Home
Weather Message Manual Version 3.8
Contents
1. RUSSELL COUNTY IN SOUTHEAST ALABAMA UNTIL S30 PM CST AT 455 PM CST NATIONAL WEATHER SERVICE DOPPLER RADAR INDICATED A TORNADO NEAR FOR ITCHELL MOVING NORTHEAST AT 25 MPH THIS STORM WILL AFFECT RURAL EASTERN RUSSELL COUNTY IF YOU ARE NEAR THE PATH OF THIS TORNADO TAKE COVER IN AN INTERIOR ROOM ON THE LOWEST FLOOR OR A BASEME ABANDON MOBILE HOMES AND VEHICLES FOR MORE SUBSTANTIAL SHELTER CALL 1 800 856 0758 TO REPORT SEVERE WEATHER LAT LON 3229 8514 3213 8504 3226 8492 3247 8499 The Short format allows you to select certain elements of the message to send For example if you set up your short message format as follows NWS WFO has issued a MesgType HeadLine lfCounty for Counties lfCounty County lfExpire Until Expire BulletAT Results in a message like this 455 PM CST NATIONAL FOR EAS NWS BHM has issued a Tornado Warning WEATH ER RADAR INDICATED A TORNADO N MITCHELL MOVING ERN RUSSELL COUNTY NORT EAST AT 25 MPH THIS STORM WILL AFFECT RURAL The Selected option only sends the text associated with the UGC group associated with the county that was alarmed Some messages contain multiple groups A good example is the zone forecast It contains multipl
2. U u u J J 242 Graphical Product Names LIU IU III aaa sassa qa sssauuwauaswuykuswawau aqa suasuqwaawasuutusas 244 User D fin ed Prod U I LU u M capac ede gecbsieeessdedeoscuencebesssaczee 245 Paging E Mail Formats J U u u u u u u u u 246 Publishing Data to a Web Page l U u u uu u u u J 250 2011 Weather Message Software VI Weather Message Server 8 9 10 11 12 13 Part XVIII Sending HTML Email UU uu IS aiaa anaa anaa aeaa amaa anaa eaS aaia 251 Sending Tweets using Twitter J U U U u u nunnur euneun u u u u T 252 Facebook Status Updates J UU u u u uu u u u 255 Wha tis EM WIN U I U UVVU Ta 258 What is Weather Wil ciccissciecicdaessedsstetecnsdaeasanustounceclaenseaseantecsdasadeds save deteaanteassdanseutvdaudeavelandaasa 259 What isi NOAAPORE iiss ciccscccscteiiectiscevccceacubdeiiavevcacuueat nauk snuduvaeuvadeucssnauvuvsdtvududuvuebecuvodnvvasevsead uuouuave 259 Software License 262 Index 0 2011 Weather Message Software Weather Message Server 1 1 1 1 2 Introduction Overview Weather Message Net 3 8 is a full featured weather alerting software package Utilizing data streams from the National Weather Serv
3. With each of the above messages the parse option can be used to remove and shorten some of the words in the weather text Replacement words are entered in the WxWords dat file For example to replace NATIONAL WEATHER SERVICE with NWS you would enter NATIONAL WEATHER SERVICE NWS in your WxWords file Using our short message format from above NWS BHM has issued a Tornado Warning for Russell County Until 05 30 PM AT 455 PM CST NATIONAL WEATHER SERVICE DOPPLER RADAR INDICATED A TORNADO NEAR FORT MITCHELL MOVING NORTHEAST AT 25 MPH THIS STORM WILL AFFECT RURAL EASTERN RUSSELL COUNTY 2011 Weather Message Software 250 Weather Message Server This message could be changed to NWS BHM has issued a Tornado Warning for Russell County Until 05 30 PM AT 455 PM NWS RADAR INDICATED A TORNADO NEAR FT MITCHELL MOVING NE AT 25 MPH STORM WILL AFFECT RURAL E RUSSELL COUNTY The parser is case sensitive so consider this as you setup your WxWords COUNTY will not match County Several Weather Message users have already created extensive WxWords dat libraries If you want a file that is pre loaded with words check the Weather Message Miscellaneous Downloads or send e mail to the Weather Message Yahoo group 17 7 Publishing Data to a Web Page You can send files or html to a websi
4. The Template File Name is the name of the html file that contains your template The Browse button can be used to locate the template file The program automatically defaults to WxMesgNet WxData Template for template files You can place templates in any directory The Template File Name is not required Leave this blank if you want to send the weather text without html encoding If you have not established a template file enter a name for a new template file This file will be created using the html code you specify when the Save button is clicked The Destination File Name is the name you want the resulting message to be named on your server This field is required You can use variables in the path and file name see Path File Name Variables 6 Select the Save To type Local FTP FTPS SFTP with Password SFTP with Certificate or HTTP If one of the FTP options or HTTP is selected the program will allow you to enter information about your FTP or HTTP server Enter the FTP Server address Port number User Name and Password These settings will be used to log into your server Note When using the SFTP with Certificate option you should enter your private key password in the password field Your private certificate must be saved in c Program Files WxMesgNet SSHKeys directory The file should be named as follows server name plus underscore character plus user name with the extension pem For example wxmesg com_danny pem
5. 2011 Weather Message Software 232 Weather Message Server FL WFO Miami FL WFO Miami FL WFO Melbourne FL National Hurricane Center FL WFO Miami FL WFO Tallahassee FL WFO Tampa Bay Area Ruskin FL WFO Tallahassee FL WFO Tampa Bay Area Ruskin FL WFO Jacksonville FL WFO Melbourne GA WFO Atlanta GA Southeast RFC Atlanta GA WFO Atlanta GA Southeast RFC Atlanta GA WFO Atlanta GA WFO Atlanta GA WFO Atlanta GA WFO Atlanta GA Southeast RFC Atlanta GU WFO Guam GU WFO Guam HI WFO Honolulu HI WFO Honolulu HI WFO Honolulu HI WFO Honolulu HI WFO Honolulu HI WFO Honolulu HI WFO Honolulu HI WFO Honolulu IA WFO Des Moines IA WFO Quad Cities IA WFO Des Moines IA WFO Des Moines IA WFO Quad Cities IA WFO Quad Cities ID WFO Boise ID WFO Boise ID WFO Pocatello Idaho Falls ID WFO Pocatello Idaho Falls ID WFO Pocatello Idaho Falls IL WFO Chicago IL WFO Central Illinois Lincoln IL WFO Chicago IL WFO Central Illinois Lincoln IL WFO Chicago IL WFO Central Illinois Lincoln IN WFO Northern Indiana North Webster IN WFO Indianapolis IN WFO Northern Indiana North Webster IN WFO Northern Indiana North Webster KS WFO Dodge City KS WFO Goodland KS WFO Wichita KS WFO Topeka KS WFO Topeka KY WFO Louisville MFL MIA MLB NHC PBI TAE TBW TLH TPA VAX VRB AHN ALR ATL ATR CSG FFC JGX MCN RDU GUA GUM HFO HNL HWA ITO LIH OGG STU WAK
6. An application would like to connect to your account The application Weather Message by Weather Message Software would like the ability to access and update your data on Twitter Not using Twitter Sign up and Join the Conversation Username or Email Password Deny Enter your Username or Email address password and click Allow The browser window will work for a few minutes then close Twitter will send Weather Message an access token that will be used to post updates Click Save and then Exit Create a Twitter Paging Group On the Paging Setup window right click in the grid and select Add Fill out the screen as shown below 2011 Weather Message Software 254 Weather Message Server Edit Paging Group Group Name SendToTwiter Create Group Pager Style Header Trailer Size 140 Create Group Short Maximum 1 Menenga Parse Timezone Geta Pin Entry Format Service Name Toinn X pin space name 208 John Doe Pager Pin List a Put each pager pinona separate line lt Enter a Group Name for your Twitter group You can use any of the available styles see Paging E Mail Formats 246 for a description of each style The Size field must be set to 140 characters Twitter only allows 140 characters and will reject any posts that exceed that limit The Maximum field can be set to zero to send multiple posts shoul
7. Double click on a cell in the Product ID column to add change or delete a product identifier Left click in the color column to change the background color aa click to change the foreground color The Product ID column contains the first three letters of the AWIPS identifier to be colored To add a new product identifier scroll down to a blank cell and click in the cell Enter the product identifier and press enter Then right click in color column to change the foreground text color or left click to change the background color The colors associated with the alarms established under the Alarms tab will override these default colors 9 7 6 Quick List Tab The Quick List Tab is used to 2011 Weather Message Software Message Client 135 Weather Message Client Setup Server Settings 1 Settings 2 Alams Product Colors Quick Lit Category Category ltems a WFO Birmingham TORBMX Thunderstorm 3 WFO Huntsville TORHUN Area Forecast Discussio WFO Mobile TORMOB Zone Forecast Round Up ad Description Description Product Tomado Add Change Delete Add Change Delete Save Cancel To add a category enter the category description and click Add To change a category click on the category make any changes and click on Change To delete a category click on the category and press the keyboard delete key
8. 2011 Weather Message Software 42 Weather Message Server Note When Weather Message Server is running as a service it will run as the user Local System Any directories that the server accesses will need to allow Local System to have full control 2 4 6 Printer The Printer menu allows you to select a default printer and font size Default Printer Default Font Click the Default Printer menu item to select a default printer Click the Default Font menu item to select a default font 2 4 7 Special Prefix The Special Prefix window allows you select products to be serviced by the WRN WRO WRP WRQ WRR and WRS prefixes These special prefixes are designed to assist you in alarming a group of messages These prefixes can be used to reduce the number of alarms needed for commonly alarmed products ra Special Prefix Setup Product FFW _ Product Identifiers Identifiers SVR must be all Fips or eee OF The first product entered determines the list type ses The prefix WRN defaults to the products FFW SVR and TOR Enter additional products by typing them into the list Note All of the products in this list must use the same UGC coding sequence zone or FIPS 2011 Weather Message Software Weather Message Server Setup 43 Product Identifiers must be all Fips or Zone The prefixes WRO WRP and WRQ have no assigned default values Select one of these pre
