do with JAJAH IP Platform Awarded by the world s 25 largest carriers as the Best Communication Solution Copyright JAJAH Inc 2009 Blog Corporate Info Press Developers Privacy Policy Terms of use Contact Us 9 OpenWengo A European solution Open Source app based on the SIP protocol for free VolP calls between 2 PCs with SIP compliant soft
95. a webcast Unlike a webinar there is no interaction 5 Interactive A webinar can be collaborative and include polling and question amp answer sessions to allow full participation between the audience and the presenter In some cases the presenter may speak over a standard telephone line while pointing out information being presented onscreen and the audience can respond over their own telephones speaker phones allowing the greatest comfort and convenience There are web conferencing technologies on the market that have incorporated the use of VoIP audio technology to allow for a completely web based communication Depending upon the provider webinars may provide hidden or anonymous participant functionality making participants unaware of other participants in the same meeting 6 Slide Show Presentations Often PowerPoint or Keynote slides are presented to the audience via web conferencing while markup tools and a remote mouse pointer are used to engage the audience while the presenter discusses slide content For example http www asaresearch com expo _files frame htm 7 Live or Streaming Video This type of web conferencing is preferred but often difficult to achieve to high levels of satisfaction due to bandwidth issues on the part of the presenter or the audience members Using this technology full motion webcam digital video camera or multi media files are pushed to the audience 8 VoIP VoIP is where real time aud
96. aba Laam Mora Cell Phone WolF Call Wake calle from iniemet browser et your eal phones T T Laam Mora pi Slick to Call for ooogle ASS a digk 1o Call gaged to your homepage iGoogle or hebibes Then make calls bom Web t Lewn Mare Call Me Button tor eb iad Mal be Diaa ha rur aau abara ba allear rrinrial Copyright April 2010 J Carlton Collins CPA all rights reserved Wednesday Otlober 7 2009 Specials Canada VoIP Plan r 60syear Local Homa Phone Pian Available in Torona Vancouver Montres Cakpary Edreonion Ofawa Kingalon Winds Subscribe ew lore Available Humbera International Calling Rates L hina VoIP PEX install a Vol PEE bo ud Wouter for yau busines Wore init Wil Pipa ric Internet Protected Mode On 44 High Tech Communications www CarltonCollins com Review of Skype By J Carlton Collins CPA Skype is a software application that allows users to make voice calls over the Internet in addition to instant messaging file transfer and video conferencing Presented below are Skype highlights 10 Using Skype you can call any computer in the world free of charge Skypeln You can also call any telephone in the world for a small charge currently 1 8 cents a minute SkypeOut If you have a camera your party can see you If they have a camera you can see them You can also use Skype to make conference calls to up to 16 Skype users You can also use Skype to transfer file
97. able Source Input Not all sources are created equal Almost every projector will feature a standard D sub 15 pin input Many will also have an S video connector or legacy RCA inputs The higher end projectors will also have a DVI connection for use with outputting HDTV signals in their appropriate expanded resolution Copyright April 2010 J Carlton Collins CPA all rights reserved 111 High Tech Communications www CarltonCollins com Web Cameras ebcams range from the silly to the serious From videoconferencing with a client to following the movements of animals at your favorite zoo webcams have great communicative potential Until a few years ago often demonstrated one webcam conferencing product that was particularly user friendly With Microsoft s NetMeeting users could converse and send video feeds in real time You could even join a random video conference and meet someone from across the globe Unfortunately that program became overrun with users inappropriate personal webcams However there are still lots of productive uses for webcams For example Linksys Wireless G Internet Video 1 You will be out of town for a week and you want to keep an eye on your home office 2 You d like to be able to check on the babysitter and make sure everything is okay while you re out 3 You d like to know what your dog does in the backyard all day long 4 You want to monitor activity in your warehouse loading dock showr
98. aging AOL Instant epending on how you use the Internet the technology can improve your efficiency and productivity or drain your company s resources and waste valuable time Instant messaging represents one instance of new Internet technology that can be both a burden and a blessing In keeping with the rapid pace of the modern world where email has all but replaced the conventional letter or phone call Instant Messaging may do away with the need for ordinary conversation While it may not replace casual water cooler type chat Instant Messaging can provide a platform for everything from tech support to communicating with relatives without huge long distance bills or an inefficient use of time Messenger Buh ih Co Vyorber 5 119 Following increased consumer involvement with the Internet and proprietary communication services offered by AOL CompuServe Prodigy and others a new program called ICQ heralded the first free Instant Messaging client By installing the communication client and signing on with a userID and password users received real time information on friends and contacts also signed onto the system Message transaction took place through a proprietary protocol which directed messages to a server which then routed them to the appropriate IP address and port number of the intended receiver Users then establish a veritable direct link to their contacts by clicking on any given contact and
99. al reporting selecting accounting software or using a computer Is your web site attractive look professional and make a positive impression Do you have a separate web site and domain name for each major service or product that you sell Does your web site provide electronic versions of all documents such as product manuals installation instructions exploded diagrams etc Does your web site contain key words so that you can be found easier Has your web site URLs been submitted to the various search engines for indexing Do you have a concerted effort to establish cross links back to your web sites so they will rank higher in a search Copyright April 2010 J Carlton Collins CPA all rights reserved 114 High Tech Communications www CarltonCollins com 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 Reading the Web Do you read the web frequently to stay abreast of news and stories related to your interests business and clients Do you use Google alerts to automatically deliver to you relevant stories Do you maintain a clickable list of dozens of web sites that your frequent to save time perhaps through your favorites list or some other list of hyperlinks Do you save relevant articles to your computer for future reference Buying On Line Do you shop all major purchases online before buying Do you use price harvesting web sites such as Pricegrabber com or Pricesc
100. all rights reserved 199 High Tech Communications www CarltonCollins com The Electromagnetic Spectrum Generally Electromagnetic radiation is classified by wavelength into radio wave microwave infrared the visible region we perceive as light ultraviolet X rays and gamma rays The behavior of EM radiation depends on its wavelength When EM radiation interacts with single atoms and molecules its behavior also depends on the amount of energy per quantum photon it carries Penetrates Earth s Atmosphere Radiation Type Microwave Infrared Visible Ultraviolet X ray Gamma ray Wavelength im 10 0 510 8 10 Approximate Scale ot Wavelength Buildings Humans Butterflies Needle Point Protozoans Molecules Atoms Atomic Nuclei 10 108 10 10 10 Temperature of objects at which g this radiation is the most intense W wavelength emitted 1K 100 K 10 000 K 10 000 000 K 977 C 173 C 9 727 C 10 000 000 C Fancy Talk amp Impressive Formula EM waves are typically described by any of the following three physical properties the frequency f wavelength A or photon energy E Wavelength is inversely proportional to the wave frequency so gamma rays have very short wavelengths that are fractions of the size of atoms whereas wavelengths can be as long as the universe Photon energy is directly proportional to the wave frequency so gamma rays have the highest energy around a billion electron volts and radio waves have very
101. an be published to web sites e mailed or embedded in electronic documents via JavaScript iFrame or HTML code Data can be securely encrypted before transmission 3 Automated Tabulation of Result Results are automatically tabulated as received simply log into to view the latest reports 4 Highly Stratified Reports Zoomerang has the ability to provide detailed reports that are highly stratified 5 Pricing Zoomerang offers free pricing for up to 30 questions and 100 responses 200 a year for unlimited questions and 600 a year for Zoomerang s entire bundle of survey features Surveys are one of the most powerful communication tools available to the business community but until now they have been terribly expensive and time consuming to use Other survey solutions are list below Survey Monkey CheckBox Constant Contact NoviSystems Feedback server SurveySolution Vovicl Zarca QuestionPro 10 SurveySaid 11 SurveyGizmo 12 4QSurvey ee OY a E a Copyright April 2010 J Carlton Collins CPA all rights reserved 91 High Tech Communications www CarltonCollins com SurveyMonkey SurveyMonkey Survey Monkey claims to be the world s leading provider of web based survey solutions used by millions of companies organizations and individuals alike to gather the insights they need to make more informed decisions Highlights regarding Survey Monkey are presented below 1 High Satisfaction SurveyMonkey clai
102. an com to help you search for the best prices Do you use customer feedback and ratings to help you select the right product or company to do business with Do you shop online to educate yourself about the features options and competing products before making a purchase even when making a non Internet purchase Do you shop airfares hotels and rental cars online at multiple Internet sites in order to find the best pricing Communicating Do you use e mail Do you have your own domain named e mail account to convey the right image i e don t use and AOL Hotmail Gmail or Yahoo e mail address Do you leave your computer up and running 24 7 so that e mail is always retrieved and waiting on you when you are ready to read it Does your e mail have an automatic signature block containing all of your contact information so recipients don t have to hunt down your information to communicate with you or refer you via phone or snail mail Do you use Skype or some other Voice over IP to make computer to computer or computer to phone calls Do you have a camera installed on your computer so that you can also make video calls Background Checks Copyright April 2010 J Carlton Collins CPA all rights reserved 115 High Tech Communications www CarltonCollins com 28 29 30 31 32 33 34 35 36 37 38 39 40 41 Do you use the internet to perform background checks on potential
103. at someone will find your web page Advanced Web Page Design Techniques Aside from developing a great looking web page with text and graphic pictures there are other measures you can take to spice up your page One of the most popular advanced techniques is to add RealAudio to your web page With real audio wave files can be embedded directly on your web page As the user accesses the real audio file the real audio player buffers the first ten seconds of the file and then begins playing the wave stream The result is that sound starts fairly quickly and continues playing uninterrupted Copyright April 2010 J Carlton Collins CPA all rights reserved 127 High Tech Communications www CarltonCollins com Characteristics of a Successful Web Page 10 11 No Invisible Webs It is difficult sometimes to find web pages in the haystack of the Internet To keep the site from being invisible it must be registered with all of the online search engines like Google Bing Lycos WebCrawler Alta Vista InfoSeek etc and with the catalog listings such as ElNet Galaxy Yahoo the Commercial Sites Index etc In addition the registrations should be kept up to date with new categories and new sites No Dead Webs Some Web pages have a ghost town feel about them because it seems as if no one has been tending them in a while On good sites the content is always fresh information Rich Successful pages are information rich so the site offers
104. ation techniques that you will consider adopting to help you 1 Communicate more effectively 2 Communicate more efficiently 3 Save money Therefore please do not be surprised as we meander through new high tech methods mixed in with older communication methods Thank you Copyright April 2010 J Carlton Collins CPA all rights reserved 5 High Tech Communications www CarltonCollins com Introduction Chapter 1 Copyright April 2010 J Carlton Collins CPA all rights reserved 6 High Tech Communications www CarltonCollins com Introduction Technology is changing the way business communicates New technologies devices and software applications have evolved and as a result people and businesses are communicating far differently often with greater efficiency and better results Are you keeping up Do your communication efforts promote you as a leader or laggard Is there more that you could do to better communicate with your customers prospects employees executive team and board of directors Every leader in the world will tell you that the ability to communicate is the foundation of success This course is dedicated to reviewing and demonstrating the vast new wave of communication tools and solutions that technology has brought forth Specific discussion points will include some of the following points as time permits Carlton s List of Today s Newer Communication Methods 1 Internet Phone and Video Conferencing
105. aton Collies Aisma GA ae Because the service is free and video support is included the experience is different compared to traditional telephone calls It is common for Skype users to keep video based phone calls active for hours as they work together on a common project This arrangement encourages teamwork and enables managers to more easily supervise remote users even when team members are physically located thousands of miles apart However the basic service is just the beginning For a small fee Internet based Skype offers many additional features as follows For example users can also use Skype to call land lines and cellular phones throughout the world directly from their computer used this feature personally in 2009 while traveling in Morocco simply logged into the internet locally and used Skype to call telephone numbers back in the United States The many people spoke to had no idea that was initiating the phone call from a computer In total my phone calls from the African continent to the United States cost me about 1 36 these same calls would have cost more than 300 had a I made the calls with my cell phone Skype also supports call forwarding and Voicemail and can be used to video conference with up to 15 parties simultaneously also use the Skype service as a security device With auto answering enabled am able to use Skype to log into my office or home computers and view live video of the premis
106. ayment of benefits to myself or to the insured 2 INSURED INFORMATION if different than that of patient SERVICES 3 DATE OF SERVICE __ 3c DIAGNOSIS CODE 3a FROM Example InfoPath screen used to create Health Insurance Claim Form Web site authoring tools such as Dream Weaver Front Page and Expression Web also provide form tools for creating electronic documents such as vacation request forms and surveys loan applications order forms and rules base product configurators Because time is always saved when data is only entered once and the resulting data is automatically delivered collected tabulated and reported electronically tech savvy CPAs are always on the lookout for situations where electronic forms can be implemented to save time reduce expenses and promote accuracy If you would like to expand your practices by providing electronic document management services to your clients consider becoming certified as a CDIA Certified Document Imaging Architect by passing the required online exams For those CPAs who possess an extraordinary amount of knowledge in this area you may also consider obtaining the EDP Electronic Document Professional designation from Xplor International a group of experts in the electronic document industry who set standards and judge the qualifications of applicants Copyright April 2010 J Carlton Collins CPA all rights reserved 60 High Tech Communications www CarltonCo
107. b page that contained the word toasters in its key word list its title and in the body of the web page would score higher and therefore would be ranked higher than another web page that simply mentioned the words toasters in the body of the page Based on what I ve seen it appears that many web stores don t understand this simple concept Further both Google and Wisenut use algorithms that will rate your web page more highly when other web sites link to you using the search phrase The only real way to get other web sites to link to your web site is to offer a truly stellar web site If for example you published the definitive toaster web site other toaster enthusiasts would link to your site and you would fair far better in Google and Wisenut searches e Lack of Keywords To rank high you must add keywords to your web store Doing so is very easy here is an example of the line of html code you add to your web page lt meta name keywords content tennis tennis elbow racket racquet gt Adding this line of code will not ensure that you rank high but omitting it will almost always assure that you don t If you are an astute individual you may have noticed a slight problem here If a web store sells hundreds of items wouldn t they need hundreds or even thousands of key words in their web page The answer is yes they would Unfortunately many top search engines actually penalize web pages with a lower score for excessive key word
108. been shot started using the search tools to locate the item in question It took me about 4 minutes but was able to find the exact German Martindale bridle for just 59 00 Needless to say my skeptical friend was amazed and he hung around after the presentation to tell me Why Some People Avoid Shopping on the Web In my opinion there are several reasons why so many people don t shop on line as follows 1 Slow Internet In years past many people had slow dial up access to the internet and as a result shopping on line takes hours not minutes Heck if my microwave oven took 8 hours to bake a potato wouldn t use it either 2 Wrong Search Tools Many people use the wrong search tools to search the internet Try this for yourself Go to Yahoo and search for the word magazine then do the same in Google On march 1 2002 Yahoo found 14 861 hits while Google found 23 700 000 hits Yes that s right 15 thousand compared to 24 million Most people who use Yahoo to search the Internet are in fact using one of the worst search tools possible No wonder they can t find what they are looking for 3 Searching Ignorance Many people don t know how to use the search tools Instead of looking for baseball and equipment try looking for baseball and equipment and S and order and credit card In this manner you are far more likely to find web sites that actually sell the gear you are looking for 4 Fear of the Internet Many
109. cks designed to make you buy more products or more expensive products For example the more expensive higher profit items are at eye level Workers pass out free samples of food for you to taste These techniques obviously work because they keep doing them 4 Maybe you wouldn t purchase 100 of your groceries from a web store but maybe you would have dog food canned drinks soups and canned foods and common staple goods delivered by Billy Bob You might still visit you local grocery store for broccoli and meat so that you can pick it out yourself In this case Billy Bob s allows you to save money on the items you purchase there and it reduces your shopping time in the retail store At this point you are probably thinking Carlton if this is such a great idea then why have other online grocery stores such as WebVan and Peapod lost money and gone out of business Do not worry have the answer for you Peapod embraced the web model only to the extent that customers could place orders over the web However they did not embrace the most important part of the model which is to avoid the high cost of overhead Here in Atlanta Peapod contracted with Brunos the most expensive grocery store chain in Atlanta to fulfill their web orders As a result their prices were actually higher than the local grocery store and the added delivery fee inflated those prices higher still Instead of saving money and time Peapod only allowed you to save tim
110. consumer information Some ask for address and phone number at checkout though consumers may refuse to provide it Many larger stores use the address information encoded on consumers credit cards often without their knowledge to add them to a catalog mailing list This information is obviously not accessible to the merchant when paying in cash Copyright April 2010 J Carlton Collins CPA all rights reserved 143 High Tech Communications www CarltonCollins com The Problems with Phone Communications Chapter 16 Copyright April 2010 J Carlton Collins CPA all rights reserved 144 High Tech Communications www CarltonCollins com The telephone is a great way to communicate in some situations but in many situations it can be a very poor method of communicating particularly in professional situations Consider the following problems with a telephone call 1 Written Record After the call there is no record of what was said If you had sent me an e mail could refer to that same e mail days or even years later to find that name data or information which you conveyed to me but with a phone call will have no record of that data Taking time to write up your notes is a redundant use of time 2 Forwarding Often you want to convey things that were said in a phone conversation to others This requires you to call that other person or persons and repeat everything that you want to convey Had it been an e mail you c
111. ct works with popular cell phones iPhone Nokia BB windows Mobile and PCs and utilizes Copyright April 2010 J Carlton Collins CPA all rights reserved 155 High Tech Communications www CarltonCollins com military grade encryption algorithms which change randomly to enhance security The encryption keys are generated automatically by your cell phone making it easy to use The price starts at 79 per cell phone www gold lock com Other Cell Phone Security Measures In addition to encrypting your cell phone with third party products you might also consider these additional measures 1 Don t assume that your cell phone calls are secure Do not discuss confidential or sensitive issues over your cellular phone 2 Do not leave confidential voice or text messages 3 Usea PIN to protect your cell phone and your voicemail 4 Bewary of texts system messages or events on your phone that you did not initiate or expect 5 Turn off Bluetooth feature if you don t use it 6 Do not leave your cell phone laying around unattended Conclusion In conclusion cell phone conversations and text messages have never been 100 secure and with the recent breach of standard encryption methods there is more cause for alarm than before To be absolutely secure you should consider purchasing a third party encryption program and implement additional measures to protect your cell phone from viruses theft and breach However perhaps the most
112. ctivity via your cell phone free of charge b Allows you to post and reply to your Facebook postings and requests via your cell phone free of charge 6 Privacy Settings a Controlling the content you post b Controlling who can see your information 7 Avoiding the Games a Games can be time wasters b Games can be Data Miners that harvest your data 8 To get the most out of Facebook a Invest time to find your old friends b Take time to post pictures especially older pictures of your friends c Take time to post interesting status quotes frequently d Take time to read the status posts of your friends view their pictures and comment or indicate that you like the post e Use the forum to communicate with your friends ask questions share articles links and videos that might be of common interest to one another Copyright April 2010 J Carlton Collins CPA all rights reserved 64 High Tech Communications www CarltonCollins com facebook Home Profile Friends Inbox 3 News Feed Carlton Collins Settings Logout Q Suggestions What s on your mind Attach amaA Adam McT ish fun night of accounting 37 minutes ago Comment Like r Connor Bergeron likes this Lauren Dempsey dislike haha 25 minutes ago Write a comment Rodi Knapton Rush is going out again with Andy and the guys 44 minutes ago Comment Like Diane Poppineau Ansaldi gt Sandee Joyner Whittingslow Hello my friend Whe
113. d 400 million users Facebook statistics Copyright April 2010 J Carlton Collins CPA all rights reserved 103 High Tech Communications www CarltonCollins com Teleconferencing f more personal contact and real time sharing is needed try a teleconferencing system like Adobe s Acrobat com or GoToMeeting Most services allow screen sharing collaborative white boarding and other substitutes for same room presence without the commute to the meeting even if it s just down three floors the incessant interruptions for coffee and bathroom breaks the face to face socializing or the forced absence from your desktop while you wait for that crucial email Since most also create a transcript you don t need someone taking minutes either Wikis ikis provide a collaborative environment that is ideal for the development of working documents and statements as well as material that will need to be referred to again and again For one off projects an online wiki like WetPaint or PBWiki are ideal free easy to set up and easy to use For more mission critical material especially when you plan to use it repeatedly and where security is a major concern your organization can fairly easily set up an internal wiki on your intranet using advanced software like MediaWiki the software that runs Wikipedia Wikis are self organizing and easy to create and edit and they keep track of changes made along with a record of who is respons
114. d Routers C Add To Cart 2 Wlan Cards And Adapters For desktop computers notebooks and PDAs without integrated Wi Fi the addition of a wireless adapter is a simple and convenient way to enable wireless connectivity on your device Linksys Wireless G PCI Card In Stock 49 99 S54hibps Wireless G Wireless POI Network Interface Adapter Card NIC MFG WMPS4G CDW 452911 See Alt Wireless Adapters Add To Ca Hawking HVWUG1 Wireless G USB Adapter In Stock 53 99 108Mbps 302 11b g Wireless USB Network Interface Adapter with Removable Antenna MFG AWUGT COW 1038208 See Alk Wireless Adapters Add To Ca sCom 11a Wireless PCI Adapter network In Stock 89 99 Network adapter PCI 302 11b 802 11a 802 119 MFG 3CRDAGS75B COW 649210 See Alk Wireless Adapters Add To Ca Belkin Wireless G USB Network Adapter In Stock 39 99 Network adapter H Speed USB 802 116 602 119 MFG FSD7050 COW 674432 See AlE Wireless Adapters _ Add To Ca Copyright April 2010 J Carlton Collins CPA all rights reserved 207 High Tech Communications www CarltonCollins com Wireless Security The use of a wireless device provides an invisible access point into your computer network in a range up to 300 feet radius from your wireless device Hackers use empty tennis ball cans to build devices designed to detect and boost your signal like the device shown below Many users setting up wireless home and s
115. d for connecting PDAs cell phones and PCs in short intervals Backward compatibility When 802 11g was released to share the band with existing 802 11b devices it provided ways of ensuring coexistence between the legacy and the new devices 802 11n extends the coexistence management to protect its transmissions from legacy devices which include 802 11g 802 11b and 802 11a Access Points A Wi Fi hotspot is created by installing an access point to an internet connection The access point transmits a wireless signal over a short distance typically covering around 300 feet When a Wi Fi enabled device such as a Pocket PC encounters a hotspot the device can then connect to that network wirelessly Most hotspots are located in places that are readily accessible to the public like airports coffee shops hotels book stores and campus environments Copyright April 2010 J Carlton Collins CPA all rights reserved 205 High Tech Communications www CarltonCollins com Where can find a Wi Fi hotspot Other than ISP and hotspot provider websites users can locate hotspots using the internet prior to traveling www WiFreespot com and www Wifinder com both feature databases of active hotspots Wi Fi internet access costs vary depending on the Wi Fi service provider and the access plan type typically daily monthly or hourly T BOINGO a WIRELESS Like a public hotspot homes and businesses can support a Wi Fi network by ad
116. d forth FTP or File Transfer Protocol establishes a direct connection between computers for the purposes of file sharing and communication Be advised that FTP requires intermediate Internet and connectivity knowledge to configure an FTP server which may be accessed by client computers WsFTP Remote Control Software Vs Virtual Private Networks Which approach is better These two solutions are dramatically different as follows 1 With remote control solutions the remote keyboard and monitor take control of the host computer located many miles away It is as if the keyboard cable and monitor cable are no longer 6 feet long but many miles long The host computer sends screen images to the remote computer and these screen images are relatively small files When the remote user opens a 50 MB Word document the word document opens instantly on the host computer and only the screen images are transmitted Likewise when the remote user saves the word document it is saved instantly on the host computer from the host computer s RAM 2 With virtual private networking the host computer is seen as a node on the network just like a traditional node on a network When a remote user opens a 50 megabyte Word Document from the host computer the entire 50 megabyte document must travel through the Internet connection to the remote computer and is loaded into the computer s RAM This means that opening a large Word document across a VPN connec
117. data that you want to present PivotDiagrams can take advantage of all of the power of Data Graphics that I ve been showing you in previous posts SO you Can create some graphically rich ways to show your data To create a PivotDiagram select the PivotDiagram template in the startup screen This triggers the Data Selector wizard that lets you choose which data source you want to connect to PivotDiagrams are always connected to external data PivotDiagrams can connect to Excel Access SQL Server SQL Server Analysis Services SharePoint lists and other OLE DB or ODBC data sources When you select your data source you end up with a single shape in your PivotDiagram that shows you the sum total of all of the rows in your data Choose the totals that you want to display and then choose how you want to break out your data into groups and subtotals To do this you use the Add Category control in the task pane Copyright April 2010 J Carlton Collins CPA all rights reserved 186 High Tech Communications www CarltonCollins com Click on one of the categories to break out the currently selected shape In this example I m breaking out the totals by the different types of calls Hardware Software etc 17 61 Calls SolyeRate 30 420 5 82 You can continue to break out subtotals for example in the screen shot below we have selected the Software shape and broken these totals out Software We can also add some Data