9. baat 210 Fire Department Eagle Creek E pin on a separate line lt Enter the name of the group to be setup in the Group Name field This name will appear in the alarm setup window as an available paging group Select the Style of page to send Select Short for a short message Selected for selected text from the alarmed UGC group Selected No Head for selected text from the alarmed UGC group without the header Full for Full Text Full No Head for Full Text without header Hint The No Head style option removes the heading lines from the messages This option removes all of the heading text from the first line in the message or UGC group down to the 2011 Weather Message Software Weather Message Server Setup 31 issued date time line The pager messages can be broken down into small packets to be sent to cellular phones and pagers These devices normally cannot receive a large email message Entering 0 zero for Size will tell the system to not break the message down into packets In addition you can limit the number of these packets you want to send by specifying that number in the Maximum field Entering 0 zero for Maximum will tell the system to send all of the packets Hint Some paging companies restrict the message size that can be sent to their pagers lt you exceed the size limitation the page request will be refused or rejected by the paging company If your page requests are being rejecte
10. m Wg Weather Message Server Connections x Address Computer Name Socket Type Id Version Date 192 168 1 10 DANNY dl 38583594 E 1 3 7 3902 09 11 09 01 192 168 1 10 DANNY dl 62407605 M 1 373305 09 11 22 24 ine eee The Address column contains the TCP IP address of the connected client The Computer Name column contains the computer name The Socket column contains the internal socket number associated with the client The Type column contains a C for message clients or a M for map clients The Id column contains the client s client identifier The Version column contains the version number of the client software being used The Date column contains the date and 2011 Weather Message Software 76 Weather Message Server 3 5 3 6 time that the client connected This window automatically updates every 15 seconds The Refresh button can be used to force a refresh immediately Clicking on a column header will sort the list alphabetically based on that column Testing Alarms In order to test your alarms a message that matches your alarms must be received There are two methods for creating a test message Use the Test Alarm 3 option from the main alarm grid or Weather Message Text Creator See the section on WxMesgText Message Creator for specific program operation Data Files Weather Message uses a number of data files to translate the codes used in the weather products In some cases users may want to
11. File Port Help Serial Ingest Software Demodulator Intemet Ingest Processing File Block File Size SPSCYSWY TXT 1of2 2048 Port Com4 Packet Length 0 Total Blocks 592 Bad Header 0 Bad Blocks 0 Check Sum 0 Error Percent 0 0 Block Count 0 WWWUS85 KCYS 070116 SPSCYS SPECIAL WEATHER STATEMENT a Starting Purge Cycle The main screen may contain up to three tabs that show the status of the serial software demodulator and internet ingest subsystems The status bar at the bottom of the window contains status message indicating the operation of the application Should the program stop receiving data you will see a red Data Alert message indicating the data failure Note f WxEmwin is stopped with the window minimized the next time it is started it will start minimized Note You can have one or more ingest engines running at the same time It is common to have both the Serial Ingest and Internet Ingest running at the same time for dual ingesting of EMWIN data System Tray When WxEmwin is minimized you can restore the main screen by right clicking on the system tray icon then select open 2011 Weather Message Software WxEmwin EMWIN Ingest 87 Data Alert Notification Should the program stop receiving data you will see a notification message above the system tray icon This message will indicate the data stream that has failed AY WxEmwin Status gt Not
12. Weather Message Version 3 8 Weather Alerting Software for your network 2011 Weather Message Software Weather Message Server 2011 Weather Message Software All rights reserved No parts of this work may be reproduced in any form or by any means graphic electronic or mechanical including photocopying recording taping or information storage and retrieval systems without the written permission of the publisher Products that are referred to in this document may be either trademarks and or registered trademarks of the respective owners The publisher and the author make no claim to these trademarks While every precaution has been taken in the preparation of this document the publisher and the author assume no responsibility for errors or omissions or for damages resulting from the use of information contained in this document or from the use of programs and source code that may accompany it In no event shall the publisher and the author be liable for any loss of profit or any other commercial damage caused or alleged to have been caused directly or indirectly by this document Printed July 2011 in Dadeville Alabama Special thanks to Publisher Weather Message Software All of the Weather Message users that have helped with the development of this software have listened carefully to your Editor requests Without your continued devotion this version would not be possible Danny Lloyd Also to the p
13. 1 GOSCIRUS 2 RADBMXAL 3 GOSCIRUS 4 MOD91EUS Exit The Save Image option is used to save the currently displayed image Images can be saved in GIF JPG PNG TIF and BMP format e The Print Full Image option will print the entire image to your default printer The Print Displayed Image option will print the image visible in the Image Viewer window to your default printer The Setup option opens the Setup Window l4 e Items 1 through 4 act as a recent image viewed list Select a previously viewed image to see it again e The Exit option shuts down the Message Client Note f you enable the Password for Setup Exit you will have to enter the a password to access the setup screen or exit the program The Select Image menu launches the Select Image 47 window The Browse menu launches the Image Browser 42 It is used to see a thumbnail of the images recently received The Image menu allows you to alter the sizing and resizing behavior of the displayed image Fit to Window Keep Aspect Ratio e The Fit to Window option when checked will cause the displayed image to fit the size of 2011 Weather Message Software 140 Weather Message Server the image viewer e The Keep Aspect Ratio when checked will cause the viewer to retain the aspect ratio of the displayed imaging Urn checking this option can cause the image to be distorted The Animate menu will start an animation of images T
14. 15 5 Setup 15 5 1 Server Tab The Server Tab is used to define the communication settings for your Weather Message Server a LL Setup x Server Program Options Tasks Weather Message Server Host TCP IP Address 127 0 0 1 Host TCP IP Port 9501 Backup Address Backup Port 9501 Client Identifier mE The Host TCP IP Address is the address of the Weather Message Server Enter the address of your primary server in this field Note When the Host TCP IP Address field is left blank WxLoader will try to discover the address and port of the Weather Message Server If your server is on the same local network as the client it will automatically obtain the address and port If the client is running on a different network you will need to enter the address and port of the server The Host TCP IP Port is the port defined by Weather Message Server for connections The default is 9501 The Backup Address is the TCP IP address of your backup Weather Message Server Do not enter an address in this field if you do not have a backup Weather Message Server This address is used when the program cannot contact your primary Weather Message Server The Backup Port is the port defined for use by the backup Weather Message Server The 2011 Weather Message Software 212 Weather Message Server default is 9501 The Client Identifier field allows you to assign an identification number to WxLoader This
15. Select the State Radar Site Image Layers File Name for ingest and Interval to retrieve Click on the Add button to schedule that radar site To remove a site click on the site in the list and click the Delete button Hint To receive national radar products select the state abbreviation NA Note f you do not enter a file name WxRadar will create the radar file name in the format RAD plus the last three letters of the radar site plus the 2 digit state abbreviation plus gif For example the file name for KMXX would be RADMXXAL gif The scheduled radar images will be retrieved based on the interval period specified Valid intervals are 4 5 6 7 8 9 10 11 12 13 14 15 20 25 30 35 40 45 50 55 and 60 minutes The results of each scheduled retrieve is logged to the file RadLog txt To view this log file click on File and View Log The log file will contain an entry for each time it attempts to retrieve a radar image It will also contain any error conditions Hint The scheduled images will be retrieved according to the schedule you establish If you want to retrieve all images immediately click on the Retrieve Now menu button When you are finished entering your schedule click on the Preview menu This returns you to the Main Window h 2011 Weather Message Software WxRadar 203 14 5 Setup 14 5 1 Settings Tab The Settings Tab is used to define general program operation g
16. Amateur Radio Net 145 33 The Print Notes button prints the displayed notes to your default printer Click Save to save any changes and Close to close this window Note The notes for each county are stored in the WxMesgNet Map Notes directory They are stored as rich text RTF files and can be edited with any RTF editor Fonts and colors can be included when using an external editor 2011 Weather Message Software WxMap Client 155 The Label County Toggle On Off when On for a county causes the county s name to be displayed on the map 11 6 Views The Views Menu option allows you to preset different map views This capability allows you to establish ten different views to quickly reposition the map to the defined areas View Alabama View Regional Save View Delete View To preset one of the four views position the map for the area to be included in the view Click on the Save View menu option You will be prompted to select one of the ten view and to enter a name for this view View Name Select a view to save View Alabama v J Enter a name for this view Alabama Save Cancel The name you entered will now be displayed in the View menu To delete a view click on the Delete View menu option You will be prompted to select a view to delete View Name Select a view to delete View Regional Enter a name for this view Regional D
17. Weather Message on the Web E Mail Program Support 13 3 Creating Text Messages Before you can begin scheduling user defined text messages you must create the messages First select or create a directory to store your messages You can use C Program Files WxMesgNet WxData WxLocal to store your user defined messages This directory is 2011 Weather Message Software 184 Weather Message Server automatically created for use by Message Text Creator and can be shared by WxScheduler You can use the Notepad menu option to launch Notepad to create the message Hint WxMesg Text and WxScheduler use the same text message format Messages created can be used by both programs Sample Message The following screen shows a sample message being created for a monthly system test Fi TestTor Notepad Lo File Edit Format View Help WUUS52 KBMX wXUTC A TORBMX ALC001 wxExpire O NEW KBMX TO w 9000 wxVtecIssue wxvtecExpire m BULLETIN EAS ACTIVATION REQUESTED TORNADO WARNING AUTAUGA COUNTY EMERGENCY MANAGEMENT AGENCY wxDate THIS IS A TEST OF THE AUTAUGA COUNTY SIREN NETWORK THIS IS ONLY A TEST NO TORNADO WARNING EXIST The file name for the message must end with the extension txt You will also notice that some special program codes are used in the message These special codes tell WxScheduler where to put special text in the message The message must be
18. HI 2011 Weather Message Software 142 Weather Message Server Images are broken down into six categories Click on one of the categories to see a list of images available When an image is selected the program will display the image if it is available If the Auto Animate option is enabled the image will automatically begin animation The Miscellaneous category contains a slide show option This can be used with the animate option to show all images 10 5 Image Browser The Image Browser allows you to browser received images Click on a image to load it into the Image Viewer Note f you have received a large number of images it make take several seconds for this screen to populate 10 6 Setup 10 6 1 Program Tab The Program Tab is used to set the graphics directory and other program defaults 2011 Weather Message Software Image Viewer 143 Wodmage Setup Program image z Graphics Directory C WxMesgNet Wximages Auto Animate Default Zoom 100 Save Cancel The Graphics Directory is automatically setup by the system This directory should not have to be changed under normal situations The Auto Animate option when checked will make the program automatically start image animation when an image is selected The Default Zoom field allows you to specify the zoom factor that is used when the image viewer is initially loaded
19. The HTML Code box is used to enter the html code to encapsulate the weather text Remember to use the variable MESSAGE in this code as a place marker for your text The Save button will save your html template and update the Archive Path field 2011 Weather Message Software Weather Message Server Setup 69 Note f a html template is specified the program will change any html reserved characters in the weather text to their corresponding html abbreviation This prevents html browsers from misinterpreting the weather text as html code Note The http PUT command requires write access to the directory specified in the command Note See Publishing Data to a Web Page for examples 2 7 Print Settings The Print Settings window allows you to print you print Alarms Email Groups Fax Groups and Pager Groups a a Print Settings l Print Alarms Print Email Groups Print Fax Groups Print Pager Groups Print Services lt lt lt lt J lt Select the items to print and click the Print button 2 8 Utilities The Utilities menu has the following option Change Archive Password The Change Archive Password window allows you to change the password entered in alarms used to archive products 2011 Weather Message Software 70 Weather Message Server Change Archive Password xa Old Password New Password Enter the old archive passw
20. The Reset Map option resizes the map showing all of the United States The Show Polygons option when checked will display polygons for messages that include the effected area The Label Counties option when checked will display names for the counties See the Map Base Tables for additional settings for labels The Active Alarms option displays the Active Alarms s5 window Note f you are in the drag or zoom mode you will not be able to click on a county to see the county s information The Views menu allows you to quickly change and save the map view to one of ten user defined areas 2011 Weather Message Software WxMap Client 149 View Alabama View Regional Save View Delete View e See Viewshs5 The Save Image option saves the current map image to WxMesgNetWaplmage jpg The Help menu allows you to see this manual and display information about the program Weather Message Help About Weather Message on the Web E Mail Program Support 2011 Weather Message Software 150 Weather Message Server 11 3 Main Window Ya Weather Message Map File Silence Map Views Savelmage Help St Clair AL Tornado Warning Tornado Watch TOR continued at 10 26 2010 15 30 00 Connected Weather Message Net Se 33 8403688 86 1785645 48 3 08PM You can click in the map legend on any of the weather t
21. f the Use Defined Ingest Paths setting is checked you will not be able to change the paths listed 2011 Weather Message Software WxScheduler 193 13 5 Examples 13 5 1 Hurricane Graphic The following screen shows show how to receive a tracking graphic from the National Hurricane Center Item Schedule Script Server Type O Loa HTTP OFTP Server Address www nhc noaa gov Port 80 User Name Password File Name storm_graphics ATO1 AL01 06W 5 gif Browse Ingest File Name ATO106 W5 gif Drop Duplicates Disabled Send Now oO Item Schedule Script Day of Month v Week of Month v Day of Week v Month v Time Interval 00 15 At This Time Every Time Message Duration 00 15 This graphic is received using the Internet every 15 minutes using HTTP 2011 Weather Message Software 194 Weather Message Server 13 5 2 Script Example he following screen shots demonstrate a script used to process a text file WxScheduler download Lamp data and the script extracts the information for KSBN Item Schedule Script Server Type O Local G HTTP OFTP Server Address weather noaa gov Port 80 User Name Password File Name pub data raw fo fous1 1 kwno lay usa Browse Ingest File Name LAMP TXT Drop Duplicates P Disabled F Sen
22. lt Server Settings 1 Settings 2 Alams Product Colors Quick List Scroll Buffer Size 125000 Product List Opacity 70 Product List Size 500 Product ListOnTop W The Scroll Buffer Size defines the number of characters to keep in the main text window The Product List Opacity allows you to setting the opacity or transparency of the product list 100 represents a normal window The lower the value the more transparent the product list becomes This allows you to see through the product list when it is positioned on top of other windows The Product List Size allows you to determine the number of products that are contained in the product list The Product List On Top field causes the product list when shown to appear on top of all other windows 9 7 4 Alarms Tab The Alarms Tab is used to set sounds colors print and popup options for 40 alarm types 2011 Weather Message Software 132 Weather Message Server Weather Message Client Setup gt Server Settings 1 Settings 2 Alams Product Colors Quick List a Alarm Type 1 Play Wave File C WxMesgNet Sounds Plectron wav Browse Wave Option Awips To Wave v Color Sound Durati PrO SS umdDwaion a Pop UpCliet E Print Client On Top Execute Program Save Cancel The Weather Message Server Setup program allows you to associate an Alarm Type for each alarm that is sent t
23. 2011 Weather Message Software 62 Weather Message Server Edit Alarm 1 TORBMX List Products List Forecast Offices List States Aam Client Map X10 Pasing Email Fax Archive Htmi Exe Print Notes E Mail Pager V Phone a Danny Facebook a None Danny Twitter Danny None E DannyShort E DannyLine 4 III h 4 III h Fax Group 7 N J Time Restrict No X FaxOffice Time Begin HH MM Start Receiving Time End HH MM Stop Receiving SMTWTFES Days of Week s J ces Paging To send a message to a pager you first have to establish your paging groups Weather Message supports TAP SNPP WCTP protocols along with a number of other speciality formats See the section on setting up paging groups After the groups have been established select one or more of the groups from the list Upon receiving a valid alarm for a pager group Weather Message will send a message to the pager group s based on the style you selected for the group If you selected the short message format and a TORBHM was issued with counties ALC123 and ALC037 the paging message will read NWS has issued a Tornado Warning for Tallapoosa Coosa County until 07 00 PM Examples of the message formats can be seen in Paging E Mail Formats Note f the alarm was only for Tallapoosa County only the name Tallapoosa will appear The same goes for Coosa If both counties are in the
24. AWIPS Products VTEC Counties Html Destination File Name b wxmesgnet wxdata archive sample htm Save To Local FTP gt HTTP D Pro Lite Sign Server Address Port 0 User Name Password 2 Sign Serial Port c Sign Identifier The Destination File Name is the path and file name that you want the created message to be named on your server or directory This field is required Select the type of save Local FTP HTTP or Pro Lite Sign If FTP or HTTP is selected the program will allow you to enter information about your ftp or HTTP server Enter the FTP Server address Port number User Name and Password These settings will be used to log into your server For Pro Lite Signs select the Sign Serial Port and enter the Sign Identifier Hint Setting the Sign Identifer to 00 will address all Pro Lite signs connected to the serial port 15 5 3 1 3 Products AWIPS Tab The Products AWIPS Tab allows you to specify the products that should be processed for this task based on the AWIPS identifier 2011 Weather Message Software WxLoader 219 File Separator Default Task Destination Products AWIPS Products VTEC Counties Html Products To Process I TORHUN Product Identifier TORBMX Add Product Delete Product es Enter an AWIPS identifier to process in the Product Identifier field Click the A
25. SHOWERS AND THUNDERSTORMS STORMS POSSIBLY SEVERE LOWS IN THE MID 60S SOUTHEAST WINDS 10 TO 15 MPH CHANCE OF RAIN 80 PERCENT ONDAY VARIABLE CLOUDINESS WITH HANCE OF THUNDERSTORMS HIGHS ERCENT A G IN THE UPPER 705 CHANCE OF RAIN 30 P AS ONDAY NIGHT PARTLY CLOUDY WITH LIGHT CHANCE OF SHOWERS LOWS IN THE MID 50S CHANCE OF RAIN 20 PERCENT TUESDAY MOSTLY CLOUDY AND COOLER WITH A CHANCE OF SHOWERS HIGHS IN THE MID 60S CHANCE OF RAIN 30 PERCENT WEDNESDAY AND THURSDAY OSTLY CLOUDY WITH A CHANCE OF SHOWERS EACH DAY LOWS IN THE MID 40S HIGHS 60 TO 65 sERIDAY cc PARTLY CLOUDY LOWS T HE MID 40S HIGHS 6S TO 70 SATURDAY PARTLY CLOUDY LOWS NEAR 50 HIGHS IN THE MID 70S You will notice that this message contains two groups Each group starts with the code ALZ Using the Selected option and alarming for ALZ011 Blount County you will receive the following 2011 Weather Message Software Supplement 249 text BLOUNT FAYETTE LAMAR MARION WALKER WINSTON INCLUDING THE CITIES OF DOUBLE SPRINGS FAYRITE HAMILTON JASPER ONEONTA s VERNON 405 PM CST SAT APR 5 2003 TONIGHT lt INCREASING CLOUDS A SLIGHT CHANCE OF A