118. des in custom show 12 Indirect MIRC A 1 Supports Internal Supports Inte 2 Multiple Ship To A Multiple Ship 3 Purchase Order Cr n Purchase Ord Add gt gt 4 Automatic Inter Ce Post to G L Pr 17 Automatic Int 1099 Backup J Supports OFF 5 Distributes Freight Conclusion PowerPoint can help you develop organize and present information find that developing materials in PowerPoint can be five times faster than developing materials in my word processor Why Because PowerPoint invites you to develop your material using bullets lists charts and pictures whereas your word processor begs for complete paragraphs including introductory and conclusion sentences With a word processor you end up writing more reviewing more and then summarizing more in order to deliver your presentation PowerPoint also helps you organize your presentation Once the data is assembled you can reorganize slides by simply clicking and dragging them to a new position You can even lasso multiple slides and move them with one drag of the mouse This type of organization is much more difficult to accomplish in a word processing environment PowerPoint also helps you deliver a presentation because the slides act as your lecture notes These notes keep you on course Audience participants whose minds naturally drift away can use the slides to catch up to you in your presentation Presenters who have a natural fear of speaking in
119. ding a wireless access point and equipping the PCs and networked devices with wireless network adapters or WLAN cards Equipment needed for Home or Office Wi Fi network 1 Access Points Many companies offer wireless routers that perform all the functions of an access point and with the additional security of an integrated firewall NETGEAR Wireless N Router WNR2000 wireless In Stock 79 99 router N Router WNR2000 Wireless router 4 port switch Ethernet Fast Ethernet 802 11b 602 119 802 11n draft 2 0 external Add To Cart MFG WNRZO00 100NAS CDW a 1630558 See Alk Wireless Broadband Routers Linksys Wireless N Broadband Router with Storage In Stock 106 99 Link Wireless N Broadband Router with Storage Link MFG WRIIGONL CDW 1753092 See All Wireless Broadband Routers Add To Cart sco WRVS4400N Wireless N Gigabit Securi In Stock 224 99 al C Router VPN Secure high speed wireless network access for small business Gigabit Ethernet connections enable rapid transfer of large files Advanced security including Add To Cart intrusion prevention helps keep assets safe MFG WRVS4400N CDW 1028226 Copyright April 2010 J Carlton Collins CPA all rights reserved 206 High Tech Communications www CarltonCollins com D Link DIR 615 Wireless N Router In Stock 62 99 802 11n Wireless M Router i MFG DIR 615 CDW 1220620 See Alk Wireless Broadban
120. e am sorry but web shoppers like myself have come to expect lower prices via the Internet Webvan s troubles were related to growing too fast technical problems and a botched merger with Homer Grocer Webvan s CEO Robert Swan claimed that the Webvan model could have worked however the company simply ran out of start up capital They started with 1 2 billion Conclusion believe that the Internet offers the greatest opportunity our world has ever seen for both big companies and common people to launch new businesses The cost of establishing a web store is extremely small and due to the power of the web goods and services are instantly available to millions of prospective consumers These factors are the foundation which will fuel wide spread web commerce for years to come As high speed internet access becomes more prevalent web businesses will experience greater successes highly recommend that you read my related article believe in e commerce which is located here http www accountingsoftwareadvisor com ec ecommerce htm Copyright April 2010 J Carlton Collins CPA all rights reserved 132 High Tech Communications www CarltonCollins com Carlton s Multiple Web Site Strategy t is my belief that if your company offers 15 different services then you need to have 15 different web sites in order to make the right web impression and promote those services have never read this idea anywhere before or heard this idea
121. e even have a Skype computer setup in my dog room so can log in to check on my dogs say hello and make their Copyright April 2010 J Carlton Collins CPA all rights reserved 39 High Tech Communications www CarltonCollins com tails wag This same type of inexpensive solution might be used by companies to keep watch on their warehouses or workers from long distance or from just across the street Other Skype features allow conversations to be recorded and the chat translation tools allow users to text one another even if both parties speak different languages The Skype Mobile feature allows users to make nation wide or international calls from cellular phone with only Skype charges applied of about 1 8 cents per minute Skype extras offer even more functionality such as the following a The mcePhone extra allows your incoming Skype calls to pop up on your TV screen b The KishKish extra monitors the level stress level of the person you are talking with over Skype to detect when a person is lying c The Yugma Skype extra provides a conference room metaphor on users desktops and includes IM voice video a whiteboard and file sharing capabilities d The Skylook Extra integrates Outlook with Skype to send you alerts to your cell phone and to read important emails to you on your phone when you are away from your desk Today s Tech Savvy CPA would certainly embrace the opportunity to try out these exciting technologies t
122. e and both parties could see and hear one another Today video conferencing has become a reality with dozens of proven solutions available such as GoogleTalk GoToMeeting iChat Jajah ooVoo Vonage and Gizmo Each of these solutions has their own advantages however this article focuses on the most popular internet based phone call and video conferencing solution today Skype Today more than 100 million people use Skype to place internet based phone calls and video conference throughout the world with between 10 to 20 million active users at any time The basic Skype service is free and takes only 2 to 5 minutes to set up simply visit Skype com to download and install the application Next search for the Skype users you want to call this is Copyright April 2010 J Carlton Collins CPA all rights reserved 38 High Tech Communications www CarltonCollins com similar to searching for their name in a phone book and add them to your contact list Double click the user name to initiate the Internet phone call and the recipients computer will ring just like a telephone Once the person you are calling answers you can speak to one another using your computer s speakers and microphone If you both have web cameras you can see one another as well Skype allows you to speak to other Skype users around the world and each day tens of millions of people use this service See Cormac Comers Cal en Teoh Ha a Mary Low Collies HP ky C
123. e and call e No Pictures All items offered for sale should include a picture if not multiple pictures People like to touch and feel stuff before they buy but a web store does not offer this capability Pictures and movies offer the next best thing For example we ve all seen the Copyright April 2010 J Carlton Collins CPA all rights reserved 121 High Tech Communications www CarltonCollins com boom box stereo system promoted on television for just 9 95 It looks great on television but when it arrives at your door you discover that it is only 3 5 inches high Hey got one check it out Most people just want to know what they are ordering A picture helps tremendously Multiple pictures diagrams schematics blueprints dimensions and VRML s all help the shopper understand the item before they purchase e Weak Descriptions Web stores should provide detailed descriptions of each product You would think that this would be obvious but evidently it is not Some web sites do not even attempt to describe their products or provide a picture You have to wonder what they are thinking For an example check out this web page which compares the descriptions provided by two separate web stores for the same exact product Hey when there is no printing or publishing cost why not offer a longer description e No Prices Most importantly web stores should always provide pricing information When encounter a web store without prices
124. e become the preferred low cost and easy solutions In addition Microsoft Windows includes a remote solution as well There are more than 425 downloadable solutions located here http www download com Remote Access 3150 7240 4 0 html however the main solutions are as follows Some Low Cost Remote Access Solutions Some High End Remote Access Solutions GoToMyPC CITRIX Log e l Mec iy Windows s webex ea Array pcAnywh ere Access Security Performance 4 Remote Desktop Connection motepc a i beinsync Copyright April 2010 J Carlton Collins CPA all rights reserved 52 High Tech Communications www CarltonCollins com Benefits of Using Remote Access There are numerous situations that call for a remote access solution Traveling employees often need access to their e mail calendar or contact list Traveling sales representatives need access or to the accounting system for entering orders of looking up inventory levels and customer history information Work at home employees need access to their office computer Multiple location companies need to connect remote locations to a centralized accounting system Troubleshooting support professionals need to log into the customer s remote system for maintenance purposes Presented below are specific examples of how you might use a remote access solution in your organization Customer 1 See or conduct live product demonstrations on any machine that has an internet co
125. e having a similar impact as those companies that conduct numerous small and inexpensive meetings daily are leaner and meaner than those older traditional companies that rely on expensive travel intensive long lasting meetings that occur only periodically Some of the highlights of Live Meeting are as follows Meet with colleagues customers and suppliers no matter where you are Meet with just one person or as many as two thousand people at the same time You can edit files together such as a Word document or excel worksheet You can collaborate on a whiteboard drawing a diagram or laying out a critical path chart and the whiteboard image can be captured saved and shared with others 5 The entire Live Meeting event can be recorded and archived or shred with others Record your presentation as easily as clicking the mouse without any special equipment required It is easy for people who missed the meeting or class to view recordings on demand using Microsoft Windows Media Player or by downloading the recording for viewing at their convenience You can leverage your presentation many times with full quality recordings 6 Secure Sockets Layer encryption means that your meetings are absolutely secure from prying eyes 7 Live meeting is integrated with Outlook to make scheduling as simple as sending an e mail 8 Live Meeting leverage the full capabilities of Microsoft Office PowerPoint presentations with high resolution support f
126. e is already in place and additional web impressions are only a matter of a little sweat Read on as a develop my point further with another example Tower Records We all know about Tower Records but when visit this web site wonder why they only have one web site Why don t they have fifty web sites For example the company could maintain web sites specifically dedicated to country music rock and roll classical music big band punk rock and Christian music The Christian music web site for example might be adorned with pictures on angels harps and the pearly white gates of heaven along with a quick reference to the top 50 Christian music songs Thereafter Tower Records could market this particular web site to the church community Similarly the country music web site might display cowboy boots and guitars and be marketed towards the country music crowd In each case the massive database and engine that has already been developed and published by Tower Records is the Same database and engine that drives these additional web pages In this manner Tower Records need not re create the wheel from scratch they need only create new home pages that link to the database and engine that is already in place A key point is that the effort needed to create a second third and forth web impression requires only a small fraction of the effort involved in creating the original web site The Cost of Creating Multiple Web Sites The cost of this add
127. e not smiling Deep breaths Attentive Body Language Showing Real Interest q Good eye contact Eyes wide open Leaning forward Smiling or slight smile Good posture Eyebrows lifted Nodding in agreement Copyright April 2010 J Carlton Collins CPA all rights reserved 28 High Tech Communications www CarltonCollins com Bored Body Language Just Not Being Interested Leaning back Arms folded Sleepy eyes Propping up head Yawning Not smiling Slouching Doodling Sitting back too comfortable Frozen stiff Closed Body Language Many Reasons Are Closed i 4 f i a i m 4 f ra a Arms folded No smile Defensive hand gestures Non accommodating eyes Legs crossed at the knees Deceptive Body Language Seeking To Cover Up Lying Or Other Deception Avoiding eye contact Hiding one s face Speaking through one s hand Looking up or looking away Wringing hands Biting or sucking on lips Defensive Body Language Protecting Self From Attack Covering Up Frowning Pursing lips Looking away Withdrawing Furrowed brow Distant stare Copyright April 2010 J Carlton Collins CPA all rights reserved 29 High Tech Communications www CarltonCollins com Dominant Body Language Dominating Others Fist Pounding Finger shaking Blocking Finger pointing Leaning in Yelling Being louder than necessary Interupting Emotional Body Language Identifying Feelings y lt ae
128. e to use the U S Mail or set up a fleet of couriers to deliver our magazines Or maybe we needed to develop a distribution channel into stores across America Whatever method we used to distribute our magazine it would have been costly probably 50 cents per magazine at best But wait we re not making any money We need subscribers We invest 100 000 to launch a marketing campaign aimed at attracting paying readers Unfortunately there is little demand for our efforts and our business never takes off We lose a quarter of a million dollars in just a few months time not to mention a lot of lost work Now fast forward to today You and could develop and write our first issue of The Trout Fisherman and post it to a web site in a matter of days Our web site cost would probably be just 10 per month We submit our web site to the some of the popular search engines and people around the world start finding our web site They find that it is well written and full of good content They bookmark our web site and keep coming back Within a few months we have an impressive list of readers OK ok We haven t made any money off our web site but we haven t lost any either This is the key point Now we shift gears and start selling fishing gear on line Our web orders are automatically forwarded to another company who handles fulfillment and we pocket a small profit on each sale We start selling maps to well stocked fishing holes on line the reader
129. eady to go The whole process takes me about 5 minutes People are always impressed by this quick example using their own web page Content It is important to note that any web site needs extraordinarily good content or else all other efforts are for naught This whole idea does not work unless each and every web site you create is dedicated to delivery a bevy of relevant well written content which is useful to the prospective customer you are trying to attract Please keep this in mind Conclusion think that the idea that a company should have one and only one web site is very short sighted Many companies target different markets via other more expensive efforts such as print ads television commercials trade journals etc Why not do the same on the Internet where the incremental cost of doing so is minimal Mark my words this concept will become Standard operating procedure with five years but always remember that you read it here first Copyright April 2010 J Carlton Collins CPA all rights reserved 135 High Tech Communications www CarltonCollins com Buying on the Web Remember our focus today is communicating your products and services t your customers So at first glance the topic Buying on the Web might not seem to fit However think it does think that it is useful to view your efforts to communicate from the customer s perspective Do Most of My Shopping on the Web To start with for the past 15 yea
130. eb Page PowerPoint slide shows can be published to the web instantly using the built in web publishing wizard This option allows you to make your PowerPoint slide show instantly available to your meeting group as well as the rest of the world A key benefit of this approach is that your complete slide show including animations and sound will automatically work on the published web site Publish as Web Page Publish what f Complete presentation Slide number through 3 E W Display speaker notes Web Options Browser support f Microsoft Internet Explorer 4 0 or later high Fidelity C Microsoft Internet Explorer 3 0 Netscape Navigator 3 0 or later All browsers listed above creates larger Files Publish a copy as Page tithe PowerPoint Presentation Change File name C Documents and Settings Carlton Collins My Documents Browse Open published Web page in browser Cancel Packaged for CD The Packaged for CD wizard will package your PowerPoint presentation to run on another computer including linked files animations TrueType fonts etc You can also choose to include the Microsoft PowerPoint Viewer which will allow the Packaged for CD file to run on a computer that doesn t have Microsoft PowerPoint installed Package for CD Copy presentations to a CD that will play on computers running Microsoft Windows 98 Second Edition or later even without PowerPoint Name the CD Files
131. ed on the 3GPP LTE Long Term Evolution cellular standard offering peak bit rates of 326 4 Mbit s It may perhaps also be based on WiMax or Flash OFDM wireless metropolitan area network technologies that promise broadband wireless access with speeds that reaches 233 Mbit s for mobile users In 2011 it is expected that more wireless companies will launch 4G Broadband networks Copyright April 2010 J Carlton Collins CPA all rights reserved 150 High Tech Communications www CarltonCollins com Mobile phone subscribers per 100 inhabitants 1997 2007 Developed Developing Mobile phone subscribers per 100 inhabitants 1997 2007 Text Messaging The most commonly used data application on mobile phones is SMS text messaging 74 of all mobile phone users Other Non SMS Data Services Led by mobile music downloadable logos and pictures gaming gambling adult entertainment and advertising source Informa 2007 Standardization Of Micro Usb Connector For Charging Starting in 2010 many mobile phone manufacturers have agreed to use the Micro USB connector for charging their phones The mobile phone manufacturers who have agreed to this standard include Apple LG Motorola Nokia Research In Motion Samsung Sony Ericsson the new chargers are up to three times more energy efficient NOUR WNE Copyright April 2010 J Carlton Collins CPA all rights reserved 151 High Tech Communications www CarltonCollins co
132. ely and effectively in ways that text and numbers cannot Visio 2010 also automates data visualization by synchronizing directly with data sources to provide up to date diagrams and it can be customized to meet the needs of your organization The Visio product is used to create business and technical diagrams to think through organize and better understand complex ideas processes and systems Product features include eS gi The ability to assemble diagrams by dragging predefined Microsoft SmartShapes symbols Tools designed for specific professional disciplines Generate diagrams from existing data Task specific templates are updated regularly from the Web Track reviewers comments and changes to shapes and digital ink using the new review mode Publish diagrams with Save as Web Page functionality Import and export diagrams in Scalable Vector Graphics SVG format a new Extensible Markup Language XML standard for Web graphics Integrate business processes and systems by extracting data from your Visio diagrams and importing it to Access Excel Word 2003 SQL Server XML and other formats Convert a Microsoft Outlook calendar to a Visio calendar that can be formatted and shared with others Following are some documents that were created using Visio wf R cepteur Visio conf rence multipoint i avec pont MCU H323 INTERNET Emetteur R cepteur 4 Copyright April 2010 J Carlton Collins CPA all
133. employees customers or vendors before doing business with them Do you also check police mug shots or sex offender pages as a precaution before doing business with someone Do you check out traffic cameras on the web before heading out of your home or office to find out if the streets are open Do you print out turn by turn driving directions and maps from the Internet to help you find your way to a new location Social amp Business Networking Do you use social networking sites such as linked in Plaxo MySpace FaceBook Twitter etc to help build and maintain your professional and personal relationships Accounting System Do you have remote access set up so remote employees working from home from satellite locations or from the road can log in and access the system Does your accounting system provide web portals so company executives and employees can keep track of the accounting data easily via web based dashboards and summary reports Do your traveling sales representatives log in during the evening and enter sales orders from the road so they can begin being processed the very next morning Do you have an automated e commerce solution which automatically orders and replenishes inventory as needed without or with little human intervention Do you have a web store online which describes your products and pricing and allows readers to order those products and services on a real time basis Does your accounting system au
134. eople use Linkedin to get to someone in order to make a sale form a partnership or get a job It works well for this because it is an online network of more than 60 million experienced professionals from around the world representing 170 industries Copyright April 2010 J Carlton Collins CPA all rights reserved 75 High Tech Communications www CarltonCollins com 1 Increase Your Visibility By adding connections you increase the likelihood that people will see your profile first when they re searching for someone to hire or do business with 2 Improve Your Connectability Most new users put only their current company in their profile By doing so they severely limit their ability to connect with people You should fill out your profile like it s an executive bio so include past companies education affiliations and activities You can also include a link to your profile as part of an email signature The added benefit is that the link enables people to see all your credentials which would be awkward if not downright strange as an attachment 3 Improve Your Google Page Rank LinkedIn allows you to make your profile information available for search engines to index Since LinkedIn profiles receive a fairly high PageRank in Google this is a good way to influence what people see when they search for you To do this create a public profile and select Full View Also instead of using the default URL customize your public
135. er 8 0 for Windows as its speech profile engine start Speech Recognition Start using your voice to control your computer Set up microphone Set up your computer to work properly with Speech Recognition Take Speech Tutorial Train your computer te better understand you Read text to your computer to improve your computer s ability to understand your voice Doing this isn t necessary but can help improve dictation accuracy Open the Speech Reference Card View and print a list of common commands to keep with you so you always know what to say To use Speech Recognition the first thing you need to do is set it up on your computer To learn how to do that see Set up Speech Recognition When you re ready to use Speech Recognition you need to speak in simple short commands The tables below include some of the more commonly used commands Copyright April 2010 J Carlton Collins CPA all rights reserved 216 High Tech Communications www CarltonCollins com Microsoft Narrator Windows 7 Sk Microsoft Narrator File Preferences Help Narrator will read aloud what is on screen as you navigate using the keyboard Main Narrator Settings W Echo User s Keystrokes W Announce System Messages E Announce Scroll Notifications Start Narrator Minimized Control whether Narrator starts when log on Quick Help Voice Settings Ex Narrator is a light duty screen reader utility included in Microsoft Windows
136. er in next page Wireless iP Config amp NAT Setting amp Internet Firewall ff Basic Co nfig Enable Web Access from WAN E WAN amp LAN Filte E URL Filter SEETI Respond LPR Request from WAN es m Setup Status amp Log Respond Ping Request from WAN Enable Firewall Logged packets type Port of Web Access from WAN Logout 9 Position the Router or Access Point Safely Wi Fi signals normally reach beyond the walls of a home or small office A small amount of signal leakage outdoors is not a problem but the further this signal reaches the easier it is for others to detect and exploit Wi Fi signals often reach through neighboring homes and into streets for example When installing a wireless home network the position of the access point or router determines its reach Try to position these devices near the center of the home rather than near windows to minimize leakage 10 Turn Off the Network During Extended Periods of Non Use The ultimate in wireless security measures shutting down your network will most certainly prevent outside hackers from breaking in While D impractical to turn off and on the devices frequently at least consider doing so during travel or extended periods offline Computer disk drives have been known to suffer from power cycle wear and tear but this is a secondary concern for broadband modems and routers If you own a wireless router but are only using it wired Ethernet connect
137. ers for Cooperative Ministries food drive Selected Positions Awards amp Accomplishments 1 2008 and 2009 Chairman of the Southeast Accounting Show the south s largest CPA event 2 Recipient of the 2008 Tom Radcliff Outstanding Discussion Leader Award 3 Named Top Ten CPA Technologists by Accounting Technologies Magazine Named Top 100 Most Influential CPAs by Accounting Technologies Magazine in multiple years 4 Has personally delivered over 1 500 technology lectures around the world 5 Has published 80 pages of accounting software articles in the Journal of Accountancy 6 Recipient of the AICPA Lifetime Technical Contribution to the CPA Profession Award 7 Recipient of the Outstanding Discussion Leader Award from the Georgia Society of CPAs 8 Lead author for PPC s Guide to Installing Microcomputer Accounting Systems 9 Has installed accounting systems for more than 200 companies 10 Past Chairperson of the AICPA Technology Conference 11 Has delivered keynote and session lectures at dozens of accounting software conferences including seven Microsoft Partner Conferences five Sage Conferences and multiple conferences for Epicor Open Systems Exact Software Sage ACCPAC ERP Dynamics NAV Dynamics AX SouthWare Axapta 12 Has provided consulting services to many computer companies including Compaq IBM Microsoft Apple Novell Peachtree Epicor Sage Software Exact ACCPAC Intuit Peachtree Great Plain
138. eserved 23 High Tech Communications www CarltonCollins com Why Discuss Non Verbal Communications OK realize this book course is based on high tech communications however because 94 of all communications is non verbal and 50 based on body language alone we ought to address this topic Additionally some high tech methods of communication such as video conferencing will convey your body language therefore a brief study of non verbal ques and signals is entirely appropriate to help you communicate most effectively Specifically have several key points that would like to make in this chapter as follows 1 Most high tech communications don t convey the non verbal signs and signals that are often very important to some people in evaluating sincerity and gaining their trust You should be aware of this flaw and perhaps take steps to compensate for this 2 Some people don t make that good of an impression initially for a variety of reasons be it nervousness a weak voice insecurities physical appearance etc For these people high tech communications could be a good equalizer that allows them to establish important business relationships 3 The high tech communication methods discussed in this manual are not intended to completely eliminate personal interaction eventually you will probably meet the people you communicate with face to face Personal Appearance According to experts your personal appearance communicate
139. esign Supports Multiple Browsers Often a web site that looks perfect in one browser will be completely unacceptable in another browser The site should be tested and viewable with a variety of browsers Copyright April 2010 J Carlton Collins CPA all rights reserved 128 High Tech Communications www CarltonCollins com 12 Convey the Correct Image The web site should include graphics design and colors are in synch with the corporate image For example a church s web site should not have scantily dressed models or pictures of people behaving irresponsibly 13 Consistency The site has consistent imagery and content from page to page Web Development Tips 1 Test Your Web Site on Multiple Browsers Test your pages on multiple platforms before you release them to the world What may look wonderful on the Internet Explorer or Netscape browser may look horrible on an Safari Google Chrome AOL Macintosh or UNIX NCSA Xmosaic browser Your server logs are a gold mine of information For example you can see the percentage of users that are loading the pages but not the images in the pages You can also see which pages have never or rarely been accessed Check Your Own Page Regularly Don t wait for people to tell you that there are problems Most people who find a problem with your web site go away without saying a thing Don t Use Long Titles Remember that the title goes into the hotlist where display space is l