26. This option will allow you to retrieve a file on a schedule and only process the file when it has changed The Disabled field is used to temporarily disable a scheduled item When this option is checked the scheduled item will not be processed Hint The Disabled option is useful when you want to send a message on demand You can setup the message with a schedule and then disable the message When you want to send the message you can right click on the schedule grid and select Send Now The Send Now field is used to send this scheduled item immediately Placing a check mark in this field and saving the item will cause the scheduler to immediately send this item 2011 Weather Message Software WxScheduler 187 Note You must exit back to the main screen before it will be sent The scheduler does not work while you are editing items Schedule The Schedule tab allows you to enter the processing schedule for this item Edit Scheduled Item kem Schedule Script Notes Day of Month j gt Week of Month Day of Week Wednesday gt Month Time 11 30 AtThis Time V Every Time Between Time Message Duration 00 15 Now enter the scheduling information for this message The Day of Month Day of Week Week of Month and Month fields can be left blank to indicate Any In the above example for a weekly test the Day of Month Week of Month and Month fields are left blank
27. This should be a user name and password setup in the firewall Select the Type of firewall Valid entries are 1 Tunnel 2 Socks version 4 or 3 Socks version 5 Firewall Proxy Settings Firewall Pip Firewall Http Proxy Host Name HTTP Version 1 0 Port 0 User Name Password Detect Proxy Save Cancel For a Proxy access enter the domain name or TCP IP address of the proxy in the Host Name field Enter the Port number for the firewall If required enter a User Name and Password This should be a user name and password setup for the proxy If HTTP version 1 0 is required for the proxy server check this box The Detect Proxy button will automatically detect the proxy settings for your computer and populate the host name and port fields Note The Firewall Proxy settings are common to all Weather Message applications Changing these settings will automatically change them for the other applications 2 4 5 6 Purge Tab The Option s Purge Tab allows you to configure the purge interval and product count for received products 2011 Weather Message Software 40 Weather Message Server m Program Options l General Product Collectives FTP Ingest Protocols Purge Service Global Purge Time 42 Hours Global Product Count Q Product Id RWRAL 2 2 BMX The Global Purge Time field specifies the number of hours to keep expired weather
28. WFO Wakefield WFO Wakefield WFO Charleston WFO Blacksburg WFO Blacksburg WFO Wakefield Wallops Flight Facility WFO Burlington WFO Burlington WFO Spokane WFO Spokane WFO Seattle Tacoma WFO Spokane WFO Seattle Tacoma WFO Seattle Tacoma WFO Seattle Tacoma WFO Seattle Tacoma WFO Seattle Tacoma WFO La Crosse WFO Green Bay WFO La Crosse WFO Milwaukee WFO Milwaukee WFO Milwaukee WFO La Crosse WFO Cheyenne WFO Riverton WFO Riverton WFO Cheyenne WFO Riverton WFO Riverton Network Control Facility Central Region Headquarters Tropical Prediction Center Network Control Facility Network Control Facility Tropical Prediction Center Southern Region Headquarters GLS GRK HGX HOU LBB LUB MAF SAT SUT SPS MCT MTX SLC STR AKQ CRW ECG FCX LYH ORF RIC RLX RNK ROA SBY WAL BTV TYX GEG LWS OLM OTX SEA SEW SOR UIL ZSE ARX GRB LSE MKE MKX MSN RST BFF CPR CRS CYS LND RIW ANC BCQ CCA DRK DRO ECA EHU 237 2011 Weather Message Software 238 Weather Message Server 17 2 XX XX XX XX XX XX XX XX XX XX XX XX XX XX XX XX Network Control Facility Western Region Headquarters World Weather Building Tropical Prediction Center Pacific Region Headquarters Storm Prediction Center Spanish Product Network Control Facility Network Control Facility Western Region Headquarters Alaska Region Headquarters Eastern Region Headquarters
29. phrase before it is alarmed The Match Text field allows you to enter a word or phrase that should be found in the message before it is alarmed This feature can be used with messages that contain different content For example the SPS Special Weather Statement is used for different purposes One use of this message is to announce thunderstorm advisories Entering THUNDERSTORM ADVISORY in this field for an SPS alarm will require it to contain these words before it would be alarmed The Exclude Text field allows you to enter a word or phase that if found would cause the message to not be alarmed This feature can be used to prevent the alarming of test messages For example entering the word TEST in this field would prevent any message containing the word TEST from being alarmed Hint The Match and Exclude fields use wildcards for matching Be sure to prepend and append an The matching mechanism supports to match Any single character to 2011 Weather Message Software 56 Weather Message Server match Zero or more characters to match any single digit 0 9 charlist to match any single character in charlist and charlist to match any single character not in charlist The default matching mechanism is fast but is limited to one set of matching criteria Checking the RegEx box to the right of the Match Text and Exclude Text boxes allows you to enter regular expressions Regular expressi
30. tem Schedule Script_ Notes Schedule Name Test Tomado Server Type Local HTTP FTP Server Address Port 0 User Name Password File Name C WxMesgNet WxData WxLocal Tes Browse Ingest FileName TORBMXAL bd Drop Duplicates F Disabled Send Now Enter a Schedule Name for this scheduled item Select the Server Type for this scheduled item Local HTTP or FTP In the above example the message will be obtained locally The Server Address Port User Name and Password fields are used when you select the server type HTTP or FTP When using HTTP or FTP enter the appropriate Server Address Port User Name and Password Enter the path and name of the file in the File Name field For local files you can use the Browse button to locate the file For HTTP or FTP files enter the location of the file In the Ingest File Name field enter the name of the file as it should appear when it is copied to the ingest directory The base name of the file should not exceed eight characters The total file name length including the extension should be no longer than 12 characters The Drop Duplicates check box when checked will create a CRC32 checksum for each processed file If the next file processed for a scheduled item is a duplicate the program will not process the file This option is useful if you are using WxScheduler to retrieve graphics from web sites In most cases you do not know when a web site file will change
31. you can put a copy of the received messages in a second or third directory for processing by RealEMWIN or the Weather Message Retransmission program Note Changing the Ingest and Additional Distribution Paths on this screen will automatically change them for WxByte WxIngest and WxPort 7 4 Register Software The Register menu option allows you to register your software WZ Register Software Registration Name Registration Code 2011 Weather Message Software WxWw2000 Weather Wire Ingest 109 When you purchase WxWw2000 you will be supplied with a Registration Name and Registration Code Enter these exactly as they are printed These fields are case sensitive After the software is registered we recommend that you stop and restart the software To purchase the software go to http www wxmesg com purchpay htm 2011 Weather Message Software 112 Weather Message Server 8 WxPort NOAAPort Ingest 8 1 Overview WxPort is used by Weather Message to receive NOAAPort data WxPort can process all four multicast channels from the NOAAPort data stream The ingest program can be started automatically by the Weather Message Server or manually E XF WxPort NOAA Port Ingest o a File Channels Help Status NWSTG 1201 NWSTG2 1203 Sequence Number 75627976 1 Sequence Number 47867924 0 Received File SXUS20 Received File MRBR86 Last File SXUS20 Last File MRMR9
32. 239 CGR CHG CLA CLI CLM CLS CMM COD CPF CSC CUR CWA CWF CWS DAY DGT DPA DSA DSM EFP EOL EON EQI EQR EQW ESF ESG ESP ESS EVI EWW FA0 FA1 FA2 FA3 FA4 FA5 FA6 FA7 FA8 FA9 FDI FFA FFG FFH FFS FFW FLN FLS FLW FMR FOF FOH FRW FSS FTM FWA SX WT CX CD CX CX CS FX FZ FP FX WL FZ WO FX AX SD AC CX FE FE FE SE SE WO FG FG FG FG WO WF FA FA FA FA FA FA FA FA FA FA FN WG FO FO WG WG FG WG WG FE FD FO WO FG NO NO Coast Guard Surface Report Computer Hurricane Guidance Climate Report Annual Climate Report Daily Climatological Report Long Term Climate Report Seasonal Coded Climatological Monthly Means Coded Analysis and Forecasts Coded Port Forecast Canadian Selected Cities Forecast Current Space Weather Indices Center Weather Advisory Coastal Waters Forecast Center Weather Statement Daily Space Weather Summary and Forcast Drought Information Radar Hourly Digital Precipitation Unnumbered Depression Asos Daily Summary 3 TO 5 Day Extended Forecast Average 6 TO 10 Day Weather Outlook Average 6 TO 10 Day Weather Outlook Earthquake Information Bulletin Earthquake Report Earthquake Warning Flood Potential Outlook Extended Streamflow Guidance Extended Streamflow Prediction Water Supply Outlook Evacuation Immediate Extreme Wind Warning Aviation Area Forecast Pacific Aviation Area Forecast Northeast U S Av
33. ALO DBQ DMX DSM DVN MLI BOI CBX PIH SFX SNT CHI ILX LOT PIA RFD SPI FWA IND IWX SBN DDC GLD ICT TOP TWX BWG 2011 Weather Message Software Supplement 233 KY WFO Paducah EVV KY WFO Paducah HPX KY WFO Jackson JKL KY WFO Louisville LEX KY WFO Louisville LMK KY WFO Louisville LVX KY WFO Paducah PAH KY WFO Louisville SDF LA WFO New Orleans Baton Rouge BTR LA WFO Lake Charles LCH LA WFO Lake Charles LFT LA WFO New Orleans Baton Rouge LIX LA Lower Mississippi RFC Slidell LOM LA WFO New Orleans Baton Rouge NEW LA Lower Mississippi RFC Slidell ORN LA WFO Shreveport SHV LA WFO New Orleans Baton Rouge SIL MA WFO Boston BDL MA WFO Boston BOS MA WFO Boston BOX MA WFO Boston EQI MA Northeast RFC Taunton HFD MA WFO Boston ORH MA WFO Boston PVD MA Northeast RFC Taunton TAR MD National Centers For Environmental Prediction WBC MD Hydrometeorological Predication Center WNH MD Ocean Prediction Center Ocean Forecast WNM ME WFO Caribou BGR ME WFO Caribou BGR ME WFO Caribou CAR ME WFO Caribou CBW ME WFO Portland CON ME WFO Portland GYX ME WFO Caribou HUL ME WFO Portland PWM MI WFO North Central Lower Michigan Gaylord APN MI WFO North Central Lower Michigan Gaylord APX MI WFO Detroit DTW MI WFO Detroit DTX MI WFO Detroit FNT MI WFO Grand Rapids GRR MI WFO Detroit MKG MI WFO Marquette MQT MI WFO North Central Lower Michigan Gaylord NWR MI Sault Ste Marie SSM MN WFO Duluth DLH MN WFO Mi
34. Client s connected to the server Select Yes to send the alarm to all Message Clients or select an individual Message Client identifier Each Message Client can be set to a different identifier This allows you to send different alarms to individual Message Clients Map Client The To Map field is used to indicate whether you want this alarm sent to the Map Client computers connected to the server Select Yes to send the alarm to all Map Clients or select an individual Map Client identifier Each Map Client can be set to a different identifier This will allow you to send different alarms to individual Map Clients Note Only messages with UGC lines will be sent to the map client Alarm Types The Alarm Type field designates an alarm number for this alarm The Message Client and Map Client use the Alarm Type to determine the sound message or text to speech option that is 2011 Weather Message Software Weather Message Server Setup 61 used when the alarm arrives The Message Client and Map Client will also use this Alarm Type to determine if their windows should be made visible if they are hidden Select your choice in the Alarm Type field You can establish 40 different alarm type settings in the Message and Map clients For example You could assign alarm type 1 to tornado warnings type 2 to tornado watches type 3 to severe thunderstorm warnings 4 to severe thunderstorm watches etc The actual wave files that
35. Edit Scheduled Item tem Schedule Script Notes The script used by WxScheduler is based on the programming syntax for Visual Basic Net 2005 The script is implemented as a function The function definition is Private Sub OnDataReceived ByVal ReceivedData as String ByRef ScriptStore as Object as String User scripts can access the received data using the variable ReceivedData It is the responsibility of the user script to return the data using the Return command or if no processing is desired return String Empty This function also passes the global variable ScriptStore This global variable can make data available to all of your scripts WxScheduler will attempt to download the file requested on the Item tab It will pass the received data to the user script in the variable ReceivedData In the event that no file could be downloaded ReceivedData will contain String Empty When this item is saved WxScheduler will attempt to compile the script If an error occurs you will be prompted with the error message and allowed to correct the script Notes The Notes tab allows you to information about this scheduled item 2011 Weather Message Software WxScheduler 189 13 4 2 Settings Tab The Settings Tab is used to establish general program option Use Defined Ingest Paths Timeout seconds 60 Log File Size 50000 FTP Use Passive Mode Auto Startup Run as a servi
36. Files siusorsauidanasnun ennont aa oredan ataa a aaa aaea a vant cedsneuestdeesseceessctescocdedeceds sisesstuceceanaesseds 77 8 Debug File cceccee cece eessee essen eeseeeseeesesneeeseneessaeeusenesusneeeasneeseaesdsaeesasneeseaeeussaesasnesaaneeesaeensaess 77 Part IV Weather Message Controller 80 1 SOVERVICW uuu u u aaea aa aa sua nied eee bau asss cei aaar a aa es a aa aaaea aaea eA aaa da aaan 80 2 Menu Option sosisini eet hee eee ee ete Su SS nate denied 81 3 Set p Poiana etal ahua Suwanun ecw cease ec assaka asua ce cea ences aaiae 82 Part V Third party Applications 84 Part VI WxEmwin EMWIN Ingest 86 1 OVervieW siciituisieeceeidi ital heeeetei ire tte deve eile eit aasawa qhay kasqaqa aie eee lead 86 2 MenU OU ONNS sic ceca cassettes caren acts up u a aq a u ama sa 87 3 Serial ingest Tab III IIIa auSyaassu es ra aada aaa anaa aaan daaa aaaea daiane 89 4 Software Demod lator TAD u ull ULU n nna aa aaa aaa Aaaa aa aa aa aa a aaa a aaa 91 Software Demodulator Stat s u uu u u u u uuu u uu u uu adaini andina daa I U uuu 92 5 Internet Ingest Tab 94 6 Setup anaoun taiua aaraa aaraa raaraa dano aan daadaa aia riea qd ussqqu ss agawawasue aaa saduwasta ss syasusasswasussag 96 Serial Ingest Tabi u asas ay E EN Aaaa aAa E EAE a EAEE qas aa EA AEA E OASAN ENTAR 96 Software Demod Tab
37. ImageViewer Help Tornado Warning l WUUSS2 KBMX 312004 TORBMX ALC123 312019 O NEW KBMX TO W 9000 101031T2004Z 101031T2019Z BULLETIN EAS ACTIVATION REQUESTED TORNADO WARNING LEE COUNTY EMERGENCY MANAGEMENT AGENCY 304 PM CDT SUN OCT 31 2010 THIS IS A TEST TEST TEST OF THE LEE COUNTY SKYWARN WEATHER INFORMATION NETWORK LEESKYWIN Connected Weather Message Net The Messages Tab displays a scrolling text box of received weather products The last message received is at the top The size of the scrolling buffer can be change in Setup 23 To view an incoming message in a separate window click on the message and a new window will open The status bar at the bottom of the window display connection information Normally you will see a green led which indicates you are connected to Weather Message Server If the program is not connected you will see a red led and the system tray icon will show a red circle 2011 Weather Message Software 124 Weather Message Server WZ Weather Message Message Client File Silence Text Request QuickList Product List ImageViewer Help Weather Roundup Message Description County Expires Time Remaining Tomado Waming Tallapoosa AL 10 31 03 19 PM 0 12 Connected Weather Message Net 3 07PM The Alarms Tab contains a list of active alarms It displays the message description counties and expiration informat
38. Ingest Protocols Purge Service Show Errors v Auto Startup No UnZip Files v Client Pass Code asasaas Show Message Decode Email Page Use Upper Case Email Page Add Delimiter 7 Log File Size 50000 Daily Logs Setup Shutdown Password Server Name Weather Message Net Save Cancel The Show Errors check box when checked will cause the software to pop up an error box when a problem is encountered during program operation Regardless of this setting all errors are logged to the log file The UnZip Files check box when checked will cause the software unzip received compressed files Files with the extensions zis and zip will be uncompressed when this option is enabled This option is checked by default The Show Message Decode option when checked will cause Weather Message Server to show detailed information in the server window about each message as it is decoded This option is only used for debugging and should not be used for normal operation The Email Page Use Upper Case option when checked will cause all email and paged messages to be sent in upper case The Email Page Add Delimiter option when checked will cause the program to add a comma between county names when using the short message option The Log File Size field allows you to specify this size of your Weather Message log files The default is 50 000 bytes The Daily Logs option when checked causes the program to store the log files fo
39. Ingest Paths Tab The Ingest Paths Tab is used to define the directories that will store the received weather products for processing 2011 Weather Message Software WxPort NOAAPort Ingest 117 WxPort Setup Settings Common Filters Ingest Paths Ingest Path c WxMesgNet WxData RxFiles Additional Distribution Paths The Ingest Path is defined in the Weather Message Server setup screen and would not normally be entered here Note The Ingest Path can be changed if you want to deposit the received messages in a directory other than the one established for Weather Message Server The Additional Distribution Paths can be used to place a copy of the received weather text in different directories for processing by other programs For example if you use Weather Message to receive your weather data you can put a copy of the received messages in a second or third directory for processing by RealEMWIN or the Weather Message Retransmission program Note Changing the Ingest and Additional Distribution Paths on this screen will automatically change them for WxByte WxIngest and WxWW2000 8 4 Register Software The Register menu option allows you to register your software WZ Register Software Registration Name Registration Code Gea J 2011 Weather Message Software 118 Weather Message Server When you purchase WxPort you will be supplied
40. On the main window select the alarm that you want sent to Facebook On the Paging Email Faxing tab select your Facebook group in the Paging list box Do this for each alarm that you want sent to Facebook 17 11 What is EMWIN EMWIN stands for the Emergency Managers Weather Information Network It is a service provided free by the National Weather Service EMWIN is a data stream broadcasted by the National Weather Service for use by emergency managers and others This data stream contains current weather warnings watches images advisories and forecasts issued by the National Weather Service The information present in the EMWIN data stream originates from local weather service offices and other sources This information is collected at the National Weather Service office in Silver Spring Maryland From there it is up linked to the GOES weather satellites from a transmission site in Wallops Island Virginia There are three methods to receive EMWIN data You can obtain it directly from the GOES weather satellites with a satellite receiver If the EMWIN signal is being broadcasted on a VHF or UHF frequency in your area you can receive it using a low cost scanner and decoder It is also available through an Internet connection Each method requires different hardware and or software combinations A list of hardware vendors is available from the National Weather Service EMWIN Vendors web page Who can benefit from EMWIN Emergency Manage
41. Put one fax number per line You can also enter a name associated with each address by following the fax number with a single space then the name Entering a name will help you identify the person associated with the fax number 2011 Weather Message Software Weather Message Server Setup 19 Hint f you are required to dial a nine to obtain an outside line you can insert a P after the 9 to cause the modem to pause for a second dial tone For example 9P3292952 The Create Group Fax Header Trailer button allows you to create text that will be added to the beginning and end of selected and full fax messages for this group When you click on this button a screen will be displayed for you to enter the header and trailer See Message Header Trailer st for an example 2 4 2 Email Group 2 4 2 1 Email Settings The Email Setup window allows you to set the email server information along with your email groups E Mail Setup SMTP Server smtp hughes net Email Options E Mail Address danny wxmesg com E Mail From Create E Mail E Mail Danny_Home_Net Header Trailer Group Name Style Danny Full Phone Short Phon2 Full No Head Graphic Full Danny Test Short Enter the name of your SMTP Server and your E mail Address The E Mail From field can be used to attach your agency name and or abbreviation This field will be shown in the e mail From field Note Weather Message does not natively support se