140. esults Public Search Results 9 Prevent Photo Video Tag Mistakes Caption I decided to grow a beard while my wife is away to my surprise it s coming in grey In this photo Me remove This is the album cover Move to Save Changes Cancel Reportedly this is a frequent Facebook problem you let loose for a few hours one night at the company party and photos or videos of the moment are suddenly posted for all to view not just your close friends who shared the moment with you but potentially the entire world can see them In some cases the results can be devastating It has been well documented that some Facebook users have been fired from work after incriminating photos videos were posted Copyright April 2010 J Carlton Collins CPA all rights reserved 70 High Tech Communications www CarltonCollins com for the boss to see For others randomly tagged photos videos have ended relationships At the least a tagged photo video can result in personal embarrassment To avoid this potential problem you can prevent tagged photos or videos from showing up in all of your friends news feeds by selecting Account Privacy Settings Profile Information Photos and Videos of Me and select Customize to limit your photos to specific Friends or specific Lists of Friends Early in 2010 Facebook provided the option to select Only Me and None of My Networks but this privacy option
141. etwork s DHCP pool To be more secure you may want to turn off DHCP on the router set a fixed IP address range instead then configure each connected device to match Use a private IP address range like 12 12 12 x to prevent computers from being directly reached from the Internet The specific procedures to follow will vary on the devices you are using therefore you should refer to the user manual or web for detailed instructions for each device you have on your network Copyright April 2010 J Carlton Collins CPA all rights reserved 213 High Tech Communications www CarltonCollins com 8 Enable Firewalls On Each Computer and the Router Wireless routers contain built in firewall capability but the option also exists to disable them Ensure that your router s firewall is turned on For extra protection consider installing and running personal firewall software on each computer connected to the router To do this simply log into your wireless router device navigate to the Firewall menu and click the Enable button as shown below 44 WL500g Deluxe Microsoft Internet Explorer oj x File Edit Yiew Favorites Tools Help Ftd G O HaGIP gt P zeel wd Address http 192 168 1 1 EJ oo Links ASUS WL500g Deluxe SDU Mi Home Enabling Firewall SPI Firewall will provide basic protection for WL500g Deluxe and devices Mi Quick Setup it If you want to filter out specified packets please use WAN vs LAN filt
142. fessional upbeat friendly and inviting Leave Detailed Voice Mails In the event that you do reach voice mail go ahead and leave a detailed message so as not to waste your time or your parties time One of my pet peeves are people who leave messages that just say call me After playing phone tag for numerous missed calls on both sides you finally reach them only to find out that they had a simple question that you could have easily answered if they had left a detailed message in the first place Scheduling Phone Calls I ve had people spend more time and effort calling me to schedule a call than the call actually took Tchotchkes Tchotchkes are inexpensive promotional products that typically have your company name and contact information stamped on These types of promotional products typically show that a company is generous and big enough to absorb the cost of a few trinkets It makes the recipient feel a little more comfortable that they are dealing with an established company Everything a prospects sees hears and reads about your firm creates an image in their mind Make sure the impressions you create are consistent with the images you want to convey In addition to attracting new clients your marketing program should be designed to convey refine and polish your firm s image so you always always make a positive first impression Copyright April 2010 J Carlton Collins CPA all rights reserved 36 Hi
143. ffett Invitation to connect take action P CIPP 2 William Bill Morris RE Bill Morris is asking for Help take action E Senior Technical Manager at AICPA iestntnnnnenennnnnnnnnnenenenanieieitnnninininnenentntninnnnaneinntnnnnnnianeinnananaieenentnnaeeinananeenennnit eee Kirk Alexander Golf Weekend of Microsoft Convergence 2010 take action v Action items Invitations 12 Q amp A 4 See all messages Network Activity pi Step up Chrome fast Share ideas articles quotes and more F O Share UPDATES Rick Telberg CFO Link Turning accountants into the new breed of CFOs The browser by Google 1 Submitted by Adrienne Gonzalez republished from Goi http bit ly ax610d Acz via Twitter 11 minutes ago Comment Reply privately Rick Telberg CPA link IRS Reduces Audits of Large Corporations The amon peas Service s audits of the nation s large http bit ly 9F5CU5 w ey So Y 38 minutes ago Comment Reply privately Your profile has been viewed by 8 people in the last 30 days In the last 15 days you have appeared in search Rick Telberg CPA link IRS to Step up Audits of Sole Proprietors The Internal results 10 times Revenue Service plans to check for unfiled ta http bit_ly arBOLV w See more via Twitter 38 minutes ago Comment Reply privately Reading List by Amazon x More updates m a a PEPE Internet Protected Mode On fa v 100 v 10 Ways to Use LinkedIn Most p
144. gh Tech Communications www CarltonCollins com Voice Over IP amp Video Conferencing Chapter 6 Copyright April 2010 J Carlton Collins CPA all rights reserved 37 High Tech Communications www CarltonCollins com Internet based Phone Calls amp Video Conferencing Technology continues to change the way we communicate Many new technologies devices and software applications have emerged to improve the way we communicate Two such technologies are Internet based phone calls and video conferencing Using these technologies many businesses are communicating with greater efficiency and better results Are you keeping up Is there more that you could do to better communicate with your customers prospects employees business partners executive team and board of directors This article focuses on this new age of communicating and offers suggestions for embracing these new technologies and avoiding the pitfalls they offer lectronic mail hit the scenes in the early nineties and dramatically changed the way we communicate Today new technologies continue to emerge ushering in a new era of dramatic changes in the way we communicate Consider internet based phone calls also known as voice over IP and video conferencing The first video conferencing solution was deployed in 1936 by the Germans but this concept became well known in 1962 via the futuristic cartoon The Jetsons In this cartoon people used television screens to communicat
145. ght April 2010 J Carlton Collins CPA all rights reserved 168 High Tech Communications www CarltonCollins com a L A i E LG TTA LE x J m r Web Conferencing Chapter 19 Copyright April 2010 J Carlton Collins CPA all rights reserved 169 How Web Conferencing Differs from Video Conferencing We have already discussed video conferencing earlier in this manual and web conferencing is a little different in that you are constantly communicating with large groups of people and often different people such as prospective customers Therefore there is a class of products that cater specifically to this market A few facts about web conferencing are presented below 1 Types Web conferencing is typically used in three ways as follows a Live meetings b Training c Presentations via the Internet called webinars 2 Client Software Needed In a web conference each participant sits at his or her own computer and is connected to other participants via the internet via a downloaded application on each of the attendees computers or a web based application where the attendees access the meeting by clicking on a link distributed by e mail meeting invitation to enter the conference 3 Webinar A webinar is a specific type of web conference It is typically one way from the speaker to the audience with limited audience interaction 4 Webcast A recorded webinar which is later played back is often referred to as
146. hen communicating You might want to add hand gesture notations to your speech notes You should avoid using the same hand gesture over and over You shouldn t animate or mime your entire speech You should refrain from copying others the best gestures are unique to you New gestures feel strange to your body Practice them until they are comfortable One handed gestures are often more effective than two handed gestures Avoid finger and fist gestures that may be insulting to other cultures Gestures are a physical activity you cannot learn to do them by reading Use a mirror to verify that your gestures reinforce your message oe ot ee a ee Mudras The earliest bronze statues in India were cast in the Indus Valley about 2300 BC reaching an artistic peak during south India s Chola Dynasty c 9th to 13th centuries AD Known as mudras the hand positions of each statute has a different meaning as follows Copyright April 2010 J Carlton Collins CPA all rights reserved 26 High Tech Communications www CarltonCollins com 9 Understanding body language can be critical There is more to body language than movement Behavioral studies indicate that individuals establish a personal space circumference which may change depending on the type of message they are sending and their goal Body Language There are four parts to tactical body language facial expression gestures stance and personal space Unfortunately it is
147. hone bill and learn about services Verizon and Sprint have similar units for their customers 9 Kodak Photo Kiosk Kodak provides an interactive kiosk which allows users to print pictures from their digital images Kodak has over 100 000 units up and running in the U S Two major classes of photo kiosks exist a Digital Order Stations In retail locations this kiosk allows users to place orders for prints and photographic products Copyright April 2010 J Carlton Collins CPA all rights reserved 84 High Tech Communications www CarltonCollins com b Instant Print Stations This kiosk uses internal printers to instantly create photographic prints for a self serve paying customer Some systems will only print 4x6 inch prints while other systems allow for 4x6 5x7 8x10 8x12 J 4 eo aa h A Kodak quality k V S printsin seconds INS i OletsGopiacita 10 Internet Kiosk An Internet kiosk is a terminal that provides public Internet access Internet kiosks are typically placed in settings such as hotel lobbies long term care facilities medical waiting rooms apartment complex offices or airports for fast access to e mail or web pages Some Internet kiosks are based on a payment model similar to vending machines or Internet caf s while others are free A common arrangement with pay for use kiosks has the owner of the Internet kiosk enter into a partnership with the owner of its location paying eithe
148. house when traveling You may not want to do this i For a fee Skype can receive your calls and automatically forward them to your telephone or cell phone j Fora fee Skype also offers voice mail 4 Make your First Video Call Access the Contacts Page and double click a contact to make a computer to computer phone call Copyright April 2010 J Carlton Collins CPA all rights reserved 49 High Tech Communications gt Mary Low Callies HP Cy Cartan Collies Afama A Save Copyright April 2010 J Carlton Collins CPA all rights reserved www CarltonCollins com 50 High Tech Communications www CarltonCollins com Remote Desktop Control Chapter 7 Copyright April 2010 J Carlton Collins CPA all rights reserved 51 High Tech Communications www CarltonCollins com Remote Desktop Control aes a m a Introduction to Remote Access emote access becomes important when you travel away from your computer or when two or more separated people need to share the same data For more than 15 years Citrix MetaFrame was the defacto standard for establishing high performance remote access while pcAnywhere was the defacto low cost solution In recent years new solutions have risen to challenge both of these solutions In particular Microsoft Terminal Services is arguably as good as Citrix and priced far lower 30 to 40 lower In addition web based solutions such as GotoMyPC and LogMeln hav
149. hutdown of Skype in its current form September 1 2009 eBay announces sale of 65 of Skype to a consortium comprised of Index Ventures and Silver Lake Partners Using Skype Copyright April 2010 J Carlton Collins CPA all rights reserved 47 High Tech Communications www CarltonCollins com 1 Download Download and setup is free and takes about a minute You will want to install Skype on every computer that you want to communicate with from The download page is here http www skype com download skype windows downloadin 2 Find Contacts Next search for your contacts using the Contacts Search for Skype Users menu option as shown in the screen below Sype Skype carlton collins atlanta ga Skype Contacts Conversation Call View Tools Help G v Carlton Collins Atlanta GA Hello to my Skype friends B Skype Search for people on Skype a q2 Search for people on Skype i New Se ta s Contacts Conversations Looking to meet new people Looking for someone in particular Search the Skype Directory If you know their Skype Name full name or email address enter it here or leave this box blank Echo Sound Test Service Alan Akers frit Mare Velde ic Fred Austin Collins You can also add MySpaceIM contacts Enter their MySpaceIM name and click Find carlton Collin i Female Collins Country Region All countries regions X Gender gt Male Carlton Collins i State Do not specify Carlton Collins
150. ible for each edit no more dickering over credit Where real time interaction isn t a necessity building a wiki over a long period of time can be far more productive than a chain of meetings but make sure to assign responsibilities and allow time for wiki work Email Lists Groups nother solution where real time interaction is not a factor is the old fashioned email list Somewhat out of fashion these days email lists can still be quite productive ways to get things done as a group and both Yahoo and Google offer services that are free and easy to set up An effective email list should probably have a moderator not to approve messages but to remind people when they re going off track Good etiquette is essential in this environment something about the medium encourages flame wars But with a few precautions email lists can still be quite effective tools allowing for thoughtful considered exchanges and automatically maintaining a searchable archive of past discussions Copyright April 2010 J Carlton Collins CPA all rights reserved 104 High Tech Communications www CarltonCollins com Collaboration Apps inally effective use of a project management application can forestall the need for most meetings Systems like Wrike and Basecamp allow notes to be exchanged tasks to be assigned and files to be shared They also offer a number of ways for users to interact SMS email online RSS or using a third party appl
151. ically delivered and tabulated The results can be compiled in a variety of data formats including Excel CSV comma separated value text or database formats Many organizations that have adopted paperless forms have reaped many benefits For example in 2008 the Georgia Society of CPAs GSCPA replaced their old paper based CPE course evaluation forms with electronic evaluations Instead of completing paper based evaluation forms at the end of each course attendees receive an e mail containing an electronic evaluation form As attendees complete the forms and click the submit button the evaluation results are instantly compiled in a database which automatically tabulates the results This new process eliminates the labor intensive tasks of producing distributing completing collecting reentering reporting and storing data using paper forms The Society simply logs into the database to view the evaluation summary reports as needed According to Paige Brooks of the GSCPA the transition to electronic forms has definitely been worth the money She further explains that in addition to reducing the amount of processing time full reports are available instantly whereas the older method sometimes did not produce results until months after the event Many software application shave added paperless data collection capabilities as well For example in 2007 Intuit launched new web based electronic timesheet functionality called QuickBooks Ti
152. ication through Basecamp s API If full fledged project management is too much consider using online services like Google Docs which can be installed to your own domain via Google Apps alongside Google Talk or another IM you can share documents add to and edit each others work and create a repository of materials at the same time Copyright April 2010 J Carlton Collins CPA all rights reserved 105 High Tech Communications www CarltonCollins com Communications Equipment Chapter 13 Copyright April 2010 J Carlton Collins CPA all rights reserved 106 High Tech Communications www CarltonCollins com Projection Systems Pricegrabber search for video projectors with a contrast ratio of 1 000 1 or better yields over 30 results from several well known manufacturers of computers and consumer electronics oo 5m Yese jo Neo ie o Tohba Mitshibishi Pocket Projector 699 Prices range from just under 500 to well over 6 000 a stark contrast for two devices that simply take a video signal and use light to shine it on a wall right Well yes and no There can be a tremendous difference in price from unit to unit however no current model operates so simply as to just shine light on a wall and you pay for every extra built in feature and convenience Video Projection Vs Film Projection The video projector is similar to a film or slide projector in that they both accept a source and project the image from that
153. ice guided navigation The iPhone 3GS can orient the map with its digital compass YouTube Apple has also developed a separate application to view YouTube videos on the iPhone which streams videos after encoding them using the H 264 codec Simple weather and stock quotes applications also tap in to the Internet Google Searches iPhone users can and do access the Internet frequently and in a variety of places According to Google the iPhone generates 50 times more search requests than any other mobile handset Nielsen found that 98 of iPhone users use data services and 88 use the internet Text Input The iPhone has automatic spell checking and correction predictive word capabilities and a dynamic dictionary that learns new words The keyboard can predict what word the user is typing and complete it and correct for the accidental pressing of keys near the Copyright April 2010 J Carlton Collins CPA all rights reserved 160 High Tech Communications www CarltonCollins com presumed desired key The keys are somewhat larger and spaced farther apart when in landscape mode which is supported by only a limited number of applications E Mail And Text Messages The iPhone features an e mail program that supports HTML e mail which enables the user to embed photos in an e mail message PDF Word Excel and Powerpoint attachments to mail messages can be viewed on the phone Apple s MobileMe platform offers push email which emulates the
154. ies Apple claims that the 3GS iPhone battery can last for up to ten hours of video nine hours of web browsing on Wi Fi or five on 3G twelve hours of 2G talk time or five on 3G 30 hours of music or 300 hours of standby Copyright April 2010 J Carlton Collins CPA all rights reserved 158 High Tech Communications www CarltonCollins com Battery Criticism The battery life of the iPhone has been criticized by several technology journalists as insufficient and less than Apple s claims This is also reflected by a J D Power and Associates customer satisfaction survey which gave the battery aspects of the iPhone 3G its lowest rating of 2 out of 5 stars Battery Warranty If the battery malfunctions or dies prematurely the phone can be returned to Apple and replaced for free while still under warranty The warranty lasts one year from purchase and can be extended to two years with AppleCare Battery Replacement Kit Since July 2007 third party battery replacement kits have been available at a much lower price than Apple s own battery replacement program These kits often include a small screwdriver and an instruction leaflet but as with many newer iPod models the battery in the original iPhone has been soldered in Therefore a soldering iron is required to install the new battery The iPhone 3G uses a different battery fitted with a connector that is easier to replace although replacement by any besides Apple still voids the warranty
155. ight April 2010 J Carlton Collins CPA all rights reserved 172 High Tech Communications www CarltonCollins com The four screens below show how you use GoToMeeting start your meeting Invite others to attend demonstrate and collaborate while your attendees see your screen or document Instantly start a meeting by clicking Meet Now Show your whole screen an application or just a specific document You can invite others via phone email or instant message vse beete ais Cine ttu 6 amaton Mode Use Telephone Aua OUse Mic amp Speakers Each person can choose to use their computer s mic and speakers or call in You can give attendees keyboard control or change whose screen is presented As the meeting organizer you can share either your whole screen or choose to just show a specific application You can record your meeting sessions including all phone and microphone audio for future review and reuse You can interact on the screen using the pen highlighter arrow and spotlight tools Specific tools you have include the following Audio conferencing via phone and computer Full desktop sharing Specific application sharing Recording Invite others on the fly Instantly change presenters Transfer keyboard and mouse control Drawing tools Multiple monitor support 10 Mac and PC support 11 Chat OMONHAOAWNE Copyright April 2010 J Carlton Collins CPA all rights reserved
156. imited Link Your Images Always use at least some text and make sure that images have links It can be frustrating to encounter a home page that is a series of images without a single word on the entire page One Topic Per Page Don t go overboard and put everything on one page your reader still has to download your document over the Internet It is better to have several smaller pages Try to present one topic per page However if you have a large number of topics maintaining and linking them can be a daunting task Consider combining smaller related topics onto a single page instead Avoid Extremely Large Images make sure you compress extremely large images so they will display fast Copyright April 2010 J Carlton Collins CPA all rights reserved 129 High Tech Communications www CarltonCollins com Selling on the Web ake a deep breadth Do you smell that That smell my friend is the smell of opportunity Today the Internet offers more opportunity than any other time in our history including the Industrial Revolution Why do think so Consider The Internet now enables virtually anybody to start a new business with virtually no overhead costs For example suppose you and had wanted to launch a new magazine business back in 1990 The Trout Fisherman We would have developed and written our first issue and printed 50 000 copies for a cost of 90 000 Then we needed to somehow distribute that magazine Our options ar
157. in the machine s housing record reflections of infrared light from objects and human fingertips on the surface 10 Surface has been optimized to respond to 52 touches at a time 11 Mark Bolger is the Surface Computing group s marketing director 12 A commercial Microsoft Surface unit is priced at 12 500 for the unit only whereas a developer Microsoft Surface unit costs 15 000 Microsoft said it expects prices to drop enough to make consumer versions feasible in 2010 13 A similar concept was used in the 2002 science fiction movie Minority Report As noted in the DVD commentary the director Steven Spielberg stated the concept of the device came from consultation with Microsoft during the making of the movie 14 A unique feature that comes preinstalled with Surface is the pond effect Attract application a picture of water with leaves and rocks within it and by touching the screen you can create ripples in the water just like you were putting your hand into a real stream Additionally the pressure of touch alters the size of the ripple created and objects placed into the water create a barrier that ripples bounce off just as they would in real life a a Copyright April 2010 J Carlton Collins CPA all rights reserved 88 High Tech Communications www CarltonCollins com XK iN Survey Solutions Chapter 10 Copyright April 2010 J Carlton Collins CPA all rights reserved 89 High Tech Communications www Carlton
158. individual decision or group decision 8 Expressing Emotions Ideas Communication helps people express their ideas and emotions to share thoughts with one another 9 Entertainment Movies music television shows theater or even anecdotes narrated by people are types of communication which are a source of entertainment for us Copyright April 2010 J Carlton Collins CPA all rights reserved 14 High Tech Communications www CarltonCollins com How We Learn Chapter 3 Copyright April 2010 J Carlton Collins CPA all rights reserved 15 High Tech Communications How We Learn 7 Verbal words only 38 Verbal voice tone inflection sounds 55 Non Verbal Source Albert Mehrabian 1 Through Taste 1 5 Through Touch 3 5 Through Smell 11 Through Hearing 83 Through Sight Source Bob Pike How We Remember 10 From what we read 20 From what we hear 30 From what we see 30 From what we see and hear 80 From what we say 90 From what we say as we act Source Bob Pike Copyright April 2010 J Carlton Collins CPA all rights reserved www CarltonCollins com 16 High Tech Communications www CarltonCollins com Effectiveness of Teaching Activities Firsthand Experience 21 Guided Practice 19 Structured Role Playing 18 Microteaching 18 Analyzing Calculating 16 Testing 16 Video Taping 16 Spontaneous Role Playing 16 Interviewing 15 Problem Solving 15 Buzz Session 14 Reading 14 Brainstorming 1
159. io communication through the computer via use of headphones and speakers also vulnerable to bandwidth issues when engaging large groups High Tech Communications www CarltonCollins com 9 Web Tours Where URLs data from forms cookies scripts and session data can be pushed to other participants enabling them to be pushed though web based logons clicks etc This type of feature works well when demonstrating websites where users themselves can also participate As an example try QuickBooks Online https gbo intuit com redir trialperiod 10 Meeting Recording Where presentation activity is recorded on the client side or server side for later viewing and or distribution 11 Whiteboard with Annotation Allowing the presenter and or attendees to highlight or mark items on the slide presentation Or simply draw or make notes on a blank whiteboard 12 Text Chat For live question and answer sessions limited to the people connected to the meeting Text chat may be public echo ed to all participants or private between 2 participants 13 Polls and Surveys Allows the presenter to conduct questions with multiple choice answers directed to the audience 14 Screen sharing desktop sharing application sharing Where participants can view anything the presenter currently has shown on their screen Some screen sharing applications allow for remote desktop control allowing participants to manipulate the presenters screen although this
160. ion WEP l Data encryption TEIP hed Contin network key Key index advanced i The key is provided for me automatically This is a computerto computer ad hoc network wireless access points are not used 3 Change the Default SSID Access points and routers all use a network name called the SSID Manufacturers normally ship their products with the same SSID set For example the SSID for Linksys devices is normally linksys True knowing the SSID does not by itself allow your neighbors to break into your network but it is a start More importantly when someone finds a default SSID they see it is a poorly configured network and are much more likely to attack it Change the default SSID immediately when configuring wireless security on your network Copyright April 2010 J Carlton Collins CPA all rights reserved 210 High Tech Communications www CarltonCollins com Wireless LAN Configuration Utility Link Info Configuration Encryption About Mode Infrastructure SSID inks o Ts Rate Fully Automatic PSMode xl Channel EF Restore Defaulte Undo Changes Apply Changes i Cancel Help Log In to the Network Router Navigate to the Router s Basic Wireless Settings Page Choose and Enter a New SSID Save the New SSID 4 Enable MAC Address Filtering Each piece of Wi Fi gear possesses a unique identifier called the physical address or MAC address Routers keep track of the MAC add
161. ions you can also sometimes turn off Wi Fi on a broadband router without powering down the entire network Copyright April 2010 J Carlton Collins CPA all rights reserved 214 High Tech Communications www CarltonCollins com Speech Recognition Chapter 26 Copyright April 2010 J Carlton Collins CPA all rights reserved 215 High Tech Communications www CarltonCollins com Speech Recognition Speech recognition converts spoken words to text Speech recognition applications include Voice dialing e g Call home Call routing e g I would like to make a collect call Simple data entry e g entering a credit card number Speech to text processing e g word processors or emails a The first soeech recognizer appeared in 1952 and consisted of a device for the recognition of single spoken digits 1 Another early device was the IBM Shoebox exhibited at the 1964 New York World s Fair Windows Speech Recognition Windows Speech Recognition is a speech recognition application included in Windows Vista and more recently Windows 7 Windows Speech Recognition allows the user to control the computer by giving specific voice commands The program can also be used for the dictation of text so that the user can control their Vista or Windows 7 computer Windows Speech Recognition relies on Microsoft SAPI version 5 3 included in Windows Vista to function The application also utilizes Microsoft Soeech Recogniz
162. irst day of summer 2 The Impulsive You don t have time to think about your responses ey Hm going om vatabion and i need tomtom ta Look afle my tat ig paatiy Low pearderante wad ju Tead bs give het feins massagot gvi heupe ak te det alga liegs te wt sung ts deep Think you could look afiat him while Vm 1 gaT i d only we fret Emer nerki ofl oa That just avout sums it up The End heh heh 3 The Jagged Neither one of you times your responses properly so you re constantly interrupting one another The conversation lacks any kind of flow i Really hate it When my wife puts Rattlesnakes in the couch She thinks it s hilarious wut thei venom is quite powerful and the vites are very painfu OMG my wife does the same thing except with scorpions Solty didn t mean to cut you off sometimes Oh no provlem it happe So yeah Enough with the goddamn scorpions says to he 1 thought it woul said the same thing Honey Rattler vites aren t funny So What did she do She swapped out the Rattlers for covras 4 The Pauses On the phone ten seconds of silence feels like ten years of silence Yeah so that s my story complete lack of 5 The Body Language Body language in conversation can make a huge difference Hey Carl it s ween foRever since SAW you High Tech Communications www CarltonCollins com fin M ee s