42. SHOWER AFTER MIDNIGHT LOWS IN THE LOWER 50S NORTHEAST WINDS 5 TO 10 MPH CHANCE OF RAIN 20 PERCENT s SUNDAY MOSTLY CLOUDY WITH SHOWERS AND THUNDERSTORMS LIKELY BY AFTERNOON STORMS POSSIBLY SEVERE IN THE AFTERNOON HIGHS IN THE LOWER 70S EAST WINDS 10 TO 15 MPH BECOMING SOUTHEAST IN THE AFTERNOON CHANCE OF RAIN 70 PERCENT SUNDAY NIGHT SHOWERS AND THUNDERSTORMS STORMS POSSIBLY SEVERE LOWS IN THE LOWER 60S SOUTHEAST WINDS 10 TO 15 MPH CHANCE OF RAIN 80 PERCENT MONDAY VARIABLE CLOUDINESS WITH A CHANCE OF THUNDERSTORMS HIGHS IN THE UPPER 70S CHANCE OF RAIN 30 PERCENT MONDAY NIGHT PARTLY CLOUDY WITH A SLIGHT CHANCE OF SHOWERS LOWS IN THE MID 50S CHANCE OF RAIN 20 PERCENT TUESDAY MOSTLY CLOUDY AND COOLER WITH A CHANCE OF SHOWERS HIGHS 60 TO 65 CHANCE OF RAIN 30 PERCENT WEDNESDAY AND THURSDAY MOSTLY CLOUDY WITH A CHANCE OF SHOWERS EACH DAY LOWS IN THE MID 40S HIGHS 60 TO 65 FRIDAY PARTLY CLOUDY LOWS IN THE MID 40S HIGHS 65 TO 70 SATURDAY PARTLY CLOUDY LOWS NEAR 50 HIGHS IN THE MID 70S The Selected No Head wil
43. Setup window ho The View Logfile displays the radar log file in notepad The Print option prints the current radar image on your default printer The Clear Cache option clears the radar cache directory of all static image overlays The Exit option shuts down WxRadar The Schedule menu allows you to establish a schedule 207 to retrieve radar images The Retrieve Now menu forces the application to start a retrieve cycle The Help menu allows you to see this manual and display information about the program 2011 Weather Message Software 200 Weather Message Server Weather Message Help About Weather Message on the Web E Mail Program Support 14 3 Main Window u WxRadar boba File Schedule Retrieve Now Help State aL RadarSite KBMX BIRMINGHAM Alabaster x Image Reflectivity 124 miles x View Layers Topo 7 Radar Z Counties Rivers Z Highways J Cities J Warnings J Legend National Weather Service WSR 88D Image from BMX 10 31 2010 02 30 UTC 9 30 lowencebuig Ba 24 fiorence Huntsville Cadsden 9 35 PM RADBMXAL gif copied to ingest The main window allows you to quickly retrieve a radar image Select the State Radar Site Image type and Layers Click the View button to retrieve the image selected Hint To receive national radar products select the state abbreviation NA The image can be resized to fit the display window or zoo
44. The Day of Week is specified Hint Make sure that the combinations of Day of Month Day of Week Week of Month and Month will occur If you select the first day of the month and the second week of the month the criteria for this alarm will never occur Hint Specifying both Week of Month and Day of Week will instruct the program to check for the Xth Day of Week in a month If you want to schedule an item for the first Wednesday of every month enter 1 for the Week of Month and select Wednesday for the Day of Week Before entering a time select the At This Time Every Time or Between Time to indicate if this item should be processed at a specific time time interval or an interval between two times Then enter the Time or Time Interval for this item The Time must be in 24 hour notation and in the format HH MM The Duration field is used to establish an expiration time for text messages that contain UGC lines It is used to populate the WxExpire variable Enter the length of time for this message The Duration field must be in the format HH MM When the Between Time option is selected enter the Time Begin and Time End The 2011 Weather Message Software 188 Weather Message Server scheduled item will be evaluated when the current time falls between the begin and ending time Script The Script tab allows you to enter visual basic code to manipulate the received data before it is copied to the ingest path
45. The Help menu allows you to see this manual and display information about the program Weather Message Help About Weather Message on the Web E Mail Program Support FTP Ingest The FTP Ingest window is used to manually request a FTP ingest of weather products This option requires an Internet connection NOAA current offers text and image products for these durations fifteen minutes one hour and three hours 2011 Weather Message Software Weather Message Server 75 Text Files Image Files Duration to Receive Fifteen Minutes One Hour Three Hours Crane css J Retrieve Archived Files NOAA Server 140 90 6 240 Weather Message Server FTP Ingest The NOAA Server address is locked and can only be changed by modifying a registry value Select the file type and duration that you want to retrieve and click on the Retrieve button The Server s Archive FTP status line is updated as the file is downloaded Note Since the one and three hour files can be quite large it may take some time for them to be retrieved and uncompressed Note On occasion you may see a permission denied message when you attempt to retrieve products This error message is returned by the NWS ftp server when it is updating files If this occurs wait a few minutes and try again Active Connections The Active Connections window displays a list of clients connected to the server
46. The To address field will be displayed as undisclosed recipients The Priority Flag option should be checked if you want the recipients email to be flagged as priority Hint Some spam filters may flag messages with priority flags as spam If you run into a problem with a spam filter uncheck this option The Append Time check box is used to add a date and time to the email subject This option can be used with email forwarding software that does not forward email messages with duplicate subject lines 2011 Weather Message Software 22 Weather Message Server Some ISPs require that you authenticate your connection when you connect to their SMTP servers If your ISP has this requirement enter your User Name Password and select the authentication Method in the Primary SMTP Authentication fields Hint Use the SMTP authentication fields if they are required otherwise leave them blank If your ISP does not require authentication and you enter a user name and password connection attempts to your email server will fail Hint The default authentication method is Password This setting is used by most servers You can optionally select CRAM or NTLM based on your servers requirements In the event that an email message cannot be delivered you can specify the number of times the software will attempt to deliver the message Enter the number of retries in the Failure Retries field Enter the number of minutes between retr
47. WxRadar Setup Settings Ingest Paths Timeout seconds 240 Firewall Proxy Log File Size 50000 Show Image 7 Map Background hz Drop Duplicates v Image Type GF Use Defined Ingest Paths E Auto Startup No Send to Client Viewer The Timeout field allows you to specific the maximum amount of time the program will wait on the NOAA servers to respond The Log File Size field allows you to specify this size of your log file RadLog txt The default is 50 000 bytes When the program retrieves images from the defined schedule it does not display these images in the preview window The Show Image check box when checked causes the program to show each image as it is received The Drop Duplicates check box when checked will create a CRC32 checksum on each received image If the next image received is a duplicate the program will not process the image The Use Defined Ingest Paths check box when checked will cause the program to use the ingest paths defined in the ingest programs WxByte and WxIngest If you want to define your own ingest paths for WxRadar remove this check The Send to Client Viewer option when checked will cause the program to store a copy of the image for viewing by the image viewer built into the Message Client This option can be used in special situations where radar images are not being processed by Weather Message Server The user can configure WxRadar to proces
48. alarmed UGC group Selected No Head for selected text from the alarmed UGC group without the header Full for Full Text Full No Head for Full Text without header or Raw for raw data Hint The No Head style option removes the heading lines from the messages This option removes all of the heading text from the first line in the message or UGC group down to the issued date time line Hint For graphic products use the Full option Note The Raw option is used by WxLoader to reconstruct a message from the individual 2011 Weather Message Software Weather Message Server Setup 65 parts of a message The Archive Type field is automatically selected by the software based on the protocols selected on the HTML Template e7 window This field can be blank or one of these options Local HTTP FTP FTPS SFTP Password or SFTP Certificate The Archive Path field contains the directory and file name to save The default archive type is Local To save a file to a local directory simply enter the directory path and file name to save in the Archive Path field To use the FTP FTPS SFTP or HTTP protocols press the HTML Template button An example of archiving to a local directory using the original EMWIN file name along with the message expiration date time would be c weather FileName Expire FileExt This would result in a file with a eight character EMWIN file name appended with the expiration date time in the format
49. all ingest programs 2011 Weather Message Software WxEmwin EMWIN Ingest 101 E WxEmwin Setup Serial Ingest Software Demod Intemet Ingest Common ingest Paths Run in Background Log Bad Blocks Log Received Files v Send Data Loss Alerts v UnZip Received Files Purge Ingest Directories V Enable Byte Blaster 7 Server Support Log File Size 500000 Global Ingest Paths V The Run in Background check box allows you to specify whether you want the ingest programs to run in the background When this box is checked the ingest programs will not show in the system tray Once this option is enabled you will not see the ingest programs running In order to see the ingest screen you will need to use the Show Ingest menu option in Weather Message Server Note Changing this option does not take effect until the next time the ingest programs are started The Log Received Files option causes the program to record the name of each weather file received The names are recorded in WsFiles txt The UnZip Received Files option when checked will cause the program to unzip any compressed files This option is normally left unchecked as the Weather Message programs automatically unzip compressed files In some applications it may be desirable to unzip the files before they are copied to the ingest directory s The Purge Ingest Directories option when checked will cause the program to automatically purg