163. is feature represents yet another obstacle deterrent to hackers there are many software programs available that enable hackers to defeat this measure by easily faking a MAC addresses 5 Disable SSID Broadcast In Wi Fi networking the wireless router typically broadcasts the network name SSID over the air at regular intervals This feature was designed for businesses and mobile hotspots where Wi Fi clients may roam in and out of range In the home or small business this roaming feature is probably unnecessary and it increases the likelihood someone will try to log in to your home network Fortunately most Wi Fi access points allow the SSID broadcast feature to be disabled by the network administrator To do this simply log into your wireless router device navigate to the SSID menu and click the disable button as shown below Copyright April 2010 J Carlton Collins CPA all rights reserved 212 High Tech Communications www CarltonCollins com Linksys A Division of Cisca Systema inc Fimware Version 1 55 02 Wireless G Broadband Router WRK54G _ Applications See are Wireless Setup Wireless Security p n saan Administration Status Basic Wireless Wireless Network l Advanced Wireless Settings Wireless Security Tati i y Access Settings Basic Wireless Settings Wireless Network Wireless Network The Wireless screen Mode allows you to Wireless Network customize data _ Name SSID RR a nsmission settings Ss
164. itional effort is a lot less than you might think Web hosting companies like Go Daddy offer web hosting services which will allow you to maintain dozens of domain names for less than 1 000 per year Domain names cost about 10 per year As you can see the hard costs involved are trivial compared to the potential benefits of the additional exposure and multiple images that can be achieved Of course there is a cost associated with developing the additional home pages and administrating those pages However this effort does not need to Copyright April 2010 J Carlton Collins CPA all rights reserved 134 High Tech Communications www CarltonCollins com be extensive am frequently asked to explain how much effort is involved in creating a web site Here s what do when get this question simply ask them to give me the name of their current web site then visit that web site and from my browser menu choose File Save As and download their web site onto my computer this whole process takes only a few seconds Next open that web page up in Microsoft Front Page and edit the page quickly change the background color and font quickly insert a few pictures of fish which I have previously saved to my computer then copy the revised web page out to my web server and browser to that new page Proudly explain there you go there is your new web page complete with a fishy theme It already contains your content and links and it is r
165. k content are those people you actually accept as friends From a CPAs standpoint your Facebook friends may be your fellow employees professional colleagues clients prospects or other contacts The problem is there are many places you need to visit to make these changes The four main areas you will need to visit are listed below and you will need to toggle to dozens of items within each category to change all settings to Friends Only 1 Account Account Settings Edit the networks privacy settings 2 Settings Privacy Settings Edit the privacy settings for each of the following a Profile Information 12 different privacy settings b Contact Information 9 different privacy settings c Applications and Websites 1 privacy setting d Search 2 privacy settings 3 Settings Application Settings Edit the privacy settings for each application you have running such as Groups Photos Video Notes Events Gifts Etc 4 Each individual Photo Album 1 privacy setting Copyright April 2010 J Carlton Collins CPA all rights reserved 66 High Tech Communications www CarltonCollins com Exceptions to Friends Only The only exception might be under Settings Privacy Settings Search Here you might want to keep this setting set to Everyone so you can be found via a search I also allow my pictures to be viewed by Friends of Friends 2 Use Lists to Help Organize your Privacy Settings The Facebook
166. kypeOut calls March 2007 Skype adds a new feature called Send Money which allows users to send money via PayPal from one Skype user to another August 17 2007 Skype users were unable to connect to full Skype network in many countries Skype reports the system wide crash was the result of exceptional number of logins after a Windows patch reboot this day is referred to as Patch Tuesday July 9 2008 Skype changes system into a full screen application September 2008 Skype discontinues its SkypeCast service without explanation September 2008 Skype adds Compact mode after user criticism of the new default full screen mode October 2008 Analysis reveals TOM skype sends content of text messages and encryption keys to monitoring servers November 2008 Skype adds internal monthly and daily usage caps on their SkypeOut subscriptions advertised as Unlimited March 2009 Skype launched Skype for SIP a service aimed at business users At the time of launch around 35 of Skype s users were business users April 2009 eBay announced plans to spin off of Skype through an initial public offering in 2010 August 2009 Joltid files a motion with the U S Securities and Exchange Commission seeking to terminate a licensing agreement with eBay which allows eBay and therefore Skype to use the peer to peer communications technology on which Skype is based If successful this may cause a s
167. l Your Online Meetings Live Meeting supports all types of online meetings from small collaborative team meetings to training and even events with thousands of participants 6 Deliver Effective Online Presentations With Live Meeting you can deliver remote presentations with the same effectiveness as being in person With full support of Microsoft Office PowerPoint animations and transitions and the ability to receive real time feedback from your audience you can successfully get your point across without having to be in the same room 7 Extend Your Customer Base Without Geographical Limits Widen your potential client and customer base Easily access people no matter where they are Reach more people in less time 8 Collaborate In Real Time Share collaborate and discuss your projects in real time Windows of opportunity are short and you can t afford to wait for everyone to be in the same place at the same time Make critical decisions quickly with all the stakeholders regardless of geography 9 Get Easy Administration And Deployment Whether you are a company with 5 employees or 50 000 you can easily enable everyone in your organization to conduct effective online meetings With a variety of administration tools you can comply with corporate policies and easily manage users of the Live Meeting service 10 Instant Meetings Live Meeting enables you to conduct your online meetings training and events at a momen
168. l have to come up with your own pick up line While am not sure about pints 4 amp 5 points 1 through 3 could easily apply to any business situation See if you can tell what message or impression these people are sending Copyright April 2010 J Carlton Collins CPA all rights reserved 33 High Tech Communications www CarltonCollins com Low Tech Communication Methods Chapter 5 Copyright April 2010 J Carlton Collins CPA all rights reserved 34 High Tech Communications www CarltonCollins com Low Tech Communication Methods By no means do suggest that you should ignore low tech communication methods they work too Presented below are some of the low tech communication methods you should also employ Yellow Page Ad In an effort to get noticed Yellow Pages ads are getting more and more graphically outrageous A picture can help but remember that eyeballs are the single most effective graphic image for drawing and holding attention Make sure that your Yellow Pages ad accurately conveys the image you want Display Ads Similar to yellow page ads prospects can draw a number of conclusions from your display ads in newspapers and magazines Does your ad convey a dignified professional image or does it make you look low end Does your ad speak softly and clearly to your prospect or does it scream Brochure A brochure offers a good leave behind or mailer that provides prospect with the information you want the
169. l have unlimited access to it from any other Internet connected computer in the world GoToMyPC Personal Monthly Plan Annual Plan Cost One PC 19 95 179 40 Save 25 Two PCs 279 95 269 40 Save 25 Need 3 70 PCs Pay just 14 98 mo or 135 00 7 per PC Calculate price below Key Demonstration points for GoToMyPC eo oo ae E Show logging in takes about 45 seconds or less Show remote control Show dual screens Show security Lock out screen and keyboard Show security Set automatic logoff greater than 15 minutes Demonstrate voice over IP Discuss printing locally or remotely Demonstrate File Transfer Copyright April 2010 J Carlton Collins CPA all rights reserved 54 High Tech Communications www CarltonCollins com The screen above shows the GoToMyPC web page where you can log into any computer on the interest around the world The screen below shows some of the preferences that can be set to make GoToMyPC behave to your particular tastes Ea Preferences GoloMyPC T T T Ip ST gt 7 Host Viewer Performance Sound Security Authentication Printing Connections Security Features Blank out screen while connected Lock host keyboard and mouse Viewer Security Time Out after 1740 minutes of inactivity Cancel pcAnywhere pcAnywhere has been a long
170. l newsletter on the company s progress by the website s co founder Biz Stone Character Limit The 140 character limit on message length was initially set for compatibility with SMS messaging and has brought to the web the kind of shorthand notation and slang commonly used in SMS messages The 140 character limit has also spurred the usage of URL Copyright April 2010 J Carlton Collins CPA all rights reserved 80 High Tech Communications www CarltonCollins com shortening services such as bit ly goo gl and tr im and content hosting services such as Twitpic memozu com and NotePub to accommodate text longer than 140 characters Bit Ly Twitter uses bit ly for automatically shortening all URLs posted on its website Content Of Tweets According to Pear Analytics San Antonio based market research firm tweets fall into the following six categories 1 Pointless babble 41 2 Conversational 38 3 Pass along value 9 4 Self promotion 6 5 Spam 4 6 News 4 Rankings Twitter is ranked as one of the 50 most popular websites worldwide by Alexa s web traffic analysis With an estimated 6 million unique monthly users visitors only 40 percent of Twitter s users are retained Demographics Just 11 percent of Twitter s users are aged 12 to 17 according to comScore Privacy And Security Twitter collects personally identifiable information about its users and shares it with third parties The service considers tha
171. le page that you don t want outsiders to see b Refrain from using any third party applications most applications are games or quizzes that can waste time c Block all third party applications d Block your content which friends can share through their use of applications This is accomplished from the Account Privacy Settings Applications and Websites menu 5 Remove Yourself From Facebook Search Results Cariton Cotas There are many reasons why you might not want your information to show up in search results on Facebook and if so it s easy to turn off your public visibility For example if you are in the process of applying for a job it might be best to temporarily remove yourself from Facebook search results if you feel that your Facebook page conveys a less than professional image To do this select Account Privacy Settings Search Facebook Search Results and select Only Friends Remember by choosing this action you will no longer be findable Copyright April 2010 J Carlton Collins CPA all rights reserved 68 High Tech Communications www CarltonCollins com 6 Protect Yourself from Networks Most CPAs join networks or groups without giving the matter a second thought However there might be valid reasons to avoid networks completely For starters the networks you belong to are treated by Facebook as public information therefore anyone can see which networks you be
172. ligence Copyright April 2010 J Carlton Collins CPA all rights reserved 154 High Tech Communications www CarltonCollins com Cell Phone Hacking Tools In addition to the problems mentioned above the hacker community is also armed with an arsenal of hacking tools designed to intercept your cell phone calls and voice email messages Cell phone hacking became front page news in 2008 when Paris Hilton s cell phone was hacked and all her celebrity friends and their phone numbers were placed on the Internet http www youtube com watch v qP1BOZqrp5g Some examples of the cell phone hacking tools are listed below 1 Roving Bug The FBI uses a hacking tool called a roving bug originally approved by top U S Department of Justice officials for use against members of a New York organized crime family in which the FBI can activate your cell phone s microphone and use it to eavesdrop on nearby conversations Here is a video clip http www youtube com watch v wjEA9gEEfpU amp feature related 2 Bluesnarfing Bluesnarfing hack tools allows a hacker to contact your cell phone without your knowledge and download your phone s information including pictures or video 3 Brickhouse Sim Card Spy There are many tools which can read deleted text messages off of a cell phone This is because most cell phone storage cards are formatted with FAT which means that data is not really deleted when erased it can be retrieved For 99 Brickhouse
173. llins com Social Networking Chapter 8 Copyright April 2010 J Carlton Collins CPA all rights reserved 61 High Tech Communications www CarltonCollins com Social Networking Who you know does matter right Social networks help you maintain your relationships be them business personal or casual Linked In is geared more for business relationships whereas FaceBook is geared more as a social tool that helps you maintain more personal relationships but they both work well helping you keep track of all the people you know that might enrich your life professionally or personally E Applications ocial Networking Solutions such as FaceBook are having a dramatic impact on you both personally and professionally What started out as a social playground for kids has evolved into an environment that adults are finding useful and rewarding Home Profile facebook View Photos of Me 278 View Videos of Me 13 Edit My Profile You won t get what you want unless you want what you get Information Current City Atlanta GA 3 Website http www asaresearch com web fre Friends 451 friends See All R iz Tammy Tommy Sharon Huebner Crutchfield Ailleen rh Sone Friends Inbox 2 Carlton Collins Settings Logout Carlton Collins Babe Ruth had a lower lifetime earned run average than Cy Young Whitey Ford or Sandy Koufax During his early years with the Red Sox Ruth pitched nine shutouts in a season
174. located in a protected location such as beneath the battery behind a battery cover but the sensors on an iPhone are directly exposed to the environment This has led to criticism of the placement of the sensors which may also be affected by steam in a bathroom or other light environmental moisture Operating System The iPhone and iPod Touch run an operating system known as iPhone OS It is based on a variant of the same Darwin operating system core that is found in Mac OS X Also included is the Core Animation software component from Mac OS X v10 5 Leopard Together with the PowerVR hardware and on the iPhone 3GS OpenGL ES 2 0 4 it is Copyright April 2010 J Carlton Collins CPA all rights reserved 159 High Tech Communications www CarltonCollins com responsible for the interface s motion graphics The operating system takes up less than half a GB of the device s total storage 4 to 32 GB Like the iPod the iPhone is managed with iTunes Included Applications By default the Home screen contains the following icons Messages SMS and MMS messaging Calendar Photos Camera YouTube Stocks Maps Google Maps Weather Voice Memos Notes Clock Calculator Settings iTunes store App Store and on the iPhone 3GS only Compass Docked at the base of the screen four icons for Phone Mail Safari Internet and iPod multimedia delineate the iPhone s main purposes Internet Connectivity By default the iPhone will ask to
175. long to Belonging to a controversial network might convey the wrong message to your clients or colleagues so be careful as to which networks you join By default network members have the same access to your information such as your birthday or political and religious views as your approved Facebook friends Belonging to a network makes your Facebook information searchable by all members of that network as if they were your approved Facebook friends even if you have disabled public searches To protect yourself from networks CPAs should refrain from joining any network or group in which they have concerns about everybody in that group having access to their Facebook information If a CPA does join a network they should consider limiting the access to their Facebook information by selecting Privacy Settings Profile Information and for every option that displays Friends and Networks change that setting by selecting Customize then select Only Me and click OK Then Select Customize again and change it to Only Friends This will ensure that the setting is set to Only Friends and not to Friends and Networks Be advised that it can be a tedious process to make these types of setting adjustments on such a granular level 2 Make this visible to These people Only Friends Friends of Friends Specific People Hide this from Only M These people Enter a Name or List rar 7
176. lows Printed Pages PowerPoint slide shows can be printed to paper with your choice of 1 2 4 6 or 9 slides per page If desired you can suppress the slide show background to make the slides more readable especially when printed on a black and white printer Assuming duplex printing 2 sided page printing you could print a 36 page PowerPoint slide show on just 2 pieces of paper using 9 slides per page This would allow you to provide handouts to all meeting participants hence they will not have to frantically take notes to capture the content of your slide show Print what Handouts Handouts Slides per page 6 Color grayscale Order Horizd Vertical Grayscale Scale to fit pap p W Frame slides Include comment pages Printing 9 slides per page Transparencies PowerPoint slide shows can be printed to transparencies which can then be used on an overhead projector Of course transparencies can be printed in black and white or color This approach allows you to use a simple overhead projector to deliver your presentation a low tech approach that may offer less risk compared to using a laptop and computer projection system Such a solution might be preferable for Copyright April 2010 J Carlton Collins CPA all rights reserved 190 High Tech Communications www CarltonCollins com travelers who prefer to leave their laptop computers at the home or for use as a backup delivery method Publish As a W
177. loyment and management of forms throughout your organization InfoPath Forms Services of Office SharePoint Copyright April 2010 J Carlton Collins CPA all rights reserved Page Tools Hel High Tech Communications www CarltonCollins com Server 2010 help you get control over your forms solutions by providing centralized management of electronic forms for the entire organization Office SharePoint Server 2010 provides a unified portal and a forms and content management solution for your enterprise to help you manage electronic forms in the same context as other critical business functions amp 3 lt i http moss2007server FormServerTemplates Forms Al Forms aspx File Edt View Favorites Tools Help fa Home Feeds f Print Page Tools Help afat 127 Home Al Sites w Home Document Center News Reports Search Sites Site Achons Home gt Form Templates Form Templates View All Site Content Use the Form Templates library as the central repository of form templates for this site collection a Expense Reports Loan applications E Form Category 5 i dataconnections mA expensereport expensereport Completed Loan Application ij loanapplication oanapplication Completed dragosd a dragosb2 loanapptest oanapotest Completed order form order form Document Center za w2 a Documents Form Category mobile 1 Pictures gaij mobile order form Lists oe
178. lt is that if you were to create a web page with this title chances are good that your web page would be returned to the top of the hit list every time someone searched the Google for a company that offers international tax consulting services What we can learn from this observation is two things First you need create a web page with precisely the right title and keywords in order to have your best chances of being sorted among the top web sites Unless your company is one dimensional there is no way that you can do this with just one web site Therefore to be effective you may need to create a web site for every service you offer This concept is discussed further below The second thing we learn is that it may be beneficial to first test your title against the various Internet search engines before you finalize it You can usually tell by the resulting rankings of the top hits whether your intended title will sort higher on the list Conclusion Choose an appropriate title for your web page Choose appropriate keywords Make sure all of the relevant buzz words are included in the body of your home page Test your title before finalizing These steps will help you get found on the Internet Get Chosen Just because you made it to the top of a hit list from a search engine does not mean the user is going to click on your site You need to make sure your web page summary is well written and to the point The screen below shows the summaries for j
179. lton Collins CPA all rights reserved 174 High Tech Communications www CarltonCollins com Microsoft Live Meeting Surveys show that most business professionals consider some meetings to be important most meetings are simply a large waste of time particularly when extensive travel is involved In today s world technology has changed the face of meetings from long and expensive ordeals that eat cash and rob companies of productivity into quick and inexpensive tasks that make meetings almost as simple as a phone call Using the internet and your computer you can now meet with one to one thousand people from the comfort of your own desk The software that makes this work is Microsoft Live Meeting and it promises to be the next great technology break through that will change the way business does business The live meeting screen is shown below ee fT es a a Wl re Miret TF ce i Live Meeting ee ee rs Prind alin a Cl Coni E Taa A 17 0 0 ineduetien a 1 2 Metin Aa a L Eemi ery 4 Grs Apren poesis 5 dee in Profit Mange i F Seo Abbess i Fired QHerdes Matches Beie Foard ad J Aare BE x 4 Eo Seating Chart To Question and Aneers u B Pittin a i a r a j E si fa i ote a Wa tte LAES E i a a boli 2 Qucition d Start E Y herosi Crifioe Live Meting Am tom Not only does Live Meeting allow you to hold meetings without incurring heavy travel and travel expenses bu
180. m than unrated chargers Having a standard charger for all phones means that manufacturers will no longer have to supply a charger with every new phone The majority of energy lost in a mobile phone charger is in its no load condition when the mobile phone is not connected but the charger has been left plugged in and using power Newer Lithium Polymer Batteries Formerly the most common form of mobile phone batteries were nickel metal hydride as they have a low size and weight Lithium ion batteries are sometimes used as they are lighter and do not have the voltage depression that nickel metal hydride batteries do Many mobile phone manufacturers have now switched to using lithium polymer batteries as opposed to the older Lithium lon the main advantages of this being even lower weight and the possibility to make the battery a shape other than strict cuboid The Cellular Phone Market The world s largest individual mobile operator is China Mobile with over 500 million mobile phone subscribers The world s largest mobile operator group by subscribers is UK based Vodafone There are over 600 mobile operators and carriers in commercial production worldwide Over 50 mobile operators have over 10 million subscribers each and over 150 mobile operators have at least one million subscribers by the end of 2008 source wireless intelligence Mobile phone manufacturers market share in Q3 2008 In mobile phone handsets in Q3 2008 Nokia
181. m to have make sure that it does not leave out important facts that would help your prospect decide to hire you Make sure that your brochure looks crisp clean neat attractive informative complete and professional Plenty of white space high quality graphics and color printed with a readable size Calibri font shadowing and transparency will convey a 2010 impression Avoid making fonts larger to fill edge to edge that will make your brochure look amateurish Business Cards Your business cards should be crisp clean and professional and the type size and font should be easy to read Keep in mind that background colors and patterns can interfere with high tech card scanning devices Stationery Envelopes amp Stamps Bite the bullet and order a box of fine linen stationary and envelopes then use them Of course you won t use this for mailing invoices or bills but when you want to say thank you or invite someone to join you the traditional letterhead and envelope will make a good impression whether you handwrite the note or not Don t forget to purchase some attractive stamps as well Include your business card in your letter too Web Site and E Mail Address Yes a web site is more of a high tech communication tool but don t forget to reference your web site and e mail address in your stationary and business cards Tips for designing a professional web site will be covered later in this manual Telephone Reception
182. mail Merging Word amp Outlook f E Mail Marketing g E Mail List Management 12 Secure e Mail Solutions a Hush Mail b Pretty Good privacy c Secure Hive d Vormetric e ShyFile 13 Electronic Forms a InfoPath b Web Based From Controls 14 Electronic Surveys a Zoomerang b Web Monkey 15 Synchronization a Cell Phone Data to computers b Synchronizing Excel Files to Your Web Site c Web pages to computers 16 Hand held communication tools a iPhone b Cell phones c PIMs d Ear Pieces 17 Contact Management Tools a Personal Information Management PIM Tools b Sales Force Automation SFA Tools c Customer Relationship Management CRM tools 18 Web Site Development amp Web Site Management Tools a Microsoft FrontPage Copyright April 2010 J Carlton Collins CPA all rights reserved www CarltonCollins com High Tech Communications www CarltonCollins com b Microsoft Expression Web c Dreamweaver d Blogging 19 Supply Chain Automation Solutions a Communications between Accounting Systems b Microsoft BizTalk 20 RFID Technology a Asset Tracking b Inventory Management c Measurement 21 Desktop Publishing a Microsoft Publisher b Electronic Newsletters c Electronic Marketing amp Communications 22 Digital Dashboards Windows into your accounting system and financials 23 Push Technology a RSS Feeds b Scheduled Copyright April 2010 J Carlton Collins CPA
183. mains to be a difficult obstacle for many business people In the past your company probably called in a graphic artist or other specialist to help prepare your company brochure These creative people typically have a flair for creating vivid products which catch the eye and convey professionalism These specialists also have access to better desktop publishing equipment such as scanners color printers and photographic equipment This puts them in a better position to develop brochures and print media The development of web pages generally calls for the same skill set Therefore while generating your own home page is relatively easy producing an attractive web page that conveys the right look may require the use of a professional Copyright April 2010 J Carlton Collins CPA all rights reserved 125 High Tech Communications www CarltonCollins com Publishing Your Web Page Once you have developed your Web Home Page and sub pages the next step is to simply copy your files to a web server somewhere in the world There are thousands of web servers who would be happy to host your web page for a small monthly charge As a good example Go Daddy will host your domain name and provide a web site for just 4 95 per month Here is how it works 1 Visit the Go Daddy Web Site and purchase a domain name for about 9 00 Welcome Carlton Not you 24 7 Sales amp Support 480 505 8877 Re Daddy comin coina EJ nens ote om Domains websites a
184. mall office networks rush through the job to get their Internet connectivity working as quickly as possible but the fail to take the additional measures needed to properly lock down this new access point The recommendations below summarize the steps you should take to improve the security of your home wireless network 1 Change Default Administrator Passwords and Usernames The first order of business is to log into your wireless device settings and change the default username and password The default login name and password is usually admin and password and all of the hackers out there know this Therefore you should change these settings immediately Here s how First you must be connected to the wireless device with a physical wire such as an Ethernet cable you sometimes cannot do this wirelessly Log In to the Network Router by typing the following into your browser HTTP 192 168 0 1 or whatever IP address is printed on the bottom of the wireless device if different Navigate the menu to the Router s Change Password Page Choose and Enter a New Password Save the New Password Copyright April 2010 J Carlton Collins CPA all rights reserved 208 High Tech Communications www CarltonCollins com Setup Windows Internet Explorer CRCR E http 192 168 254 254 2869 home htm Z Google G Go b O B YP Bookmarksy P Check AutoLink AutoFill Sendtow A Links Reunion
185. me Tracker For a monthly fee this solution enables QuickBooks users to enter their timesheet data via a web based form and the resulting data flows directly into QuickBooks This data is used to calculate payroll checks and create customer invoices Copyright April 2010 J Carlton Collins CPA all rights reserved 58 High Tech Communications www CarltonCollins com QuickBooks TimeTracker Ouncan Fisher Larry s Landscaping lt Mays 700 gt bis TT woe Thu T y Pph Customer tob Service item P P r ms ar Firdl adin hate Linden T harap ika ar Tine ohie t Tave Draft Sage Treat hee t i The QuickBooks Time Tracker Web Based Data Entry Screen The built in drop down list boxes and automatic tabulation makes the forms quicker and easier to fill out The resulting data is submitted electronically avoiding the need to hand deliver fax mail or send paper based timesheets Electronic documents are less prone to errors and are more easily shared sent for approval or backed up off site The QuickBooks Time Tracker add in is priced at 7 00 per user per month There are many solutions available to help you create your own electronic forms For example Microsoft InfoPath is designed to help you create and deliver electronic forms Default templates such as Standard labl Text Box expense reports are provided and the built in user tools can be used to edit those templates or if you prefer you can
186. me file at the same time The SharePoint system also enables users to keep track of their progress indicate tasks that have been completed post notes and in general maintain all relevant information about a job or project in a centralized location for all authorized person to see An example of this system is shown below File Edit View Favorites Tools Help pack hg x E A P Search 5 Favorites E2 A AN i m 3 Google microsoft live meeting v B Search web p fal Options 4 E microsoft GJ live E meeting Links 4 1 Google Home SBA Team Web Site Administration 4 One Liners AdvisorcPE asa boortz carton 4 Consulting 4 Control Center Sign In PageRank Home Documents and Lists Create Site Settings Help Select a View All Tasks My Tasks SBA Team Web Site Tasks A D Use the Tasks list to keep track of work that you or your team needs to complete SjNew Item grilter edit in Datasheet Due Today Active Tasks By Assigned To Actions o Alert me Export to spreadsheet a Modify settings and columns U Title Chapter 01 New Company Setup Chapter 02 New User amp Security Chapter 03 Chapter 04 Chapter 05 Chapter 06 Chapter OF Chapter 08 Chapter 09 Chapter 10 Chapter 11 Chapter 12 Chapter 13 Chapter 14 Chapter 15 Chapter 16 Chapter 17 Chapter 18 Chapter 19 General Ledger amp Journal Entrie
187. milar to soam email and who wondered how the company was planning to make money from a free service that collects personal contact and network information However after changes at Plaxo and discussions with the company s remaining co founders Coursey reversed his stance Plaxo also responded to these issues in a section of their website Copyright April 2010 J Carlton Collins CPA all rights reserved 79 High Tech Communications www CarltonCollins com twitter Twitter is a social networking and microblogging service that enables its users to send and read messages known as tweets Tweets Tweets are text based posts of up to 140 characters displayed on the author s profile page and delivered to the author s subscribers who are known as followers Free While twitter is free your phone service provider may charge your texting fees Popularity Since its creation in 2006 by Jack Dorsey Twitter has gained notability and popularity worldwide It is sometimes described as SMS of the Internet By the end of 2007 about 500 000 tweets per quarter were posted By the end of 2008 100 million tweets per quarter were posted By the end of 2009 2 billion tweets per quarter were posted In the first quarter of 2010 4 billion tweets per quarter were posted Lists Since late 2009 users can follow lists of authors instead of following individual authors History Twitter began in a daylong brainstorming session that was held by b
188. mp everythin g in between Domain Support amp 5 Bob s My HOME Auctions soeenheert een Community Media Video Blog Account Domains Hosting Email Site Builders Business SSL Certificates Resellers 1 in Domain Registrations A SALE info 0 89 Go Daddy DEALS on TV SALE me 8 99 SALE mobi 6 99 Pye to 30 off SALE us 4 99 Peer builders Domains for just 1 9 6 99 Domain Transfers Over 100t in Free Extras SALE biz 5 99 Domain Options amp Pricing Bulk Registration International Domains CO Now Available Plus ICANN fee of 18 cents yr Building a website is as simple es as point and click One year only 4 49 mo Learn more mains for just 1 99 E SER Waban gee purchase d Search for a domain name W Buy Now 5 i uy Transfer domains to Go Daddy Plus everyday low prices on the most popular domains Build a website ae i New COMs 1 0 69 Get reliable website hosting hed year amp lower pos G0 Dadd K J 6 99 Buy personalized email Secure data with an SSL Renew products own ECONOMY PLAN Fi UNLIMITED PLAN 150 GB Space 1 500 GB Transfer 500 Email Accounts 25 MySQL Databases 410 GB Space 300 GB Transfer 100 Email Accounts 10 MySQL Databases Unlimited Space and Transfer 1000 Email Accounts Unlimited MySQL Databases Includes Freet SSL Certificate amos 5 4 99 mo imo 6 99 mo 4dmo 14 99 mo ioe 12mo
189. ms to have a satisfaction rating of 99 5 Easy SurveyMonkey claims to be simple and cost effective Privacy amp Security SurveyMonkey uses SSL encryption and multi machine backup Very Popular SurveyMonkey claims that 100 of the Fortune 100 as well as other businesses academic institutions and organizations of all shapes and sizes use their product Many Uses SurveyMonkey is used for everything from customer satisfaction and employee performance reviews to course evaluations and research of all types Free The Basic subscription is completely free Never Expires Your surveys never expire even if you choose to never upgrade from the free program Additionally you responses never expire even if you choose to stay as Basic Unlimited You can create and administer as many surveys as you want for as long as you want They are stored indefinitely Basic Features Following are the features provided by a free SurveyMonkey account as they range from survey design to data collection to analysis features Create unlimited number of surveys Allows up to 10 questions per survey Choose from 15 available question types Supports any language including Unicode Survey completion progress bar Automatic numbering for pages questions 15 pre built survey themes Validate require survey responses Randomize sort answer choices Accessible and 508 compliant and certified surveys 100 responses per survey Upgrade
190. munications www CarltonCollins com High Tech KIOSK Chapter 9 Copyright April 2010 J Carlton Collins CPA all rights reserved 82 High Tech Communications www CarltonCollins com Introduction to Kiosks There are a large number of companies producing high tech KIOSKs which are unattended computer stations that provide customers and passer bys with the information they need via electronic methods Most kiosks provide unattended access to web site applications and the device is restricted to displaying that one web site Interactive kiosks are typically placed in high foot traffic settings such as hotel lobbies or airports Presented below are a few discussion points concerning KIOSKs 1 History The first self service interactive kiosk was developed in 1977 at the University of Illinois at Urbana Champaign by a pre med student Murray Lappe and allowed students and visitors to find movies maps directories bus schedules extracurricular activities and courses When it first debuted in the U of Illinois Student Union in April 1977 more than 30 000 students teachers and visitors stood in line during its first 6 weeks to try their hand at a personal computer for the first time 2 First Commercial KIOSK In 1991 the first commercial kiosk with internet connection was displayed at Comdex The application was for locating missing children 3 Marriage of the KIOSK Robotics amp Vending Machine Many of today s kiosks bri
191. n Adapted from Givens 1998 202 Center for Nonverbal Studies ee ee ee E m e O eere W N e Remember you are not the only person who studies body language Misleading body language can be used to do just that mislead Look at the individual s entire presentation when in doubt Incongruity may be an attempt to conceal or mislead The truth is consistent When the spoken word is at cross Copyright April 2010 J Carlton Collins CPA all rights reserved 27 High Tech Communications www CarltonCollins com purposes with body language normally it is safer to believe the body because body language is more likely to be unconscious Learning to Read Body Language Whether you know it or not your body language tells more about you than you think Although many of the pictures presented below display exaggerated body language most people can pick up on even subtle tell tale signals Most of us are already aware of body language but we don t think about it enough when it comes to our own body language or reading other s body language To help you understand body language a little better presented below are some typical signals that you send off with your body language along with pictures and a brief description It is to your advantage to understand how to read and deliver body language Aggressive Body Language Showing Physical Threat Not smiling Shoulders squared off Pointing Furrowed brow Leaning forward whil
192. n Create a Simple WebLink Send out a link to your survey via email or post it on a website Respondents simply click the link to go directly to your survey Copyright April 2010 J Carlton Collins CPA all rights reserved 93 High Tech Communications www CarltonCollins com o Manage Your Participants If you have a list of emails and you would like to track who responds SurveyMonkey provides tools to manage your list and create custom email invitations You can also send follow up reminder emails to those who haven t responded With a Pro or Unlimited subscription the email list size restriction is increased compared to a Basic account limit p Generate Popup Invitations To increase response rates you can create a custom invitation popup for your own website Simply cut and paste the code into any webpage to start generating invitations To minimize annoyance to your visitors invitations will only pop up once q Custom Redirect Once your survey is complete respondents will be redirected to the page of your choice r Thank You Page Feature Create a custom thank you page to appear at the end of your survey s View Results in Real Time You can view your results as soon as they are collected t Browse Individual Responses Drill down to the individual response level to see the details of particular respondents or to read the comments of open ended questions u Filter Results Ask questions such as Show me only those
193. n that hit list Only those web sites which are solely dedicated to the topic international tax consultant rank among the top 20 to 30 hits As a result ABC Consultants are not found by Good Growth Inc However let us assume that Good Growth does find the ABC web site what then In this case the folks at Good Growth are not impressed The fact that international tax consulting is listed as a mere bullet does not compel Good Growth to follow up instead they simply move on to the next web site By contrast XYZ Consultants have created a separate web site to promote each of their specific services Their international tax consulting web site exudes international tax information The title contains the words international tax consultants The keyword list contains the words international tax consultants The content spouts off a multitude of relevant international tax information including A checklist of the ten most important international tax issues to consider A list of laws currently pending in Congress which could affect international tax law Case studies where the firm assisted other companies with international tax issues Lists of conferences and seminars on international tax law Biographies of firm consultants as they relate to international tax issues The top ten questions you should ask of your international tax advisor Published articles designed to educate you about international tax issues References
194. n into a desktop computer using a full keyboard and large screen Thereafter you can use a cradle to simply sync your desktop Synchronized data with your hand held device Once for nalion i Type Slalus a C2 Calendar Synchronized configured it is as easy as plugging in your contacts Soteria PN i k hand held device and today s syncing WS Tasks Synchronized technologies update your information l i automatically Copyright April 2010 J Carlton Collins CPA all rights reserved 165 High Tech Communications www CarltonCollins com SYNCing Products There are many syncing tools designed to keep your data in sync a few of which are listed below Microsoft ActiveSync Palm s HotSync Pumatech s Intellisync ActiveSync Microsoft s approach to synchronization started with H PC Explorer which was basically a Windows Explorer add on that gave desktop users access to files and data on Windows CE 1 0 based handheld PCs H PCs H PC Explorer evolved into Windows CE Services for Windows CE 2 0 and Windows CE 2 1 then into ActiveSync for Windows CE 2 2 3 x and now PocketPC devices Like HotSync ActiveSync synchronizes data between desktop applications and Pocket PCs or other Windows CE based PDAs However ActiveSync synchronizes only with Outlook and the older Schedule The screen shot below shows a successful Calendar Contacts and Tasks synchronization with ActiveSync 3 1 Required hardware depends on the device in
195. n t handle using a touch based screen keyboard you want the BlackBerry Bold which is available from several U S carriers Copyright April 2010 J Carlton Collins CPA all rights reserved 162 High Tech Communications www CarltonCollins com 3 If you can t stand the thought of using the AT amp T 3G network and don t need to access corporate e mail outside of POP and IMAP mail servers you want the HTC Droid Eris which like the Motorola Droid is available only from Verizon Wireless Here are problem with evaluating smartphones 1 The WebOS based Palm Pre is dying as its sole U S carrier Sprint appears to have moved on from the Pre now focusing on Android devices 2 The Motorola Droid s keyboard is lacking multitouch support in its included apps 3 The BlackBerry Storm 2 s Tapping is very slow on the screen It s not surprising that within weeks of its release carriers are selling it as part of two for one specials 4 Windows Mobile devices have been out of the picture Microsoft s long delayed Windows 7 Mobile remained vaporware until February 2010 but not much buzz or market share has been created since then 5 Nokia s Symbian OS isn t in the same league as modern mobile OSes Nokia plans to move to a new OS called Maemo someday Copyright April 2010 J Carlton Collins CPA all rights reserved 163 High Tech Communications www CarltonCollins com Synchronization Chapter 18 Copyright April 2010 J
196. ngs together the classic vending machine with high tech communications and complex robotic and mechanical internals Such interactive kiosks can include self checkout lanes e ticketing information and way finding and vending Copyright April 2010 J Carlton Collins CPA all rights reserved 83 High Tech Communications www CarltonCollins com 4 Components Typical KIOSK components include Touch screen P C pointing device keyboard bill acceptor mag stripe and or bar code scanner surge protector UPS etc 5 Government Kiosks Several countries have implemented kiosks nation wide for various purposes In the United Kingdom thousands of special purpose kiosks are now available to aid job seekers in finding employment The United States Department of Homeland Security has created immigration kiosks where visitors register when they enter the United States There are also Exit kiosks where visitors register when they leave the U S 6 Itis estimated that over 131 000 kiosk terminals exist in the U S 7 Businesses Use Businesses who provide kiosks to their customers include Delta Northwest Airlines JetBlue Airways GTAA Future Shop The Home Depot Target Corporation and Wal Mart LA A DELTA mwa JetBlue A AIRWAYS TARGET 8 AT amp T By the end of 2010 AT amp T expects to install the largest bill pay kiosk network system in the world for the phone customers which allows customers to pay their p
197. nies simply submit their home page to the popular search engines and fail to submit all of their relevant sub pages e Lack of Good Deep Content A lack of good deep content can hurt you plenty The top search engines usually award brownie points to those web sites that are frequently linked to by other web sites If your web site has little or no content then others will not link to you If others do not link to you you won t score as high on a typical search The only real way to get others to link to your web site is to provide good content that others will find useful Few people will link to a cyber sales pitch Conclusion As a general rule buy everything purchase over the Internet unless plan to eat it right away Why do do this Because like to be a more informed shopper and like to save 20 to 25 on everything purchase After all CPA stands for Cheapest Price Available Therefore if you want my business you d better have a good web presence else you will never sell a single product or service to me except for maybe an occasional ice cream cone am not alone Millions of others also take to the web to find products services and rock bottom prices Call us Savvy or call us tight wads Either way our group is growing and there will be more web shoppers in the future not fewer Copyright April 2010 J Carlton Collins CPA all rights reserved 124 High Tech Communications www CarltonCollins com How
198. nk flaps around like a sail like to pretend my penis is an eagle flying free over the mountains of this geat nation 10 The Epic Goodbye Just hang up already Cool well thanks for the call Vil catch you latee Yeah man take care Suands gud dude We should talk soon ok see You take cane of yourself Will do catcha later mang Aliant vye l Layte idk Peace dude aiii VM HANGING UP pow Like hell age we ve still like 20 20 more wa Ways to say E godo Adios Oh ok Sayounaral au Revoir wiedersehen Copyright April 2010 J Carlton Collins CPA all rights reserved 148 Mobile Phones Chapter 17 High Tech Communications www CarltonCollins com 1G Analog Cellular Telephony The first commercially automated cellular network the 1G generation was launched in Japan by NTT in 1979 The initial launch network covered the full metropolitan area of Tokyo s over 20 million inhabitants The second launch of 1G networks was the simultaneous launch of the Nordic Mobile Telephone NMT system in Denmark Finland Norway and Sweden in 1981 NMT was the first mobile phone network featuring international roaming The Swedish electrical engineer Osten Makitalo started to work on this vision in 1966 and is considered as the father of the NMT system and some consider him also the father of the cellular phone The first 1G network launched in the USA was Chicago based Ameritech in 1983 using the famous first
199. nnection 2 CPAs can have remote access to their client s accounting data to assist them in closing entries 3 Data could be obtained from the client s machine and then the accountant could perform necessary accounting tasks remotely Employees 1 Conduct work from any remote venue using remote access 2 Ideas can be documented and initiated immediately without going into the office 3 Employees unable to physically go into the office can perform tasks from home 4 Traveling employee can use a notebook without compromising secure office data 5 Remote access allows employees to travel with less costly computers than their primary PCs 6 Ensures data integrity since the data can remain on one machine without the need to update Support 1 Technical or product support is often simplified as accessing the PC in question becomes easier 2 Support agents physically see the issue rather than relying on user descriptions 3 Web based tools can detect and evaluate hubs routers and other devices from a central location GoloMyPL GoToMyPC is a web based remote access solution that requires only a browser This product technology can be installed and set up in about 2 to 5 minutes and thereafter you can connect any two PCs in the world in about 35 seconds What makes GoToMyPC better than pcAnywhere is that no static IP address is needed to make the connection What makes GoToMyPC better than Citrix or Terminal Server is the product is very inexpen
200. nternet is a quick source for viruses and pornography However it is possible to prevent viruses and block pornography recommend that you purchase and install Norton Antivirus protection or some other virus protection product for about 16 also recommend that you purchase a SonicWall firewall device or some other firewall device for about 242 The SonicWall device will protect against Internet viruses and for an additional monthly fee will block all pornography It is also wise to upgrade your Windows operating system and Office applications with the latest security patches and adjust your security levels to high 7 Fear Fraud Fraud is definitely a problem or so hear After 15 years of purchasing the bulk of our purchases I ve never encountered fraud and have only encountered a problem a couple of time But because it is harder to hide when conducting fraud from a retail location retail is a little safer bet You can hedge your bets by purchasing only from well established internet companies Pricegrabber com has thousands of them am wary when purchasing on eBay because anybody can get online and sell through eBay immediately but do use eBay anyway Often my neighbors family and friends ask me to find good prices for them They know that have the high speed internet connection and a stellar command of the Internet search tools needed to locate their item at the best prices possible At least they know where the ba
201. o save money and improve the quality of their communications If you prefer a different service other than Skype or maybe you think Skype is a bit too expensive consider these Skype alternatives 1 ooVoo Free 2 way video chat Share documents while on a video conference Built in video effects Record video conferences 1 000 minutes of online storage Desktop sharing Try all premium features free for 30 days Full product pricing S40 month OME DOWLOAD HAO TO CuSO FEATURES amp PRICING BUSINESS ee LET THEM SEE WHO THEY VE BEEN MISSING Amazingly simple crystal clear video chat r Download free ooVoo i gt r s E Way vide al ahiraye hes J ry all premiami brais tis rp How to ooVoo What do meed to use ooVoo Save me aod money only brave when i need inl i j f Su mos Hine mi predocines madhngs aang looe4o lace A Internet Protected Mode On i Kian Copyright April 2010 J Carlton Collins CPA all rights reserved 40 High Tech Communications www CarltonCollins com 2 SightSpeed Mac and Windows app offering unlimited free PC PC VoIP calls unlimited free PC PC video calls 9 way video conferencing Reduced rates for PC landline cell phone calls Also features video blogging capabilities SightSpeed j BUSINESS SUPPORT COMPANY A Service of Logitech Inc AWARD ighest Quali WINNING amp Richest restures SightSpeed Easiest to Use Business 30
202. oard members of the podcasting company Odeo in an attempt to break a creative slump During that meeting Jack Dorsey introduced the idea of an individual using an SMS service to communicate with a small group a concept partially inspired by the SMS group messaging service TXTMob The tipping point for Twitter s popularity was the 2007 South by Southwest SXSW festival During the event usage went from 20 000 tweets per day to 60 000 The Twitter people cleverly placed two 60 inch plasma screens in the conference hallways exclusively streaming Twitter messages remarked Newsweek s Steven Levy Hundreds of conference goers kept tabs on each other via constant twitters Panelists and speakers mentioned the service and the bloggers in attendance touted it Soon everyone was buzzing and posting about this new thing that was sort of instant messaging and sort of blogging and maybe even a bit of sending a stream of telegrams Reaction at the festival was overwhelmingly positive Social software researcher Danah Boyd said Twitter own ed the festival Twitter staff accepted their prize for the festival s Web Award with the remark we d like to thank you in 140 characters or less And we just did On March 2010 Twitter has recorded a 1 500 per cent growth in the number of registered users the number of its employees has grown 500 percent while over 70 000 registered apps have been created for the microblogging platform according to the first emai
203. obile No monthly fee No set up fee PC to PC calls are always free SIP based P2P client in the same ilk as Skype with integrated call recording Ginkana Members signin change Language Henne Products hrnek Bury Aly Support Bleg Make Calls from Your Browser Now Now you can make calls anywhere without downloading and still save big on your phone bill Try a Sample Call Desktop and Mobile Clients Sh I r e Free Sign Up Dial 1 800 558 8355 then speak a category or use the Galor Iree IM and share nies keypad to hype the first 3 letters of a selec Hon Download For Desktop List Anywhent with No Download 4 Free 1 800 and SP cal ag Cel Gimis Sent ngm to your lt L w Rates t Landines and Mobit Download For Mobil Buy Call Out Now H mobile phone Thy amon Cal Oul for FREE Rates Creat a Gamos accor and automatically Choose pay as you go call rates recene 0 70 in Call Gui credd Talk to some one for aboul 3 minubes on ws lt Bes per minule rales available to landlines amd MEHKE lt H MON Ely te Opensky How call Skype users from Ho set up fee anywhere Leam More PC bo PC calis are abays free lt Look al your monihiy phone bill now and compare o Stt how MN yu Tou Sart Avoid high rates for long delance and inkemaliqnal SIP Devices calling Check the rates for ihe Counties you Call nowy Configure your IP Phont ATA or wHi phont to use with your GlameS account Leann More cS Use Gizmo Business
204. old online represented about 10 of the domestic market 8 24 7 Shopping Visits to a conventional retail store requires travel and must take place during business hours Internet shoppers can shop 24 hours a day whenever they feel the need to shop 9 Benefits of Online Shopping Searching or browsing an online catalog can be faster than browsing the aisles of a physical store One can avoid crowded malls resulting in long lines and no parking 10 Returns Some online companies have more generous return policies to compensate for the traditional advantage of physical stores For example the online shoe retailer Copyright April 2010 J Carlton Collins CPA all rights reserved 141 High Tech Communications www CarltonCollins com Zappos com includes labels for free return shipping and does not charge a restocking fee even for returns which are not the result of merchant error 11 Additional Information Most Online stores describe products with text photos and multimedia files Some provide or link to supplemental product information such as instructions safety procedures demonstrations or manufacturer specifications Some provide background information advice or how to guides designed to help consumers decide which product to buy Some stores even allow customers to comment or rate their items 12 Price And Selection One advantage of shopping online is being able to quickly seek out deals for items or services with
205. one without a physical presence or residency in the country Video conferencing between two users was introduced in January 2006 for the Windows and Mac OS X platform clients Skype 2 0 for Linux released on March 13 2008 also features support for video conferencing In 2008 Skype added support for High Quality Video full screen and screen in screen modes Skype audio conferences currently support up to 25 people at a time including the host Skype does not provide the ability to call emergency numbers such as 911 in the United States and Canada The FCC has ruled that for the purposes of section 255 of the Telecommunications Act Skype is not an interconnected VoIP provider On April 24 2008 Skype announced Skype on around 50 mobile phones On October 29 2007 Skype launched its own mobile phone under the brand name 3 Skypephone which runs a BREW OS Skype is available for the Nokia N800 and Nokia N810 Internet Tablets and the Nokia N900 An official free Skype application for the iPhone OS was released in the iTunes store on March 31 2009 An improved version v1 3 was released on January 19 2010 Skype and Verizon Wireless are set to launch a new service Skype mobile that enables customers to use Skype on a variety of best selling Verizon Wireless BlackBerry and Android 3G Smartphones This plan provides free Skype to Skype global calling and low rates to international landlines and cell phones Skype will be
206. ontaminate the bulb creating display artifacts hotspots or worse Copyright April 2010 J Carlton Collins CPA all rights reserved 110 High Tech Communications www CarltonCollins com 5 Bulb cost The benefit of changing the bulb lies in the fact that brightness and contrast levels are returned to a vibrant like new state However an expense of 350 for one bulb every 1 000 to 3 000 hours is a bargain and high end units will cost far more to renew 6 Weight While this may seem like a feature of interest only to the road warrior lighter projectors make for easier home and office installations Some units weigh as little Ibs though brightness is generally sacrificed to reach this compact size 7 Noise Not necessarily a specification listed on the box but this is the first thing you notice when you turn the unit on and loud whirring in the background can distract from any presentation While breaking out the decibel meter for every model on display may be problematic you can always check reviews at PC Magazine pcmag com or Laptop Magazine techworthy com to find out if your prospective projector wails or whispers 8 Connectivity Input Some projectors feature digital media slots or an attachment module which allows you to run a presentation from a Compact Flash Secure Digital card or a Pocket PC This added functionality is a bonus and can save weight and time if you eliminate the need to carry a laptop 9 C
207. ood thing Savvy shoppers will shop around if necessary but if you provide all of the information they need you will attract more shoppers and generate more sales Yeah know creating deep content is tough But it s easier for you to dig up this information than your customers Do them the favor of providing them with the information they truly need to make the decision and close the deal you won t be sorry e Can t Get Found Another common mistake web stores make is they can t get found You may have a good web site but nobody can find you For example search for tennis racquets and you will find more than 166 000 results What good is it to be number 457 Copyright April 2010 J Carlton Collins CPA all rights reserved 122 High Tech Communications www CarltonCollins com on this list not to mention being number 45 757 It s useless To yield top results your customers must be able to find you In my opinion here are the common mistakes web stores make which prevent them from being found e Lack of Understanding How Search Engines Work Search tools like Google and Wisenut visit billions of web pages and index every word on each web page including the file name title and embedded keywords When readers use these search engines to search for say toasters the search engines quickly find every web page that remotely mentions the word toasters and then scores each web page on its relevance to the word toasters A we
208. oom Some webcams can even operate wirelessly like the Linksys Wireless G Internet Video Camera allowing wireless video transmission and monitoring Once in place the camera does not need to be tethered to a PC for wireless audio and video broadcast via the Internet If there is something that you would like to monitor or display remotely a webcam makes it easy Webcams were never terribly expensive but some devices have dropped well below 15 and they are easy to connect through a USB port A piece of software initializes the camera and grabs a frame from it periodically For example the software might grab a still image from the camera once every 30 seconds The program then turns that image into a normal JPG file and uploads it to your Web server The JPG image can be placed on any Web page If you don t have a Web server several companies such as now offer you a free place to upload your images or host video conferences saving you the trouble of having to set up and maintain a Web server or a hosted Web site Many companies like CUWorld actually allow you to use their service for free video conferencing In order to send and receive audio you will also need a microphone and speakers We recommend a headset with a boom mic for clarity and convenience While webcams may seem like novelties they can serve valuable uses as teaching consulting tools or simply by allowing you to stay in close contact with distant friends or relatives Logitech
209. opping on the web most of these savings were related to travel My wife and also purchase numerous books gifts supplies and other items Copyright April 2010 J Carlton Collins CPA all rights reserved 136 High Tech Communications www CarltonCollins com over the web Not only do save money but this also saves me time A trip to the store can eat 1 to 3 hours of your time here in Atlanta but a similar trip to the web takes only 10 to 15 minutes Other benefits of web shopping include Not risking a head on collision traveling to the store Not polluting the atmosphere with my automobile s combustible engine No wear and tear on my automobile no rubber worn off my tires Not being mugged in the parking lot once there Not succumbing to impulse purchasing once am in the store ae Oa told this story in December 2001 during a conference in a Salt Lake City Utah and made my usual boastful claim that save 20 to 25 on almost everything purchase over the Internet Before could go much further a participant from the audience called me on it He pretty much insinuated that was lying or at least exaggerating He challenged me in front of the entire audience by stating that he had just purchased a German Martindale bridle for 99 and that he had searched many retail outlets before finding this great price He challenged me to do better The gauntlet had been thrown down knew that had to respond or my credibility would have