50. and graphic products before deleting them from the directories entered in Data Path and Graphics Path The Global Purge Count allows you specify the minimum number of products to keep on file after the Global Purge Time as elapsed Individual Product Purging Purge options can also be specified for individual products or wildcard patterns These options override the global options To enter a new product identifier click in the Product Id field on the row that has the Enter the Hours and Count for this product The Product Id field supports the wildcard and characters To change an entry click in the cell to be changed To delete an entry select the row and press the delete key Purge Option Combinations Product purging give you three options e Hours gt 0 and Count 0 This purges the product based on the expiration time e Hours gt 0 and Count gt 0 This purges the product based on expiration time and product count The program favors the hours parameter first That is it will always keep a product until the hours elapses then it will honor the count setting e Hours 0 and Count gt 0 This purges the product based on the count of products If you set the count to 2 and 4 2011 Weather Message Software Weather Message Server Setup 41 product have been received in the last 30 minutes the purge cycle will keep the last 2 product received and the previously received products will be de
51. any existing polygons are not redrawn To redraw existing polygons refresh the map The Map Zoom Factor sets the step rate in which the map zooms in an out Default value is 5 five The larger the number the faster the map will zoom in and out The current zoom level is displayed in the Status Line 23 Optional Map Layer Note The map included with the default installation does not include the map layers for interstate roads forecast zones or marine zones To add these optional map layers download and install the optional map layers from your CD or the Weather Message downloads page 11 8 7 Map Layers Tab The Map Layers Tab is used to setup additional map layers r Weather Message Text Van Buren MI WWUS43 KGRR 052105 WSWGRR a URGENT WINTER WEATHER MESSAGE NATIONAL WEATHER SERVICE GRAND RAPIDS MI 405 PM EST SUN DEC 5 2010 MIZ0S6 060515 O CON KGRR LE W 0003 000000T0000Z 101206T2200Z OTTAWA INCLUDING THE CITY OF JENISON 405 PM EST SUN DEC S 2010 Zoom to County Read Text E Mail Message Print Message 2011 Weather Message Software WxMap Client 165 The default installation includes the state map layer This layer is used to outline the states The Weather Message website has an optional map layer download that contains interstate forecast zones marine zones roads and rivers Hint User provided shape layers would be setup here The File Name field con
52. for if county names are available otherwise do not include the word The lfCounty County does the same to include the word County if county names are available Hint Use fCounty Parish to use Parish instead of County Note When ifCounty County or lfCounty Parish is used the system will automatically make County and Parish plural when there are more than one county Using these codes you could construct a message that reads From Lee County EMA At 13 30 NWS BHM issued a Tornado Warning for Lee County expiring at 14 00 This flexibility allows you to have a shorter or longer message based on your requirements 2011 Weather Message Software Weather Message Server Setup 47 The IfExpire word and IfExpires word variables support the conditional instruction Else The value to the left of Else will be populated when there is an expiration time The value to the right of Else will be populated when there is no expiration time In the case of lfExpires variable a cancellation will use the value to the right of Else Example NWS has Action a MesgType lfCounty for Counties lfCounty County lfExpires until Expire Else at lssued The HeadLines code will include any headlines found in the alarmed message Headlines are lines that begin with and end with Headlines are not present in every weather message The BulletAT code will include any text found
53. formatted and worded properly you can now save the message for future reference by clicking the Save button After entering the information for your message click the Send button to send the message to Weather Message Server for processing The following screen will be displayed to confirm sending this message Confirm Send 2 Are you sure you want to send this message Ye J This message will disappear in 24 seconds The operator has 30 seconds to confirm the message If it is not confirmed the message will not be sent 12 4 Simple Mode 2011 Weather Message Software 176 Weather Message Server File Clear Counties Help Oe Produet VTEC Prot Prerorera County Selecion VTEC Aeon Sniconce Wamng County Event 1 Expires UTC 10 17 2010 02 59 H Fl Autauga Headline THIS IS AN EXAMPLE HEADLINE a Z Lee E Tallapoosa E Appling At Bullet Z Body THIS IS ONLY A TEST MESSAGE NO TORNADO WARNINGS EXIST 4 lamis J Caa File Name WxProd txt s _ 10 17 10 02 4416 The Simple mode as the name implies is easier to use than the expert mode The program builds the message based on the information that you select or enter on this screen Note f the product selected does not support VTEC encoding the VTEC related boxes will be disabled The Select All button will select all of the listed counties The Clear button will clear the coun
54. formatted like a standard National Weather Service Message You can view actual NWS products at http www wxmesg com asp recprod asp The actual messages can be used as examples for formatting The following special codes can be used in the message WxUTC Current UTC time in the format ddhhmm WxExpire Expiration time in the format ddhhmm WxDate Current local date and time WxVteclssue Issue time for the VTEC line WxVtecExpire Expiration time for the VTEC line 13 4 Setup 13 4 1 Schedule Tab The Schedule Tab is used to establish schedules 2011 Weather Message Software WxScheduler 185 Schedule Settings Ingest Paths Name File Name Day of Month Day of Week Humicane Graphic AL0106W5 f O Test Tomado TestTor ba 0 Wednesday To add change or delete a scheduled item click on the line that you want to modify and right click then select the appropriate function Edit or Delete When changing an entry the Edit Scheduled Item window is displayed Hint To send the message immediately right click and select the Send Now option Hint tems displayed with a yellow background are disabled and will not be processed 13 4 1 1 Edit Scheduled Item The Edit Scheduled Item window allows you to enter the specifics about the item being scheduled 2011 Weather Message Software 186 Weather Message Server Eun Scheduled Rem x
55. in the alarmed message after the text AT or AT This code is useful with TOR tornado SVR severe thunderstorm and SVS severe weather statment messages It captures the location of the weather system causing the alarm The Bullet code will include any text found in the alarmed message after the text This code is useful with several types of messages It captures the location of the weather system or event causing the alarm The Today and Tonight codes will include the today and or tonight information from the Zone Forecast product Specifically Today will pull all of the text associated with a line that starts with TODAY or THIS Tonight will pull all of the text associated with a line that starts with TONIGHT The DayOne and Spotter codes will include the day one and spotter attention lines from the Hazardous Weather Outlook Specifically DayOne will pull the first paragraph after the DAY ONE header Spotter will pull the first paragraph after the SPOTTER header The Now code will include all text that follows the NOW heading The Concerning code will include the text that follows the CONCERNING line in the SWOMCD product The Areas Affected code will include the text that follows the AREAS AFFECTED line in the SWOMCD product The Location code will include the text that follows the LOCATION or LOCATION line in the TOR SVR AND SVS products The UserDef1 code
56. into small packets to be sent to cellular phones and pagers These devices normally cannot receive a large email message Entering 0 zero for Size will tell the system to not break the message down into packets In addition you can limit the number of these packets you want to send by specifying that number in the Maximum field Entering 0 zero for Maximum will tell the system to send all of the packets The Subject Override allows you to override the default subject line with one of your choosing 2011 Weather Message Software 24 Weather Message Server You can enter any text and embed the variable Subject to include the original subject description The variable WFO can be used to include the 3 character WFO The Parse option can be used to reduce the size of email messages sent Selecting Y tells the system to parse the messages for this group against the WxWords word substitution file The Time Zone option allows you to select the time zone for this group This option is used when the Style is set to Short The system will adjust the received message to the selected time zone Enter the email addresses in the E mail List box Put one e mail address per line You can also enter a name associated with each address by following the email address with a single space then the name Entering a name will help you identify the person associated with the email address If you do not know the domain name for a c
57. is enabled If the interval is set to zero the image will only be saved when the map changes if the Save Map Image option is enabled 2011 Weather Message Software 166 Weather Message Server The Interval Always Active instructs the program to save the map image at the specified interval even if there are no active watch warnings When this option is unchecked the program will only save the map image if the Save Map Image option is enabled The Image Type field allows you to select the format of the saved image Select JPG PNG BMP or TIF The Image Quality field allows you to specify the quality of the saved image For JPG images zero 0 represents the lowest quality while one hundred 100 represents the highest quality For PNG images zero 0 represents no compression while one hundred 100 represents full compression You can enter a number in the range of zero to one hundred The Logo Position option allows you to add a user defined logo to the saved map image The combo box allows you to enable logo insertion by selecting the position for the logo on the map image The logo should be saved in c Program Files WxMesgNet directory with the file name WxMapLogo png The Map Image Path for a locally saved image is the local directory where the map image should be stored The program will automatically add the name Maplmage xxx when it saves the image For FTP and HTTP the Map Image Path should b