210. or all types of animations and slide transitions and enable participants to better engage by switching in or out of full screen view as they choose 9 Live Meeting allows participants to share any printable document on the fly for online review or editing With the high resolution viewer participants can zoom in or zoom out without losing the quality of text and graphics 10 Live Meeting allows participants to share control of software on your desktop without losing sight of participant feedback or text questions 11 Meeting participants can request control and presenters can quickly grant control to any participant This is useful for demonstrating a complex system such as Great Plains Software to a potential purchaser 12 Live Meeting a Question Manager that enables any of the presenters to view and respond to questions by replying to individuals or to all participants a Copyright April 2010 J Carlton Collins CPA all rights reserved 176 High Tech Communications www CarltonCollins com 13 Live Meetings interactive tools include Real Time Polls Mood Indicator Chat Annotations Whiteboard Text Slide and Web Slide 14 Internet Audio Broadcast enables presenters to stream audio over the Internet so participants only need the speakers on their PC to participate 15 Live Meeting incorporates the Microsoft Office look and feel which means that this tool is very intuitive for Microsoft Office users The presenter can even
211. osks to screen and track visitors 13 Building directory and way finding kiosk Many hospitals today utilize interactive kiosks to allow visitors to find doctor s offices departments and patient rooms This use of the kiosk alleviates some of the mundane tasks of the hospital staff and allows them to focus on the more important ones Harris County Hospital District Baptist Hospital of Miami the Children s Hospital of Philadelphia and the Cayuga Medical Center are but a few medical centers utilizing interactive touch screen kiosks with a building directory and wayfinding solutions Interactive Kiosks Solutions There are numerous different providers and the price varies greatly based on many different factors but generally start near 4 000 per Kiosk 1 SeePoint Interactive http www seepoint com default asp Used by Polaris Pfizer and Neutrogena 2 InTouch Interactive Kiosks http www intouchkiosk com index php Copyright April 2010 J Carlton Collins CPA all rights reserved 86 High Tech Communications www CarltonCollins com Microsoft Surface Microsoft s high tech coffee table shaped computer called Surface Surface is a Windows Vista powered computer placed inside a shiny black table base These machines are user friendly and have a 30 inch touch screen in a clear acrylic frame The Surface can interact with cell phones digital cameras and other physical objects wirelessly Users can interact with the machine by
212. ot be available B The era of ActiveSync 3 x is OVER Windows Mobile 5 introduces ActiveSync 5 0 which boasts a new style and new features but also Microsoft ActiveSync View Tools Help 3 Stop D Explore Synchronizing COCO Hide Details Information Type Status 4 Windows PC 2 Synchronizing 8 Contacts v Fe Calendar v v Tasks wv LI Notes E Favorites Files legacy support ActiveSync 4 0 still supports old devices but not to the same extent of Windows Mobile 5 devices In ActiveSync 5 0 device setup is easier USB 2 0 is supported music and video transfer is supported and improved error handling is integrated into the software If you gt medis are thinking of upgrading your handheld or are purchasing for the first time look for models running Windows Mobile 5 and ActiveSync 5 0 Of course ActiveSync can still be synced over a Wireless connection but first the connection settings and synchronization must be achieved through a wired or serial connection for the initial setup After partnership is established using a serial Bluetooth or USB connection open the Connection Settings dialog box and check the box marked allow network and Remote Access Service connection with this desktop computer After closing the box start ActiveSync on your device and tap the sync icon If you connected to the same Wi fi network as your host PC synchronization should commence The PocketPC will disconnect after
213. ould forward the information to others in just a few seconds 3 Interrupting don t like to interrupt people but with a phone call you never really know whether your party will want to or have time to talk when you call them 4 Being Interrupted don t like being interrupted when am deep in thought or entrenched in a task Often interruptions such as a phone call undermine my train of thought and my productivity do watch e mails displayed as received and can easily make a decision whether to respond instantly or wait until later 5 Thoughtful Responses Many reporters insist on interviewing me through a phone call rather than through e mail Sometimes they ask complex questions and want an answer off the top of my head Had they instead asked me those questions via e mail would have time to contemplate my response research some facts and figures to support my response and craft my response in the best possible light If the reporter s intentions are to catch me off guard to gain a poor response then a phone call will help them achieve that goal But if they truly want quality responses e mail works better This same concept applies to other callers as well as reporters 6 Scheduling Calls I ve worked with many people who sometimes put more effort into scheduling a phone call than the actual phone call itself In some cases it took weeks for the conversation to finally happen With e mail the parties do not
214. ows you and your partners to maintain a long term virtual presence as you work posting questions updates and ideas as they strike you or as you come across problems in your work Since IM programs maintain a full record of the chat session there s no danger of missing anything or losing it just scroll up There are a couple of rules to follow for productive IM ing 1 Cut the chatter To keep things focused each person should speak only a when they have something important to add or b in response to a question 2 No frills Today s IM software comes with voice and video capabilities avatars face morphing functions multi colored fonts and more Leave those for your twelve year old daughter you re working not playing IM Alternatives to AOL s IM include private chat rooms like Campfire or even Twitter if you can resist the siren call of your friends tweets AOL Instant Messenger http www aim com a Copyright April 2010 J Carlton Collins CPA all rights reserved 102 High Tech Communications www CarltonCollins com 990 million total registered accounts majority in China VZOchat gt 550 000 Windows Live Messenger 330 million active Xfire 11 5 141 5 million total total a Messenger 248 million active registered Yahoo global users 2 to ALL Yahoo users not Instant Messaging users Google Talk unknown users Chat within Gmail iGoogle and orkut All on the web PC and Mac Claime
215. peed increase using a Netgear requires a separate radio frequency chain and analog WIMAX WPN824 router with Smart MIMO technology to digital converter for each MIMO antenna which translates to higher implementation costs compared to non MIMO systems 40 MHz channels is another feature incorporated into 802 11n which doubles the channel width from 20 MHz in previous 802 11 PHYs to transmit data It can be enabled in the 5 GHz mode or within the 2 4 GHz if there is knowledge that it will not interfere with any other 802 11 or non 802 11 such as Bluetooth system using those same frequencies WiMAX Linksys WRT300N WiMAX Worldwide Interoperability for Microwave Access is a telecommunications technology that provides fixed and fully mobile internet access The technology provides up to 30 Mbps in real world end user throughput WiMAX is based on the IEEE 802 16 standard also called Broadband Wireless Access WiMAX offers an acceptable alternative to cable and DSL Because of it s ability to span long distances up to 34 miles and deliver data at 1 gigabit per 1 Uy 2 second WiMAX is dramatically superior to the previous wireless standards such as a dpi and even n On May 7 2008 Sprint Nextel Google Intel Comcast Bright House and Time Warner announced a pooling of an average of 120 MHz of spectrum and merged with Clearwire to form a company called Clear The new company hopes to
216. presented by anyone before arrived at this conclusion by myself Further have been arguing this idea for the past three years to thousands of businesses who attend my lectures So far no one has even attempted to challenge my premise Please allow me to make my case with the following lines of thinking Suppose that Good Growth Inc is in need of a good international tax advisor Good Growth s management turns to the Internet in search of a list of international tax advisors and relevant information pertaining to international tax strategy and law Presented below is a discussion about two hypothetical consulting firms that both offer international tax consulting ABC Consultants and XYZ Consultants ABC Consultant s web site is a basic web site that contains the same information in the firm s 4 panel fold out printed brochure The information clearly states that the firm offers the following 15 services 1040 tax preparation 1120 tax preparation state tax preparation fiduciary tax preparation 1065 tax preparation client write up services compilation services financial review services audits international tax consulting SBA loan applications etc In this example because international tax consulting is a mere bullet on the web page ABC s web site does not rank very high as a result of a web search on the term international tax consultants In fact Google returns 298 000 web site hits and ABC Company s web site is number 49 300 o
217. pril 2010 J Carlton Collins CPA all rights reserved 74 High Tech Communications www CarltonCollins com generic in nature These groups add a unique element to the networking site in that it provides connections on a more personal basis Professionals are more likely to want to connect with you online if they are somehow connected with you in life These groups may include alumni associations greek affiliations professional societies sports team connections etc These groups also allow for professionals to post job openings or answer questions concerning a professional hardship The connections made through LinkedIn Groups may be more beneficial than an unknown connection Polling The newest LinkedIn feature is LinkedIn Polls still in alpha Mobile Linked In A mobile version of the site was launched in February 2008 which gives access to a reduced feature set over a mobile phone Basic Account Upgrade Welcome Carlton Collins Add Connections Settings Help Sign Out Linked ing Home Profile Contacts Groups Jobs Inbox 40 More People g Advanced Learn what your customers want with Online Surveys amp Polls INDOX 40 unread People You May Know Robin Lynch Invite Ann Smith Book signing for my new book take action Real Esinte Professional Trey James Invitation to connect take action v senntnnenntnntnntnniennenenennnitneneennnnnenvinnenenennnnninniennenennniseneeseanreneneeneni Nancy Cohen CPA CITP Bill Mo
218. profile s URL to be your actual name To strengthen the visibility of this page in search engines use this link in various places on the web For example when you comment in a blog include a link to your profile in your signature 4 Enhance Your Search Engine Results In addition to your name you can also promote your blog or website to search engines like Google and Yahoo Your LinkedIn profile allows you to publicize websites There are a few pre selected categories like My Website My Company etc If you select Other you can modify the name of the link If you re linking to your personal blog include your name or descriptive terms in the link and voila instant search engine optimization for your site To make this work be sure your public profile setting is set to Full View 5 Perform Blind Reverse And Company Reference Checks LinkedIn s reference check tool to input a company name and the years the person worked at the company to search for references Your search will find the people who worked at the company during the same time period Since references provided by a candidate will generally be glowing this is a good way to get more balanced data Companies will typically check your references before hiring you but have you ever thought of checking your prospective manager s references 6 Increase The Relevancy Of Your Job Search Use LinkedIn s advanced search to find people with educational and wo
219. provides a device that will quickly display all deleted messages For example this could be used by a parent to determine if a child is making drug deals or having inappropriate conversations about sex See a video clip here http www youtube com watch v nmBzBJYkmnU amp feature player_ embedded Solutions For Protecting Your Cell Phone And Cell Phone Calls Given the current state of security surrounding the use of cellular phones there is plenty to worry about However there are some measures you can take to protect your cell phone s data and your cell phone conversations and text messages The number one measure you can take is to use third party products to secure all of your cell phone calls For example British based CellCrypt offers software for the Nokia BlackBerry and Windows Mobile smartphone You will have to make a few extra clicks each time you initiate a call but this will enable you to make secure calls over the 3G 2G or Wi Fi data network This solution completely bypasses the cellular networks by using its own central switch As a result your cellular conversations are encrypted using strong Encrypted Mobile Content Protocol EMCP www CellCrypt com Another popular cellular phone encryption solution is Gold Lock 3G This is an encryption product which the company claims is used use by government leaders international business executives intelligence officers and law enforcement agencies around the world The produ
220. public are comforted somewhat because PowerPoint draws the audience s eyes more toward the screen and away from the presenter In this manner the reluctant presenter Copyright April 2010 J Carlton Collins CPA all rights reserved 195 High Tech Communications www CarltonCollins com does not feel quite as nervous PowerPoint is also a great platform for presenting pictures and charts which plays into the old adage that a picture is worth a thousand words Of course death by PowerPoint is an all too frequent occurrence at many conferences and presenters should be mindful to avoid boring their audience to tears with dozens of slides Presenters should also avoid building slides which contain complete sentences because this often results in the presenter simply reading the slides to the audience a situation which always comes across negatively As a general rule use one PowerPoint slide for every five minutes of lecture In conclusion PowerPoint is a great tool which helps you deliver information As we have learned PowerPoint is not only good for live presentations but it also is useful for developing and delivering presentations through e mail the web and even the printed page Copyright April 2010 J Carlton Collins CPA all rights reserved 196 High Tech Communications www CarltonCollins com uA Ne i The Amazon Kindle Chapter 24 Copyright April 2010 J Carlton Collins CPA all rights reserved 19
221. r Like Embrace Dead Air Dead air is your friend Unfortunately your natural inclination is to believe that dead air makes you look like you don t know what you are talking about that s why your brain subconsciously fills in the dead air with UMMM You Know or Like Instead stop mid sentence let the dead air fill the room stare down the audience then continue Change Voice Inflection Try speaking softly or boldly for a change of pace Set Up Your Topics Tell the audience that the next topic they are about to hear will be the most important topic they hear all day After that tell them you were just kidding about the last topic but this next topic really is the most important Quadrant Techniques Use some of the various teaching techniques from each quadrant to appeal to the entire room Names ask participants their names when the ask you a question then remember that name and refer back to that name throughout the day when appropriate to do so Read Your Audience If they start to dwain tell a story or a joke change the subject ask a question bring them back from the dead that is YOUR job Repeat Questions so everybody can hear the question Copyright April 2010 J Carlton Collins CPA all rights reserved 22 High Tech Communications www CarltonCollins com Non Verbal Communications Chapter 4 Copyright April 2010 J Carlton Collins CPA all rights r
222. r a flat rate for rental of the floor space or a percentage of the monthly revenue generated by the machine 11 Many Diverse Uses Many business and organization use Kiosks to provide information or to communicate with customers Here are a few examples a Disney Disney has unattended outdoor ticketing kiosks b Amtrak Amtrak has automated self service ticketing kiosks c Busch Gardens Busch Gardens uses kiosks for amusement parks Copyright April 2010 J Carlton Collins CPA all rights reserved 85 High Tech Communications www CarltonCollins com d Cruise Ships Cruise ships use ticketing kiosks for passengers Hertz Hertz provides Kiosks for auto rentals as do Alamo and National f Churches Non profit organizations Church facilities and other corporations use a giving kiosk to accept funds donations tithes offerings at the self serve kiosk g Movie Ticket Kiosk Many movie theater chains have specialized ticket machines that allow their customers to purchase tickets and or pick up tickets that were purchased online 12 Visitor Management And Security Kiosk Visitor management and security kiosks are used to facilitate the visitor check in process at businesses schools and other controlled access environments These systems can check against blacklists run criminal background checks and print access badges for visitors School security concerns in the United States have led to an increase in these types of ki
223. r calls may be vulnerable as they are transmitted between networks as illustrated below When you place a Your encrypted Your decrypted Your encrypted cell phone call call is received call is received by call is received your cell phone by your network the next network and decrypted by automatically where it is encrypted and a your party s cell encrypts the call decrypted and transmitted to phone and transmits it to sent to the next l your party your network network Because your cell phone call is typically un encrypted as it is passed from one network to another it is potentially vulnerable as a corrupt network employee could conceivably intercept your call Reportedly the cellular networks have controls in place to monitor and prevent such abuse Further complicating matters is the possibility that your cellular phone calls may pass through multiple network points which is often the case when cell phone calls are made in Europe In this situation cell phone calls are routed from one country s network to another as they makes their way across Europe providing multiple opportunities for a breach of privacy Copyright April 2010 J Carlton Collins CPA all rights reserved 153 High Tech Communications www CarltonCollins com Encryption Codes Cracked Until recently your cell phone calls have been encrypted between your cell phone and your network and your calls were considered to be safe from most of the world This i
224. re have you been and how are things 48 minutes ago Comment Like See Wall to Wall Grant Raeside So we have laws forbidding telemarketers to call us at home but what laws do we have about people knocking at your door selling just about anything At least be a Boy or Girl scout selling candy or cookies 56 minutes ago Comment Like Bobo De Ablo Just start screaming at the top of your lungs when open the door Priceless i 3 minutes ago Write a comment Rickey Walker Good night all Time to put the blackberry down and get some rest about an hour ago via Facebook for BlackBerry Comment Like 2 people like this Ej Applications m REO A Cynthia Morgan Boyd 2 people are mutual friends Add as Friend Sponsored Obama Urges Refinance x Obama asks homeowners to refinance 133 000 mortgage for under 729 mo Calculate new payment g Like Highlights Mobile Uploads by Alex Popham Andrea Terrill Weatherford commented on this FALL 2009 ECU Letterwinner s Weekend Go Pirates by Andrea Terrill Weatherford FSU 09 by Alex Popham g4 NFL com Players of the 7 Week posted by Andrea Terrill Weatherford G2 1 Total Randoms Andrea Terrill Weatherford is L Chat 30 P Internet Protected Mode On Copyright April 2010 J Carlton Collins CPA all rights reserved 65 High Tech Communications www CarltonCollins com Fortify your Facebook Privacy
225. rent seals or seals unfamiliar to consumers may foil this effort to a certain extent 15 Downside Although the benefits of online shopping are considerable when the process goes poorly it can create a thorny situation A few problems that shoppers potentially face include identity theft faulty products and the accumulation of spy ware Whenever you purchase a product you are going to be required to put in your credit card information and billing shipping address If the website is not secure a customer s information can be accessible to anyone who knows how to obtain it One of the hardest areas to deal with in online shopping is the delivery of the products Most companies offer shipping insurance in case the product is lost or damaged however if the buyer opts not to purchase insurance on their products they are generally out of luck Some shipping companies will offer refunds or compensation for the damage but Copyright April 2010 J Carlton Collins CPA all rights reserved 142 High Tech Communications www CarltonCollins com it is up to their discretion if this will happen It is important to realize that once the product leaves the hands of the seller they have no responsibility provided the product is what the buyer ordered and is in the specified condition 16 Tracking Habits Many websites keep track of consumers shopping habits in order to suggest items and other websites to view Brick and mortar stores also collect
226. resenting a different thinking style preference You can determine your style by completing this 120 question survey and sending it to Alpha training for evaluation http hrda co uk Resources HBDI Survey E pdf Based on this information individuals and or teams can better predict understand and improve their problem solving idea generation and communication patterns Copyright April 2010 J Carlton Collins CPA all rights reserved 18 High Tech Communications www CarltonCollins com With this information you can better prepare yourself for communicating If you know in advance the preference of the individual with whom you will be communicating you will be more effective in delivering your message because you are now delivering it in a manner that person understands Accordingly he or she will be more willing to invest their time to listen to you Herrmann s research has shown that although we clearly prefer some quadrants over others we all have access to each of these quadrants If you prefer communicating from the Experimental Quadrant your preference will tend to be to challenge established policies to think outside the box for solutions and look at the big picture On the other hand if you prefer to communicate from the Rational Quadrant you will tend to want to gather facts and look at ways to solve problems logically and you will want to make your point clearly and concisely The Feeling Quadrant will be more likel
227. respondents who answered choice x in question y Any question in your survey even open ended can be filtered The entire results section will reflect your filter choices v Cross Tab Results Cross tabulated data is useful for showing a side by side comparison of how respondents answered two or more survey questions This is a comparison of two items within one survey such as product usage and demographics to determine how they are interrelated w Share Results Let others view your results without giving them access to your account You can control which results are visible and how the results may be used x Download Results All data can be downloaded to your local computer for further analysis Take your summary results into Excel to create graphs Save the detail results to your hard drive for safekeeping y Create PDF You can export a PDF version of the results Download individual questions with comments for easier printing 11 Pricing a Pro Monthly 19 95 month to month x 1000 free responses every monthly billing cycle Responses over the 1000 are charged 05 every cycle b Pro Quarterly 59 85 covers 3 months x 1000 free responses every monthly billing cycle Responses over the 1000 are charged 05 every cycle c Unlimited Annual 200 covers 12 months x unlimited survey responses at no additional charge Copyright April 2010 J Carlton Collins CPA all rights reserved 94 High Tech Communications ww
228. resses of all devices that connect to them Many routers offer the owner an option to key in the MAC addresses of their home or small business equipment which restricts network connections to those devices only Here s how a Toset up MAC address filtering first prepare a list of computers and devices that will be allowed to join the network b Next obtain the MAC addresses of each computer or device from its operating system or configuration utility c Next enter those addresses into a configuration screen of the wireless router An example screen is shown below d Finally switch on the filtering option e Once enabled whenever the wireless router receives a request to join with the WLAN it compares the MAC address of that client against the administrator s Copyright April 2010 J Carlton Collins CPA all rights reserved 211 High Tech Communications www CarltonCollins com list Clients on the list authenticate as normal clients not on the list are denied any access to the WLAN A http 192 168 1 1 MAC Address Filter List Microsoft Internet Explorer prov MAC Address Filter List Enter MAC Address in this format 2 xe MxEXE MEX wireless Client MAC List MAC 01 O00E3S7D00EC MAC 11 fo MAC 02 MAC 12 fo MAC 03 0 MAC 13 fo MAC 04 MAC 14 fo MAC 05 a MAC 15 pO MAC O06 fr 4 MAC 16 pO MAC Ov fo MAC 17 pO MAC 08 MAC 18 ee N D OS PTE TES E E A E x OIT Onm z3 While th
229. rgains are even if they don t take the initiative to install high speed web access or learn the search tools for themselves Conclusion In conclusion am a believer in the future of web commerce because have personally made the transition to web shopping know in my heart that most of you out there would make this transition too if only you had high speed access and a good working knowledge of searching the web This being the case it is only a matter of time before we all do a sizable chunk of our purchasing online Copyright April 2010 J Carlton Collins CPA all rights reserved 138 High Tech Communications www CarltonCollins com Selling Online Chapter 15 Copyright April 2010 J Carlton Collins CPA all rights reserved 139 High Tech Communications www CarltonCollins com Selling Online Are you selling your products and services on line Are you selling them online effectively Are you selling them through your own web site through someone s else s web site or both Perhaps you would be well advised to sell online through multiple avenues including PriceGrabber Amazon Overstock and eBay Working the Web Are you using the web to communicate with your customers For example Dominos Pizza allows yo8u to track your order as it is processed The web site uses cookies so it knows what you have purchased before which makes it easy to reorder the same thing again without creating the wheel SAT 6 32 PM YOU
230. rights reserved 183 High Tech Communications www CarltonCollins com ACERT TESTE E E Microsoft Visio kriteerist kaavio2 vsd Page 1 7 ah File Edit View Insert Format Tools Shape Window Help Type a question for help A O ca SR T o BR A O 7 G m Basic Shapes H Backgrounds H Basic Shapes E Borders and Titles m Drawriag1 Microsoft Visio iE ge gde yew piet Fom Jods pape Windon tep wees B DRD E k le E lE IE E JE JE E E E E pE k E E E IE ae Custorer Touch Pont Telephone to be used i at east one ol hese ikannect Process Flow anna Task wolves use of Te Web enabied Log Tod pe TE 1 2 J 5 Receive understand n Follow up resolve and log and confirm Find a Sharer capture IE Pee as anao dioh maita Pat or Contact konrect NOR NE ETE D pote Ter and Pas wih soak ie teera Dean crore tat ate ii l jai FA Copyright April 2010 J Carlton Collins CPA all rights reserved 184 High Tech Communications www CarltonCollins com Dis Bt fier for gt B YOE A a e H E A EE SS America MAP T 7 i es ai arte ho i eo ee ce eee Be wr il PW PARGS ADR A464 r 2 ET Li gm Service Oriented Approach Data Centric Approach Smart Clients ACT PEP Optimizing the Striving for purchasing research and excellence development User Interface Logic Messages E g Web
231. ritten Skype down to 1 7 billion on its books and announced a public stock offering for 2010 to spin Skype off as a separate company Copyright April 2010 J Carlton Collins CPA all rights reserved 45 High Tech Communications www CarltonCollins com 11 12 13 14 15 16 17 18 19 20 21 Lawyers Screwed Up It was discovered that Skype s holding company had always owned the underlying peer to peer technology On September 1 2009 a group of investors led by Silver Lake bought 65 of Skype for 1 91 billion and the lawsuit was eventually settled with ownership being divided with the new investors owning 56 the original founders owning 14 and eBay retaining 30 Phone to Computer Skypeln now allows Skype users to receive calls on their computers dialed by regular phone subscribers to a local Skype phone number local numbers are available for Australia Brazil Chile Colombia Denmark the Dominican Republic Estonia Finland France Germany Hong Kong Hungary Ireland Italy Japan Mexico New Zealand Poland Romania South Africa South Korea Sweden Switzerland the Netherlands the United Kingdom and the United States A Skype user can have local numbers in any of these countries with calls to the number charged at the same rate as calls to fixed lines in the country Some jurisdictions including France Germany and South Africa forbid the registration of their telephone numbers to any
232. rk experience like yours to see where they work For example a programmer would use search keywords such as Ruby on Rails C Python Java and evangelist to find out where other programmers with these skills work Copyright April 2010 J Carlton Collins CPA all rights reserved 76 High Tech Communications www CarltonCollins com 7 Make Your Interview Go Smoother You can use LinkedIn to find the people that youre meeting Knowing that you went to the same school plays hockey or shares acquaintances is a lot better than an awkward silence after I m doing fine thank you 8 Gauge The Health Of A Company Perform an advanced search for company name and uncheck the Current Companies Only box This will enable you to scrutinize the rate of turnover and whether key people are abandoning ship Former employees usually give more candid opinions about a company s prospects than someone who s still on board 9 Gauge The Health Of An Industry If you re thinking of investing or working in a sector use LinkedIn to find people who worked for competitors or even better companies who failed For example suppose you wanted to build a next generation online pet store you d probably learn a lot from speaking with former Pets com or WebVan employees 10 Track Startups You can see people in your network who are initiating new startups by doing an advanced search for a range of keywords such as stealth
233. rs have purchased almost everything over the internet wouldn t buy furniture a bike a car a camera a boat a house office supplies airline tickets toys clothes computers books without first shopping it over the internet Unless plan to eat it right then turn to the web for most of my purchases The web saves me time it makes me a more informed consumer and it almost always saves me 20 to 25 of my purchase price Here are some of my personal examples just to share a few Best Retail Web Price i 0 Price Paid Savings Hooker Bedroom Furniture S 6000 4200 1 800 30 Electric Dog Fence S 250 180 70 28 Hotel Rooms in Paris France S 1495 995 500 33 Bass Fishing Boat S 6 200 S 4 500 S 1 700 27 Sony Camcorder S 1600 S 1 200 400 25 Kodak Digital Camera S 869 600 269 31 Delta Airline Ticket to Seattle S 1 800 429 1 371 76 Trumpet S 600 360 240 40 Fireplace Screen S 369 140 229 62 Bicycle Third Wheel S 229 129 100 44 Lego Mindstorm S 199 150 49 25 Tennis Racquet S 210 140 70 33 Childs Tennis Racquet S 100 70 30 30 Baseball Bat S 229 169 60 26 Compaq 24 inch Monitor 1 800 950 850 47 Totals S 21 950 S 14 212 S 7 738 35 As you can see by the above few examples the cost savings can be impressive These prices do not reflect savings for sales taxes which usually more than covers shipping costs In 1999 calculated that saved more than 18 000 by sh
234. run a camera so that participants can see the presenter including facial expressions hand gestures or even visual aides as shown below 7 QuickCapture 640x480 Syv 640x4807 Jv Er Take a Picture D Record a Video E7 Take a Picture Q Record a Video Top 10 Benefits of Live Meeting According to Microsoft Live Meeting can help you participate in meetings around the world at a moment s notice and at a fraction of the cost On the Live Meeting web site Microsoft lists the following top 10 benefits of Live Meeting 1 Travel Less Save time and money by meeting online and avoid all the hassles of business travel 2 Increase Productivity Spend your time wisely and avoid downtime associated with getting to and from your meetings You can meet more frequently with customers colleagues and business partners thereby increasing your business output in the same amount of time Copyright April 2010 J Carlton Collins CPA all rights reserved 177 High Tech Communications www CarltonCollins com 3 Reduce Costs By conducting online meetings online training and online events Live Meeting helps you save money compared to the cost of conducting business face to face 4 Easily Collaborate All you need is a computer with an Internet connection to conduct your online meetings Live Meeting works directly with your other business productivity applications such as Microsoft Office and Windows Messenger 5 Use One Service For Al
235. s 4 74imo Save 5 12mos 6 64 mo Save 5 42mos 12 74imo Save 15 24mos 4 49 mo Save 10 24mos 6 29 mo Save 10 24mos 441 24 mo Save 25 E 36m08 54 24 mo Save 45 36m05 35 94 mo Save 45 E 36m0s 59 74 mo Save 35 3 Next start posting your content to the web site You can use Dreamweaver Cold Fusion Front Page Word or even Excel to accomplish this task Copyright April 2010 J Carlton Collins CPA all rights reserved 126 High Tech Communications www CarltonCollins com Submitting Your Home Page to Web Search Engines Once your web page is up and running you want the world to be able to find it You perform this step by submitting your URL to the various popular search engines As an example to update the Google search engine go to the Google Web Page and click the Submit button as shown in the screen capture below All About Google atest News For Site Owners Google Connects Help and How to Search Advertise with Us searchars weith Local Basics Advanced Features FAQs AdWords premium advertising services Information Google Web Search Features Business Solutions The Google Toolbar Translation I m Feeling Lucky Cached AdSense Google Search Appliance WebSearch Google E gt Search web Free download for your Google Services amp Tools Webmaster Info IE browser Toolbar Google Web APIs Buttons PESES Ra Gooale AdSense Our Technolo Submitting your Si
236. s Customer Vendor amp Employee Setup Inventory Setup Inventory Pricing Receipts amp Adjustments Financial Reporting I Financial Reporting II Purchase Orders Bills amp Checks Sales Orders and Invoicing Cash Flow Projections Customization Month End and Year End Procedures Backup and Utilities Office Integration Excel Integration Banking Budgeting and Planning Sales Taxes A Assigned To Carlton Yogi Carlton Carlton Carlton Carlton Carlton Carlton Carlton Carlton Yogi Carlton Yogi Status Completed Completed Completed Completed Completed Completed Completed Completed In Progress In Progress In Progress In Progress Not Started Completed Not Started Not Started Not Started Not Started Not Started Priority 2 Normal 2 Normal 2 Normal 2 Normal 2 Normal 2 Normal 2 Normal 2 Normal 2 Normal 2 Normal 2 Normal 2 Normal 2 Normal 2 Normal 2 Normal 2 Normal 2 Normal 2 Normal 2 Normal Due Date 3 23 2005 12 00 PM 3 23 2005 12 00 PM 3 23 2005 12 00 PM 3 23 2005 12 00 PM 3 23 2005 12 00 PM 3 23 2005 12 00 PM 3 23 2005 12 00 PM 3 23 2005 12 00 PM 3 23 2005 12 00 PM 4 30 2005 12 00 PM 3 23 2005 12 00 PM 3 23 2005 12 00 PM 3 23 2005 12 00 PM 3 23 2005 12 00 PM 4 30 2005 12 00 PM 4 30 2005 12 00 PM 3 23 2005 12 00 PM 3 23 2005 12 00 PM 4 30 2005 12 00 PM Complete 100 100 100 100 100 100 100 100 20 25 50 60
237. s This is an easy way to create a graphical report that can be distributed to keep people updated on current status Copyright April 2010 J Carlton Collins CPA all rights reserved 188 High Tech Communications www CarltonCollins com Microsoft PowerPoint 2010 Creating Professional Presentations Chapter 23 Copyright April 2010 J Carlton Collins CPA all rights reserved 189 High Tech Communications www CarltonCollins com Introduction Communication is frequently identified as the primary key to the success of any business All businesses must continually communicate with employees customers shareholders prospects vendors etc Given this premise one should naturally ask what tools exist to help our Organization communicate better The answer is Microsoft PowerPoint PowerPoint is designed to help you convey information and it does so in a surprisingly wide variety of ways This article will broaden your perception of PowerPoint and inform you about some of the simple but powerful features that can help you use this product more efficiently The Projection System Required Myth Many people are under the wrong impression that you must use a computer and projection system to deliver a PowerPoint presentation this is not the case While PowerPoint is ideally suited for a computer projection system there are many ways in which you can deliver a PowerPoint slide show without the use of a projection system as fol
238. s and others As an auditor Mr Collins has audited businesses in the areas of health care construction distribution automobile dealerships insurance manufacturing and general business Mr Collins tax experience includes corporate individual partnership fiduciary and estate tax planning work In the area of finance Mr Collins has prepared feasibility studies and financial forecasts for nearly 300 projects seeking more than 3 billion in startup capital including field work for 80 of those projects Mr Collins is familiar with bond issues Medicare and Medicaid reimbursement and conventional financing matters As a consultant Mr Collins worked with the entire Microsoft Excel development team contributing more than 500 pages of design improvements many of which are found in Excel today Copyright April 2010 J Carlton Collins CPA all rights reserved 218 High Tech Communications www CarltonCollins com Copyright April 2010 J Carlton Collins CPA all rights reserved 219 CPE Course Evaluation Form In accordance with State Board guidelines this form is retained as a permenant record of your attendance COURSE TITLE High Tech Communications for CPAs DATE NAME COMPANY ADDRESS CITY STATE ZIP TELEPHONE E MAIL rea Instructor s Name J Carlton Collins Excellent 5 VeryGood 4 Average 3 Fair 2 Poor 1 l The Discussion Leader s knowledge of the subject matter was D D D D 2 The Discussion Leader s
239. s a public speaker Mr Collins has delivered more than 2 000 lectures in 44 states and 5 countries addressing more than 500 000 business professionals including numerous keynote lectures at national and international conferences Key awards include AICPA Lifetime Achievement Award Tom Radcliffe Outstanding Discussion Leader Award GSCPA Outstanding Discussion Leader Award and Accounting Technologies Top Ten CPA Technologists Award As a consultant Mr Collins has assisted 275 large and small companies with the selection and implementation of accounting systems Mr Collins has a Bachelors degree in Accounting from the University of Georgia is a 26 year member of the AICPA and the Georgia Society of CPAs and is also a licensed realtor At the University of Georgia Mr Collins was elected President of the Phi Eta Sigma Honor Society was initiated into the BIFTAD Honor Society was a member of Alpha Tau Omega fraternity and served three years in the Judicial Defender Advocate program At Glynn Academy High School Mr Collins was Senior Class President Class Valedictorian and received a principle nomination to Annapolis Naval Academy Mr Collins has been married for 25 years and has two children He devotes his leisure time to family travel tennis fishing snow skiing and riding motorcycles dirt and street Mr Collins is president of his home owners association participates in the Gwinnett Clean and Beautiful program and volunte
240. s back and forth You can also use Skype to send instant messages back and forth As of September 2009 there were 521 million Skype accounts throughout the world In the 3 quarter of 2009 Skype users made 27 7 billion minutes of free phone calls from one computer to another During that same period Skype users made 3 1 billion phone calls to telephones generating revenue of 185 million 1 Skype is adding about 40 million subscribers a quarter The Idea for Skype You may recall that Napster was the first peer to peer file sharing system and Kazaa was the European version modeled after Napster and was ten times bigger than Napster Both Napster and Kazaa were attacked legally because it s users could easily use those platforms to illegally share music and even movies Eventually Kazaa s developers figured out that they could use the same technology to share voice files rather than music files and Voila the idea for Skype was born Founders Skype was developed by Estonian developers Ahti Heinla Priit Kasesalu and Jaan Tallinn in Sweden with headquarters in Luxembourg One of the initial names for the project was Sky peer to peer which was then abbreviated to Skyper However some of the domain names associated with Skyper were already taken Dropping the final r left the current title Skype for which domain names were available SOLD Skype was acquired by eBay in September 2005 for 2 6 billion eBay has since w
241. s follows Copyright April 2010 J Carlton Collins CPA all rights reserved 157 High Tech Communications www CarltonCollins com 1 A proximity sensor deactivates the display and touchscreen when the device is brought near the face during a call This is done to save battery power and to prevent inadvertent inputs from the user s face and ears 2 An ambient light sensor adjusts the display brightness which in turn saves battery power 3 A 3 axis accelerometer senses the orientation of the phone and changes the screen accordingly allowing the user to easily switch between portrait and landscape mode Photo browsing web browsing and music playing support both upright and left or right widescreen orientations GPS Tracking A software update in January 2008 allowed the first generation iPhone to use cell tower and Wi Fi network locations trilateration despite lacking GPS hardware The iPhone also has a digital compass Switches The iPhone has three physical switches on the sides wake sleep volume up and down and ringer on and off These are made of plastic on the original iPhone and metal on all later models A single Home hardware button below the display brings up the main menu The touchscreen furnishes the remainder of the user interface Audio And Output One of two speakers left and the microphone right surround the dock connector on the base of the iPhone If a headset is plugged in sound is played through it instead
242. s not the case any longer In December 2009 28 year old German computer engineer Karsten Nohl announced and proved that he had cracked the encryption code used by approximately 80 of all US cell phones called the A5 1 cipher The cracked code was published to the internet allowing virtually anyone with significant technology skills to intercept most cell phone calls To fully understand the issue most major networks operate under and follow the rules produced by the GSM Global System for Mobile Communications or originally Groupe Special Mobile The GSM uses two cryptographic algorithms for security A5 1 and A5 2 stream ciphers A5 1 was developed first and is a stronger algorithm used within Europe and the United States A5 2 is weaker and used in other countries It was widely reported that the weaker A5 2 cipher was broken in theory about ten years ago however until December 2009 the A5 1 encryption had proven to be unbreakable As a result until the GSM implements new cryptographic algorithms your cellular phone calls are considered to be potentially vulnerable throughout the entire transmission While it is unlikely that your particular cell phone calls are being monitored by hackers due to sheer volume of world wide calls it is important to understand that it is at least technically possible at this point in time Is the Government Listening to Your Cell Phone Calls While most people assume that the networks operate a clean ship and
243. s plenty The wrong image can shut people down before you even begin your communications Since you want to communicate effectively often you must start with your personal image Exactly how does one convey a professional image Sure an attractive face or healthy physique helps but they not absolutely necessary to convey a professional image According to experts the simple tricks that seem to matter most are as follows Clean Nice haircut for guys or hair style for women Nice clothes that fit well Clothes that have been ironed a iS Copyright April 2010 J Carlton Collins CPA all rights reserved 24 High Tech Communications www CarltonCollins com Hand Gestures Hand gestures are a great tool for enhancing your communication and for reading between the lines to evaluate the communication of others Experts say that those people who use more hand gestures can often command greater attention from their audiences At least one expert says that we respond to hand gestures with an extreme alertness because dedicated nerve cells in our primate brain s lower temporal lobe respond exclusively to hand outlines positions and shapes Kandel et al 1991 458 59 Wow that s deep Presented below is a summary of some of the hand gestures commonly used Copyright April 2010 J Carlton Collins CPA all rights reserved 25 High Tech Communications www CarltonCollins com Presented below are a few tips for using hand gestures w
244. s slides To use this feature in the Slide Show menu click Record Narration As you speak your voice is saved as a sound clip which is associated with each slide you can re record any individual slide s narration as needed Record Narration x Current recording quality Quality untitled Disk use 10 kb second Cancel Free disk space 41941 MB on C Max record time 66483 minutes Set Microphone Level Change Quality Tip uis Adjust quality settings to achieve desired sound quality and disk usage Higher recording quality uses more disk space Large narrations should be linked for better performance Link narrations in C 4 Carlton Colins My Documents Browse Copyright April 2010 J Carlton Collins CPA all rights reserved 194 High Tech Communications www CarltonCollins com Custom Shows You can create different versions of your PowerPoint presentation and save them as custom shows For example the screen below shows how pared down my primary PowerPoint presentation which runs 90 minutes in length to create a custom 10 minute version of this presentation using only five slides With this approach can maintain multiple versions of my presentation but need only update a given slide once to have those updates automatically reflected in all of my custom shows In the Slide Show menu click Custom Shows to take advantage of this option Define Custom Show Slides in presentation Sli
245. s who view your profile will not be able to see your list of friends Please remember that your Friends List is always visible to you and your friends Neighbors Friends 524 friends Copyright April 2010 J Carlton Collins CPA all rights reserved 67 High Tech Communications www CarltonCollins com 4 Block Third Party Facebook Applications Most third party applications are geared towards personal use but some applications such as Greeting cards might be used for business reasons CPAs should know that by default third party applications such as Gifts Mafia Wars Birthday Greeting Cards etc can access any of your Facebook information This means that your name phone number e mail address street address photos videos your comments and any of your responses to third party questionnaires can be harvested for information and then used to build a profile of you and your likes and dislikes and other preferences Who knows how this information might be used in the future Even if you do not use a particular third party application it can still mine your data through your friends For example if your friend sends you a birthday card the birthday application can harvest your birthday information from your Facebook account even if you don t use that application yourself To protect your Facebook data from third party applications follow these four rules a Start by not including any personal information in your profi
246. se Level Intermediate Pre Requisites None Advanced Preparation None Presentation Method Live lecture using full color projection systems and live Internet access with follow up course materials Recommended CPE Credit 8 hours Handouts Templates checklists web examples manual Instructors J Carlton Collins CPA AdvisorCPE is registered with the National Association of State Boards of Accountancy NASBA as a sponsor of continuing professional education on the National Registry of CPE Sponsors Cie EEA amp State boards of accountancy have final authority on the acceptance of individual courses for CPE credit Complaints regarding registered sponsors may be addressed to the national Registry of CPE Sponsors 150 Fourth Avenue Nashville TN 37219 SPONSORS 2417 Telephone 615 880 4200 Copyright May 2010 ASA Research AdvisorCPE amp Accounting Software Advisor LLC 4480 Missendell Lane Norcross Georgia 30092 770 734 0450 All rights reserved No part of this publication may be reproduced or transmitted in any form without the express written consent of AdvisorCPE Request may be e mailed to marylou advisorcpe com or further information can be obtained by calling 770 842 5904 or by accessing the AdvisorCPE home page at http www advisorcpe com ASA Research and AdvisorCPE are subsidiaries of Accounting Software Advisor LLC All trade names and trademarks used in these materials are the property of their respective man
247. sive and much easier to configure and use Other comments about GoToMyPC are as follows Features 128 bit encryption Does not require a Static IP Prints to printers at both host or remote site Supports File Transfer Protocol Can adjust time out from 1 minute to 9 999 minutes 2 oe E a Copyright April 2010 J Carlton Collins CPA all rights reserved 53 High Tech Communications www CarltonCollins com 9 10 11 12 Can blank out host screen while logged in Can invite remote users to take over Accessible from wireless devices such as PDA s without synchronization or data conversion Works from any PC with Internet connectivity anywhere in the world Can link Windows computers to Apple computers One time use passwords available to foil key logging scripts Web interface requires far less set up and maintenance compared to VPNs Problem Areas 13 Multiple users cannot access the same host PC using GoToMyPC at the same time The first remote user must be logged out before another remote user can log in Pricing for Personal GoToMyPC Accounts The following pricing as of October 2009 includes unlimited remote access the ability to swap host PC s at will software and service upgrades and technical support and maintenance during operating hours GoToMyPC Pricing How Many PCs Do I Need Ifyou have 1 computer you want to access you only need a 1 PC plan Once you have installed GoToMyPC you wil
248. synchronization to Copyright April 2010 J Carlton Collins CPA all rights reserved 167 High Tech Communications www CarltonCollins com conserve battery power but you can also alter this setting by opening the Options dialog in the Tools menu HotSync Palm initially designed HotSync to work with Palm Desktop Palm s personal information manager PIM However Palm quickly realized that supporting third party desktop PIMs was crucial to convincing enterprises to accept the Pilot and its successor devices To that end Palm came up with conduits a standard technology for translating data between Palm OS based PDAs and various PIMs Today Palm s connected organizers work well out of the box with most desktop PIMs including Microsoft Outlook For enterprise users and network administrators Palm offers Network HotSync an application that lets users synchronize their organizers across a network connection The application still synchronizes only between users Palm devices and users desktop PCs but allows this synchronization across a LAN Palm also offers HotSync Server a server based application that includes a conduit for Microsoft Exchange Server which lets you synchronize multiple PDAs from one server Conduits for Lotus Notes and Actual Software s MultiMail Professional are on the way HotSync Server supports synchronization with a serial cradle a wired or wireless modem and standard RJ 45 cabling and Palm s Ethernet Cradle
249. t information an asset and reserves the right to sell it if the company changes hands While Twitter displays no advertising advertisers can target users based on their history of tweets and sometimes may quote tweets in ads Hacked On January 5 2009 33 high profile Twitter accounts were compromised after a Twitter administrator s password was guessed by a dictionary attack Falsified tweets including sexually explicit and drug related messages were then sent from the accounts Celebrity Twitter launched the beta version of its Verified Accounts service on June 11 2009 allowing famous or notable people to make it clear which Twitter accounts belong to them The home pages of these verified accounts display a badge to indicate this special status Change Of Focus In November 2009 Twitter changed the question it asks users for status updates from What are you doing to What s happening Criticism The Wall Street Journal wrote that social networking services such as Twitter elicit mixed feelings in the technology savvy people who have been their early adopters Fans say they are a good way to keep in touch with busy friends But some users are starting to feel too connected as they grapple with check in messages at odd hours higher cellphone bills and the need to tell acquaintances to stop announcing what they re having for dinner Copyright April 2010 J Carlton Collins CPA all rights reserved 81 High Tech Com
250. t it is changing the core structure of the businesses operate For example not too long ago it was common for companies to hire employees that lived locally and provide them with office space in a centralized building This meant that either the pool for hiring talent was limited to the immediate area or that large costs would be incurred to relocate employees and their families Today things are different It is now practical for companies to hire Copyright April 2010 J Carlton Collins CPA all rights reserved 175 High Tech Communications www CarltonCollins com employees who live thousands of miles away and work closely with those employees using technologies such as e mail remote access and Live Meeting to make them an integral part of the organization This means that companies can now hire from around the world in order to find the best talent at the lowest salaries Outsourcing is one example of an industry that has risen in recent years based largely on these new technologies While the media tends to discuss outsourcing in the context of losing American jobs it is true that many foreign countries have outsourced jobs to the United States The continued march of technology advancement has left millions of companies and many industries in the dust For example Wal Mart used superior supply chain technology to bury the competition and force K Mart JC Penny s and federated Department stores into bankruptcy Internet based meetings ar
251. t s notice anytime anywhere Copyright April 2010 J Carlton Collins CPA all rights reserved 178 High Tech Communications www CarltonCollins com SharePoint Team Services Microsoft Office SharePoint Designer 2007 Chapter 21 Copyright April 2010 J Carlton Collins CPA all rights reserved 179 High Tech Communications www CarltonCollins com SharePoint Designer 2010 When groups of people need to share files or information the Internet provides the best platform of all for achieving this goal This is often true even when only tow people are involved and when they are seat close together in the same building but it is especially true when large numbers of people are involved and they are located in different locations To accomplish this task you could secure a domain name and create a web site from scratch but this is not the best approach because you will need to build the web site pages hyperlinks and implement security to prevent others from accessing your information There is a better way SharePoint provides a ready to use Internet based project management platform Simply add the participants who are authorized to access the site list the tasks and you are off and running SharePoint then allows all participants to post their shared files to the SharePoint site and others can check out those files like checking out a book from the library This enables you to share files but prevents users from working on the sa
252. te g PageRank Benefits of Google How Google adds URLs Our Company More Google What s up in the lab Press Center Contact Us J 0900 J Articles Releases Zeitgeist FAQs Feedback Newsletter Permissions Targeted text ads for your site Learn more Try our latest demos in y Google Labs Jobs at Gooqle The Google Store Openings Perks Culture Pens Shirts Lava lamps See open positions Executives Company Profile Address Logos Googlers at work and play This button will take you to a form which will allow you to list up to ten URLs Within a few hours Google will crawl over to your web page and index the key words off of your web page Thereafter users of the Internet may or may not find your web page by keying in search criteria that match your key words The reason that they may not find you is simply because of volume Assume for example that one of your key words is medicine On March 25 2004 a search for the key word medicine resulted in 39 500 000 web pages which contained that word Whether or not your web page appears at the top of the list depends on luck Of course most users would refine their search For example let us assume that a user were to search for the words medicine and aspirin This search resulted in only 500 000 web pages which contains both of those words Therefore if these two words were part of your web page you would have a higher probability th
253. ted Even if the connection drops out the next connection will resume the process from that point Windows Mobile 5 0 offers users new features such as the ability to sync pictures in contacts and wirelessly sync over Bluetooth Users can easily sync media files playlists and song ratings right from Windows Media Player 10 Mobile on their desktop PC and listen to them on their mobile device The new OS adds support for integrated hard drives allowing users to carry several gigabytes of music or information right on their phone or PDA and provides added support for USB 2 0 which will greatly increase file transfer speeds and synchronization of information between PCs and Windows Mobile based devices End users now can take a picture from their phone and easily assign it to a contact for display not only in the Contacts application but also in the caller ID window and e mail message header when that contact calls or sends e mail Pictures also can be assigned on a PC in Outlook and synchronized to a user s device Basic synchronization settings also increased in the new version The user can now choose contact groups for synchronization and exclude separate contacts from the process The same is true for Calendar and Tasks To synchronize e mail you can choose folders and subfolders Fear not however because ActiveSync 5 0 supports devices that are not running Windows Mobile 5 but new features to ActiveSync like the media sync feature will n
254. terpersonal gigas relate to otha in ampaletc wAyS l hut L Muar amp flr hak Khela D uw PITAR x f head B anase F 21 High Tech Communications www CarltonCollins com Carlton s Tips for Delivering an Effective Presentation Ih 10 11 12 13 14 15 Room Set up Angle chairs so participants face the center and can see one another a little Tables Allow participants to lean forward write deal with snacks and drinks rest arms change body position prefer 2 people per 6 foot table if possible Screen As large as possible Avoid bleed through screens Project image as large as possible Projector As bright as possible use 4300 lumens 1500 lumens is not enough 2000 to 2500 will work OK with good screen and dimmed lights avoid running the projector in econo mode Timing Start on time end early The First three Minutes The first 3 to 5 minutes are crucial the audience will determine their opinion of you within 5 minutes like to teach the audience something in the first three minutes Often time instructors only to find that they are still introducing the topic 20 to 25 minutes later and have said virtually nothing of value Set Expectations tell them when you will start stop and break Tell them what your objectives are Don t say UMMM Nothing makes you looks less confident or more like an amateur than repeatedly saying UMMM You Know o
255. time favorite remote access solution that allows you to connect through a phone line or internet connection Based on The NPD Group s retail Top Selling Business Software list Symantec s pcAnywhere was the top selling remote access software product from August 1999 through April 2003 pcAnywhere s underlying technology was made obsolete by newer solutions and eventually Symantec changed the underlying programming to reflect the newer technologies For a while it appeared that Symantec waited too late as pcAnywhere was no longer a front runner in this area However it appears that many users like the 199 99 per computer cost more than a monthly fee approach and today Symantec claims on their web site that pcAnywhere is the number one best selling remote control software CITRIX Citrix has been the defacto standard for remote control solutions for many years especially for larger companies and companies who want the best possible remote access performance However Citrix is not cheap A minimal installation of Citrix will typically cost about 15 000 to 18 000 by the time you purchase the software and implement a high powered Citrix server Here are comments about Citrix Citrix 1 Allows users to securely access corporate data through a customizable interface Centralizes data management and provides a Single Point of Access for users 3 Consolidation of data provides a controlled environment for data manipulation and distribu
256. times just getting the people to hang up is a problem Don t get me wrong do believe that the telephone is a great way to communicate enjoy talking to my friends and family and hearing the sound of their voice and laughing at their jokes However when it comes to business the telephone conversation often falls short am not the only one who questions the efficiency of the telephone you might enjoy the following cartoon provide by the Oatmeal com Copyright April 2010 J Carlton Collins CPA all rights reserved 146 L The Courtesies Etiquette requires you to work through a pile of time wasters just to ask a simple question Hey Bill it s ween awhile How are you What have you been up to How age the Kids BA HA That s great Do you still have that magnificent weard V tried to gow one wut my face ends up looking like dipped my jaw in Vaseline and then gave a Raspberry to the underside of a cat Wow it s so good to hea your voice 20 minutes later So uh the Reason Vm calling is Can voRROW your Chainsaw OK Bill no pRovlem Figured it couldn t hugt to ask Well it s ween great talking to you and we should meet up for weers sometime Vd love to gaze upon that enchanting veard over a delicious weverage We don t talk much anymore you Know it s a Shame Remember when we used to Ruin and laugh together without a cae in the world like little girls on the f
257. tion 4 Resources are available through an interface on a web browser 5 Data can be accessed through any machine with an internet connection Copyright April 2010 J Carlton Collins CPA all rights reserved 55 High Tech Communications www CarltonCollins com 6 Any user who has been granted permission may access data including partners customers and employees 7 Citrix can transfer all types of data including internet sites file shares documents and streaming media 8 The user interfaces can be tailored to the needs of specific user types 9 Available for sale from resellers since it was designed for the data management for large corporations Microsoft Windows Terminal Server Aw Windows Terminal Services Microsoft Terminal Server functions similarly to Citrix but typically costs about 30 to 70 less to implement While many Citrix installers argue that Citrix performs better that Terminal Server many users who have used both report that there is either no difference in performance or that Terminal Server performs faster Presented below are comments about Windows Terminal Server 1 Included in Windows NT Windows 2003 Server Windows XP Server Windows Vista Server and Window System 7 Server operating systems 2 User has remote desktop control capabilities 3 The host computer sends screen images to the client or remote access user 4 Because recently used files on the host are spooled to RAM
258. tion many take many minutes Likewise when the remote user saves the 50 megabyte word document the entire 50 megabyte Word document must travel back through the internet connection to the host computer once again taking many minutes There are still instances where VPN connections offer advantages but for most users the remote control solutions offer faster performance which also allow the users to utilize a cheaper less powerful computer for remote access purposes Copyright April 2010 J Carlton Collins CPA all rights reserved 57 High Tech Communications www CarltonCollins com Electronic Forms There is a great deal of attention paid to the process of scanning working papers documents and contracts into electronic format in pursuit of a paperless work environment and rightfully so as there are many advantages to this approach However there is far less attention paid to converting your paper based forms to a paperless environment This article focuses on the many benefits of adopting paperless solutions for the purposes of automating the data collection function in your organization aper based time sheets expense reports and other forms are old school there is a better approach to collecting tabulating and reporting data Today s tech savvy CPAs prefer to use electronic forms which can be e mailed to recipients accessed from the web As users complete and submit these electronic forms the information is automat
259. to come running If your web site provides only sales information and no answers to common questions no insights no examples and no hints tips or war stories then it will not be very effective A person searching for an international tax consultant would spend a great deal of time on your page if it contained links to the following o Click here for the Top Ten International Tax Planning Mistakes corporations make o Click here for four cases studies featuring tax planning strategies for a small medium large and Fortune 500 companies o Click here to read about several fraudulent tax strategies that some consultants employ that could land you in jail Copyright April 2010 J Carlton Collins CPA all rights reserved 119 High Tech Communications www CarltonCollins com o Click here to read about current bills in congress which could affect your International tax planning strategy o Click here for more good links to International Tax Planning Information on the Web Certainly an interested party would spend time reading and printing this material another good reason to have your name and address on every page The idea is to provide such a good site for relevant information that the user bookmarks your site so they can easily come back to it After all how many times has a person found a good site and then later was unable to find that site again Keep your Web Site Current People can tell when a web site is out of date
260. to Pro Unlimited annual in order to view additional responses Collect responses via weblink m Collect responses via email AS a e HO ao o E Copyright April 2010 J Carlton Collins CPA all rights reserved 92 High Tech Communications www CarltonCollins com Create Up to 3 Collectors per survey View live results as they are recorded Browse through individual responses View open ended comments from the Response Summary page opop 10 Upgrade to Pro or Unlimited Upgrade your basic account to Pro at any time and all surveys created during the Basic status will be upgraded The following professional features can then be applied to those surveys a No Limits Surveys can have an unlimited number of questions You are not charged extra for long surveys Create as many surveys as you want b Create Surveys in Any Language You can create your survey in any language even multi byte languages such as Chinese and Arabic All text and buttons in the survey can be customized for the respondent s native language c Create Surveys from Templates Over 50 survey templates are provided to jumpstart your survey design d Select from 15 Question Types We support everything from multiple choice to rating scales to open ended text e Validate Require Survey Responses Validation options allow you to require a particular number of answers or validate the text that is entered You can also make survey questions mandator
261. to be copied Presentation1 ppt l dd Files Linked files and the PowerPoint Viewer are included by default To change this click Options Copy to Folder Copy to CO Options Copyright April 2010 J Carlton Collins CPA all rights reserved 191 High Tech Communications www CarltonCollins com E Mail Of course we should not overlook the fact that PowerPoint slide shows can be e mailed directly to a recipient or group of recipients PowerPoint provides this capability from the File menu as shown below Properties Ge Mail Recipient as Attachment 1 http jie accountingsoftwaready Routing Recipient 21 J4CCRAC Partnership 2003 Gre Exchange Folder Advancing Slides Tip When delivering a PowerPoint presentation you already know the left mouse button will advance the slide show with each left mouse click However as a default the right mouse button pops up a menu rather than displaying the previous slide This can result in an awkward moment in the presentation when the presenter truly wants to slip back to the previous slide Instead of fumbling with this dialog box find it is better to set the presentation to display the previous screen on right mouse click To do this in the Tools menu select Options select the View tab and clear the Popup menu on right mouse click box as shown below Options Securty Spelling and Style General Edit Print Show if Startup Task
262. to connect through the corporate LAN In day to day use I ve found HotSync to be almost bulletproof The only problems I ve encountered with the product result from HotSync s methods for mapping fields from the PDA s built in databases to fields on the desktop PIM These problems are usually minor and inconsequential For example the mapping process might change delimiters e g quotation marks in names In some cases a PDA s space limitations might cause HotSync to truncate long notes Intellisync If your company uses Pocket PCs and a different PIM or groupware application than Outlook your users will need a third party add on to provide synchronization Of such products Intellisync is the most popular Intellisync runs on both Palm and PocketPC platforms and synchronizes with a range of PIMs and enterprise email and groupware products including various versions of Outlook Schedule and Exchange Server Symantec s ACT Lotus Organizer and Lotus Notes Novell s GroupWise Interact Commerce s SalesLogix and Palm Desktop Software Intellisync s power lies in its flexibility The product lets the user select different desktop software with which to synchronize each of the PDAs built in databases For example you can synchronize contacts with ACT the calendar with Outlook and email with Lotus Notes Intellisync also lets the user modify how desktop application fields map to the PDA a feature that both HotSync and ActiveSync lack Copyri
263. to news stories about companies with international tax problems A list of links to other relevant international tax information O CON DU BWN FE Copyright April 2010 J Carlton Collins CPA all rights reserved 133 High Tech Communications www CarltonCollins com As a result XYZ s web site ranks high in Good Growth s search and is found When Good Growth s management accesses XYZ s web site they shout halleluiah we ve hit the mother load The company proceeds to immerse themselves in the XYZ web site printing pages for their own use and forwarding other pages to their colleagues Having found many of the answers they were searching for the folks at Good Growth stop their web search and concentrate on the XYZ material They find the materials very informative and useful They conclude that XYZ is a firm that has the expertise they were looking for They end up calling XYZ and engaging their services In this case having multiple web sites enabled XYZ to make the right impression and land the customer The web can be a cold environment and you usually have only a few seconds to make a good web impression Companies wishing to promote their goods and services via the web need to provide separate web sites for each service and product in order to accomplish this most important objective It is important to note that once a company has created one web site the second third and forth web sites are really quite easy The infrastructur
264. tom Animations By selecting the Slide Show menu and clicking on Custom Animation you can create motion paths that cause text and pictures to move across the screen However a rather professional effect can be achieved by using a motion path on an object larger than your slide such as a photograph In the example presented in Figure 1 3 have inserted a picture of clouds which is larger than the slide and applied an animation in which this image crawls slowly across the screen When displayed the text remains stationary as the background image seems to slowly float by This illusion makes this slide play more like a movie and results in an interesting affect Copyright April 2010 J Carlton Collins CPA all rights reserved 193 High Tech Communications www CarltonCollins com E Microsoft Poworloind Piroientationt ge Edt ye jem Poma Do Side Show Weie Hel Aria igh amp Aa a OD Bm Bt Cartton s Budget for 2004 Tamm m d a kek io add nobts gt HET z T Tener e ACHE ET O O EL Erupe 11 5 Recording Narration Once you have completed your PowerPoint presentation you can run the slide show on your computer and use a microphone to record your comments advancing the slides as you speak The resulting product is a self running slide show complete with your voice embedded in the presentation This file can then be sent to others who can view the slide show and hear your voice walk them through the variou
265. tomatically link to and update the pricing description pictures and inventory quantities on hand of your web site on a real time basis Does your accounting system provide your employees access to human resource functions so they can adjust their withholdings request vacations or move money around in their retirement funds online Does you accounting system send your customers periodic e mails advising them as to deliveries in progress Do your asset and resources report back to your accounting system critical information such as a coke machine reporting how many drinks have been sold or a truck reporting how the average speed or how many hard brakes have been applied Copyright April 2010 J Carlton Collins CPA all rights reserved 116 High Tech Communications www CarltonCollins com Developing an Effective Web Site Overview Today building a web page is as easy as choosing File Save As from the main menu Most of today s applications will save your document automatically to a web page format HTML format By far the most difficult parts of creating an effective web site are organization layout and content The approach will depend on your objective For example if your web site is intended for use on the Internet to attract new customers you may have a different strategy than the Information Systems person who is posting a corporate web site internally on the Intranet As a starter let us assume you want to attract ne
266. ufacturers and or owners The use of trade names and trademarks used in these materials are not intended to convey endorsement of any other affiliations with these materials Any abbreviations used herein are solely for the reader s convenience and are not intended to compromise any trademarks Some of the features discussed within this manual apply only to certain versions of Office and from time to time Microsoft might remove some functionality Microsoft Office is known to contain software bugs which may prevent the successful use of some features in some cases AdvisorCPE makes no representations or warranty with respect to the contents of these materials and disclaims any implied warranties of merchantability of fitness for any particular use The contents of these materials are subject to change without notice Instructor Contact Information J Carlton Collins Carlton ASAResearch com Copyright April 2010 J Carlton Collins CPA all rights reserved 3 High Tech Communications Main Web Site Accounting Software Web Site Technology Advice Web Site Mirrored Web Site Accounting Software Feature Reports Accounting Software Advice Web Site Top Accounting Software Consultants Accounting Software News Web Site QuickBooks Web Site CPE Information Web Site Miscellaneous and Example Web Site Microsoft Excel Web Site Microsoft Accounting Systems Web Site Microsoft SBA Web Site Microsoft Office Web Site Web Sites Maintained by
267. ust a few of the international Tax Consulting links we hit in the example above The reader will most likely continue to scroll down the hit list until they find a hit that is most relevant to the search based on the brief description Some search engines require the user to provide a summary at the time the URL is submitted to the search engine while others simply use the first few lines of text in the home page as the summary Either way you want your summary read as if it is right on point with the users needs As mentioned above it is impossible to accomplish this with just one web page To be effective you must create a specific web page for every service or product Copyright April 2010 J Carlton Collins CPA all rights reserved 118 High Tech Communications www CarltonCollins com group your company offers The good news is that it costs very little extra in terms of hard dollars to create 50 web pages compared to just one web page Only time and effort is involved Conclusion Your summary should be well written and to the point to attract prospects to your site Don t Chase the Prospect Away Let us assume that your web page has ranked high in a search list and the user has clicked on your link You can inadvertently chase them away if you make them wait too long for the web page Common mistakes are locating your web page on a slow web server such as those provided by America On Line adding large graphic images that take too
268. w CarltonCollins com Mw 7A EN gt E i DAE OORRERKRRER Microsoft Office InfoPath 2007 Chapter 11 Copyright April 2010 J Carlton Collins CPA all rights reserved 95 High Tech Communications www CarltonCollins com Coley Microsote _ Office InfoPath Microsoft Office InfoPath 2010 is an information gathering program Using Office InfoPath 2010 you can create and deploy electronic forms solutions to gather information efficiently and reliably You can also use the InfoPath Forms Services capabilities in Microsoft Office SharePoint Server 2010 to extend your business processes beyond your corporate firewall delivering forms as Microsoft Office Outlook e mail messages Web browser forms or forms for mobile devices Gather Information Efficiently And Reliably Office InfoPath 2010 makes information gathering more efficient by delivering electronic forms that reach the necessary participants reduces redundant data entry and improves the quality of the data collected InfoPath forms help you reach more users by providing an easy form fill in experience across Web browsers e mail messages or mobile devices i alnlobath Bi x Ee Gat Yew peet Format Toots Toe Helo Subject InfaPach form expensereport iradem H erma epa Sm the new pet eoni form You can naw All hs oat and pe it back to me retad of the old paper for Thika Employee Information Manager
269. w CarltonCollins com There is also a tool called Directory that allows you to search for businesses Show below have searched for restaurants in my area 4 Directory restaurant norcross Zy Search Recommend a business 2 results Sortby Mostrelevant v Dagwoods Pizza ireview OF 7746 Spalding Drive Spalding Dr and Holcomb Bridge Norcross C0417773 oe 1 R s Log House Restaurant 6601 Peachtree Industrial Blvd Norcross CFI 4406 496 ko Remember you can contacts up using either their Skype address or their telephone number 3 Configure Your Skype Settings There are numerous setting adjustments you can make a few of the more important ones are listed below a Setup your profile information so people can find you Tune your microphone using the audio settings c Set up your video and screen sharing to receive and send automatically when connected to people in your contact list I would not recommend that you set your video to automatically send or receive from anyone d If needed adjust your webcam settings brightness contrast flicker etc Check the box labeled Start Skype when start Windows f Adjust your privacy settings to only receive phone calls from people on your approved contact list g Add anyone your wish to your blocked contacts list under privacy to prevent them from contacting you h Ihave my system set to answer incoming calls automatically That way can connect and view my
270. w and trust in business The people in the list are called Connections Users can invite anyone whether a site user or not to become a connection This list of connections can then be used in a number of ways as follows 1 A contact network is built up consisting of their direct connections the connections of each of their connections termed second degree connections and also the connections of second degree connections termed third degree connections This can be used to gain an introduction to someone a person wishes to know through a mutual trusted contact 2 It can then be used to find jobs people and business opportunities recommended by someone in one s contact network 3 Employers can list jobs and search for potential candidates 4 Job seekers can review the profile of hiring managers and discover which of their existing contacts can introduce them The gated access approach where contact with any professional requires either a preexisting relationship or the intervention of a contact of theirs is intended to build trust among the service s users Groups The searchable LinkedIn Groups feature allows users to establish new business relationships by joining alumni industry or professional and other relevant groups LinkedIn groups can be created in any subjects and by any member of Linkedin Some groups are specialized groups dealing with a narrow domain or industry whereas others are very broad and Copyright A
271. w customers and sell products or services over the Internet et us start by considering the old company brochure This document was used to describe the company and summarize the products or services sold Now imagine that your brochure is one of two thousand similar brochures on display at the airport available to arriving passengers How is your brochure going to catch their attention over the other 1 999 brochures What if your brochure is difficult to read because the font is too small too large or busy Where is your brochure located on the display at eye level or on the bottom row This image paints a similar image of the problems associated with creating an effective web site This session features a discussion of some strategies you can employ to make your web site as effective as possible Get Found The first problem to overcome is being found on the Internet To play this game properly you need to understand exactly how search engines index your web pages and rate them The specific algorithms used to rank the web pages found in a search vary from one search engine to another and even vary within the same search engine over time However in general if all of your search words are contained in the title of the found web site that site is generally ranked extremely high If only a portion of your search words are contained in the title then the resulting rank is a little lower If your search words are contained only in the
272. ware You can hook into any other VolP provider that uses SIP Also offers SMS video chat and instant messaging Copyright April 2010 J Carlton Collins CPA all rights reserved 43 High Tech Communications www CarltonCollins com WEN QGOrtove download Wore miy wirit A single application to talk chat and share for free with anyone e Sei mp yes m Vien IM acount 24 D Chai with all Cal everone bessen gr WengoPhone 2 1 4 F Download ieam more gl ippa You wonder how to learn Spanish An Internet Protected Mode On Make cheap calls With your WengoPhone take advantage of low FES b Call Lanes Gi bHiphings Check out our ken abes 10 Vbuzzer Soft VolP Windows app offer free calls between Vbuzzer users and reduced call rates to landlines Also offers instant messaging Phone to PC calls are just 2 per month Make calls from internet browser of your cell phones Supports PBX systems Schedule and manage conference calls for 10 month Supports callbacks amp Len Snup Foum Engh WBEUZZER TOY Services Business Rates Download Account Help Viburrer EEE r VelP Busingss Solutions Set A Digital Pnones amp Premium Features with 6x8 vaP Sobubions maa genial mer Voip Experte increase profits great mgt tool Free Quote Call 678 nts LEE PIH aia y Cooke Mobile VolP Software oak anl beg phe phones fo make VolP calls over 2G oF WiFi n
273. was the world s largest manufacturer of mobile phones with a global device market share of 39 4 followed by Samsung 17 3 Sony Ericsson 8 6 Motorola 8 5 and LG Electronics 7 7 These manufacturers accounted for over 80 of all mobile phones sold at that time Copyright April 2010 J Carlton Collins CPA all rights reserved 152 High Tech Communications www CarltonCollins com How Secure are your Cellular Phone Calls In December 2009 the encryption method used by most cellular phone companies was decoded and the instructions for intercepting wireless cell phone calls were published to the Internet for all to see Many claim that your cellular phone calls were vulnerable even before this crack occurred Exactly how secure is your cell phone Can your cellular phone calls be intercepted by others Do land lines offer a more secure form of communication Should you avoid discussing sensitive information over a cellular line This article addresses these questions and provides advice for ensuring that your cellular phone calls remain protected How Secure Are Your Cell Phone Calls t Historically your cell phone calls have been secure encrypted between your cell phone and your cellular network However a vulnerability typically occurs when you call another party on a different cellular network In this situation your cell phone call is usually encrypted and decrypted as it is passed from one network to another therefore you
274. which is still the American League record for a left handed pitcher 6 hours ago clear Wall Info Photos Video Notes fTravelMap What s on your mind Attach a J hg Q Options Carlton Collins Babe Ruth had a lower lifetime earned run average than Cy Young Whitey Ford or Sandy Koufax During his early years with the Red Sox Ruth pitched nine shutouts in a season which is still the American League record for a left handed pitcher 6 hours ago Comment Like Grant Raeside And eating the most hot dogs before after and during a game 3 hours ago Delete Linda Baker I did not know that 4 2hours ago Delete Write a comment Carlton commented on Diane Futch Johnson s photo 5 Carlton and Jim Elliott are now friends Comment Like G3 Carlton commented on Bill Amos s link P Carlton likes Bill Amos s link p Carlton likes Terry Brock s album Wall Photos po Carlton likes Leigh E Smith s photo 5 Carlton and Mike Wells are now friends Comment Like Carlton commented on Joe Pechin s status Create an Ad Snowshoe Condo x Auction Sun Oct 18 at 2pm 16 fully furnished condos 1 877 668 5397 studio 1 3 bdrm units slopeside Silver Creek Resort www motleys com g Like Create an Ad on Facebook Facebook Ads Rm m Reach over 250 million active users on Facebook Learn how to connect your business to real customers through Facebook Ads g Like Play Now L Chat 32
275. y for your respondents to answer f Randomize or Sort Your Question Choices To help minimize ordering bias you can automatically randomize the choices in your questions If you have a long list of items you can sort them automatically g Create Skip Logic Conditional Logic You can customize the path a respondent takes through your survey by adding skip logic This eliminates unnecessary confusion by skipping non applicable questions It isa proven way to reduce drop outs and overall frustration h Add a Logo Branding your survey can give your survey a professional feel You can use any logo up to 50K in size at the top of every page in your survey i Create Custom Themes Every element of your survey can be customized such as fonts sizes and colors After creating your own custom theme you can apply it to all your future surveys j Create PDF You have the ability create a printable PDF version of your survey k Fully Accessible and 508 Compliant All standard survey designs are accessible and 508 certified and compliant for respondents with disabilities Unlimited Number of Collectors You can collect responses from multiple sources simultaneously and open and close each collection method individually without having to close the entire survey m Set Collection Restrictions You can set a max response count or a cut off date for your survey You can require a password or even restrict responses by IP address
276. y protect the privacy of your photos you must visit each photo album s privacy settings and make the appropriate adjustments To do this select Photos Album Privacy from your Profile Page and make the appropriate adjustments as shown in the screen below Copyright April 2010 J Carlton Collins CPA all rights reserved 71 High Tech Communications www CarltonCollins com This way you can store your photos indefinitely on Facebook yet ensure that the only people that can view your photos are the ones who you really want to see them Family Pictures Who can see this Friends of Friends Friends of Friends Only Friends Only Me Who Can See This Friends of Friends Everyone on Facebook Friends All Friends can see this Friends of Friends My friends and their friends can see this Only Friends Only friends can see this Some Friends Choose specific friends who can see this Type the name of a friend or fi Only Me Only you can see this Except These People Type the name of a friend or fi Cancel Save this group of people as a friend list and you ll be able to use this list for easy communication and privacy control in the future 11 Avoid Your Friend s Embarrassing Wall Posts Just because you use Facebook as a business tool doesn t mean that your friends always do That s why once in a while a friend of yours might post something embarrassing or not necessarily work friendly
277. y to be more intuitive expressive and sensitive in contrast to the Organized Quadrant which focuses on plans details how things will get done and timing Copyright April 2010 J Carlton Collins CPA all rights reserved 19 High Tech Communications www CarltonCollins com Based on Hermann s theory the following teaching methods appeal best to the following quadrants of the brain Problem Solving Lectures Research Findings Handouts Bibliographies Panels Use of Experts Quiz Applied logic Analysis Theories Games Crossword Puzzles Laboratory Symposium amp Forums Case Studies Debates Textbooks Readings News Articles Demonstrations Case Studies Modeling Objective learning Checklists Worksheets Review Programmed learning Build Skills Policies and procedures Projects Field Trips Questions Who What When Where Summaries Lectures Reports D Picture Studies Brainstorm Buzz Group Visuals Illustrations Art Metaphors Skits Commercials Games Shows Videos Films Big Picture Hypothetical Develop Goals Concepts Cartoon Poems Experimentation Creativity Pull Together Discussions Possibility Thinking Exercises Self Assessment Testimonies Interaction Role Plays Videos People Oriented Cases Listening amp Sharing Ideas Sharing Personal Experiences Kinesthetic Activities Discussion Feelings Interviews Stories Music Breakout Rooms Team Projects Group Discussions

Download Pdf Manuals

image

Related Search

Related Contents

カタログ  TELEMETRO LASER COMPATTO DIGITALE RX® -1200i  Sony MDR NC10 User's Manual  ML610Q400 Series Sample Program AP Notes For SSIO  Datalogic Scanning F734-E User's Manual  Moen Chateau TL183BC User's Manual  Manual    BK 37 BK 28 BK 29 BK 37 ASME BK 28 ASME BK 29  

Copyright © All rights reserved.
Failed to retrieve file