58. login This will insure that all users have access to the programs Note t is not necessary to uninstall a previous version of Weather Message before installing an updated software version Uninstalling the software will delete your operating setup information 2011 Weather Message Software 12 Weather Message Server 2 Weather Message Server Setup 2 1 Overview The Weather Message Setup program is used to configure the operation of Weather Message It has a number of options that are detailed in this manual The default installation is pre configured to work immediately and alarm all received weather products File Support Setup TCP IP Port 9501 Ingest Path c WxMesgNet WxData RxFiles Data Path C WxMesgNet WxData WxText Graphics Path C WxMesgNet WxData WxGraph Alarm File i Weather Wire NoaaPort Alam Type Pager Group s ba 0 None None None GO8HURUS Weather Message processes received weather products based on alarms that you configure Only products that match your alarms will be processed 2 2 Menu Options 2011 Weather Message Software Weather Message Server Setup 13 5 Wg Weather Message Setup L J File Support Setup Help CP IP Port 501 n The menu buttons perform these functions The File menu allows you to export and import the program registry
59. main processing window shows the current status of WxScheduler When it is processing a message you will see information about the message scroll in the text box To establish schedules see the Schedule Tab i Note f WxScheduler is stopped with the window minimized the next time it is started it will start minimized When WxScheduler is minimized you can restore the main screen by right clicking on the then select open Copyright 2011 Weather Message Software 2011 Weather Message Software WxScheduler 183 13 2 Menu Options 8 WxScheduler File Pause Help The menu buttons on this screen perform these functions The File menu allows you to setup this program view logfiles launch notepad and exit the program Setup View Log Notepad Exit e The Setup option opens the Setup Window e e The View Log menu displays the log file in notepad e The Notepad menu opens notepad This can be used to edit message templates e The Exit option shuts down WxScheduler The Pause option stops the scheduler When stopped the status bar flashes the word Paused The menu option changes to Start Clicking Start restarts the scheduler Note When the scheduler is started after a pause any items scheduled to occur at times prior to the restart will not be processed The Help menu allows you to see this manual and display information about the program Weather Message Help About
60. modify the descriptions contained in these files The following files are located in the WxMesgNet directory File Name Description County_F dat Contains the county FIPS code county name longitude and latitude County_FZ_Z dat Contains the county fire zone code county name longitude and latitude County_Z dat Contains the county zone code county name longitude and latitude FipsZone dat Contains a cross reference between the county FIPS code to county Zone code Nwsli dat Contains the NWS Location Identifier for rivers Product dat Contains the product identifiers and descriptions ProductUser dat Contains user defined product identifiers and descriptions States dat Contains the state identifiers and descriptions VtAction dat Contains the VTEC action identifiers and descriptions VtCross dat Contains the VTEC phenomena cross reference to product identifiers VtPhenom dat Contains the VTEC phenomena identifiers and descriptions WfoSites dat Contains the WFO identifiers and descriptions WxCType dat Contains a list of product identifiers that are coded with FIPS codes Note These files are routinely overwritten during upgrades The installer will backup the files to c Program Files WxMesgNet Backup If you changed the files you can restore or compare your old version with the new version Warning Use caution when editing any of these files If the files are not properly formatted the software may not start or will disp
61. number of minutes between retries in the Retry Minutes field Note For the TAP protocol the Failure Retries field is used to specify the number of times that the program will attempt to connect to your paging provider when their modem line number is busy HTTP Post GET The HTTP Post and HTTP Get option allows you to interface directly with a web page or web server The Post option posts variables to the web server The Get option URL encodes the variables before appending them to the http address These option requires a good understanding of posting data to web servers and the paging providers webpage It is beyond the scope of this manual to describe these requirements If you have questions contact Weather Message Support For HTTP you must enter the information and variables to be posted or URL encoded to the HTTP server Enter the required information in the HTTP Post Variables field They are entered in the format variable value Three replacement variables are available to insert the pager pin group name and message Use the variable Pin to insert the pager pin Group to insert the paging group name and Message to insert the pager message The following is an example of the variables needed for the SouthernLinc HTTP server PageAreal PageNum1 Pin From EMWIN PageMsg Message NumChars Page Send Message TCP Paging The TCP option supports simple paging using the TCP protocol The application will connect to a spec
62. on the listed task 15 5 3 1 Editing a Task 15 5 3 1 1 Task Tab The Edit Task window is used to setup information for a new or selected task 2011 Weather Message Software 216 Weather Message Server fa LL Edit Task Ex5 File Separator Default Message Task Destination Products AWIPS Products VTEC Counties Html Task Name Tomado Style Short with State Issue Time Style Issue Time Day v Expire Time Style Time Day Net v Combine Like Products F Delete Inactive E Expire Adjustment Minutes Expire After 0_ Minutes The Task Name field describes this task Use short descriptive names to identify your tasks The Style option is used to specify the type of message to create Select Short for a short message with the county names Short with State for a short message with the county names suffixed with the state abbreviation Short by State for a short message that includes the state name followed by the counties Full for a full text message or Full No Head for the full text excluding the first 3 lines of the message Here is an example message created with the Short option A Tornado Warning has been issued for Tallapoosa county until 9 20 PM A Severe Thunderstorm Watch has been issued for Tallapoosa county until 9 20 PM Here is an example message created with the Short with State option A Tornado Warning has b
63. p align left gt lt PRE gt SMESSAGES lt PRE gt If you will be using HTML code enter the HTML code in the text box Remember to use the variable MESSAGEG in this code as a place marker for your text The Load Template button can be used to load a template file or a file containing html code When loading templates the program automatically looks for templates in WxMesgNet WxData Template Note f a html template is specified the program will change any html reserved characters in the weather text to their corresponding html abbreviation This prevents html browsers from misinterpreting the weather text as html code Note See Publishing Data to a Web Page for examples 15 5 3 1 7 File Separator Tab The File Separator Tab allows you to enter text to be inserted between each product 2011 Weather Message Software WxLoader 223 Products AWIPS Products VTEC Counties Html If you want text inserted between each product enter it in the text box This field is not required and can be left blank 15 5 3 1 8 Default Message Tab The Default Message Tab allows you to specify text to be uploaded when there are no active messages for this task 2011 Weather Message Software 224 Weather Message Server There are no active Tomado Wamings Enter the default message text in the text box This field is not required and can be left blank 15 6 Alarm Set
64. s 52 6 Maintaining Alarms I U U U u u u uuu uuu uuu uu u 52 The Alarm Grid uu u ua u au Sq asua beshakeveehcods contest sbaceechaced cedetestcuccaue ics weacvs as S assEssuyaswaasskaasx 52 Alam fab OO a a p a a aa ara aaar e Ea EA a a aa ara raa aA aa aaa AE EA Ee raea aara A arae HEA EH PESE AEE raK 53 VTEC SENOS nasses idera ATi e apaiage a aa 57 Area Seting Ss Ns yuaya a E A a a a ES 58 Wind Hail SettiNgS eisirean aaar aaiae na piai iird riayat aiara a aeria 59 Client Map X10 Tab I I u u uu 60 Paging Email Fax Tab u u U u U UU 61 Archive Html Exe Print Tab uu u u UU uu u u U U I Uu 64 NOTES E E E A T E E 66 FTP HTTP Himi Setups ea aeaaeae aariaa er ent iaria aaa aata a RE Mae donde 67 f Tae e a E u UI E E patsadeucces co pdenseaseuiesertbceesetiaesdareublersucdevencsd 69 UNIS e E AEE E u a EAEE cece est a EAA A uy a u N A E E 69 Part Ill Weather Message Server 72 EAE u E E E A E E A E E E A AE AA AE E ss 72 2 M nu Option ic seca ULU dosraniad maada rendan aai a daaa adasa da a ieda asus ads daaa dadaan 73 Ea e E E A E E E E aasawa aka 74 4 Active Connections LLULLU u a e aa aaaea a aAa aaa a aa aaa aaa aa aa Aa a aaa 75 5 Testing AlatMS III II eaaa aana aa ses aeaa aeaa aaa aa aai ae Da aeaaea 76 6 Data Files uuu u taina niania iaaea aada aaa Aa aaa aa aeia ida i naaa aea daa aaa Aaaa aia iiaa Aaaa aa Aiia asus 76 f LOG
65. that have alarms which are about to expire Five minutes before the alarm is to expire the program will outline the county This will assist you with identifying counties that have alarms about to expire Status Line Connected weather Message Net 29 8259785 394 999087 8 48PM The status line displays the operational status of the program and map information The first status area displays the name of the Weather Message server that is providing data The status area when present displays the latitude and longitude of the mouse pointer when moved through the map The latitude and longitude status can be enabled and disabled in Setup hos The latitude longitude status is followed by the map zoom factor The number that appears in this status box is the relative zoom level of the map Zooming in increases this number Zooming out decreases this number A green LED indicates that the program is connected to a Weather Message Server A yellow LED indicates that the program is attempting to connect to a server A red LED indicates that the program is not connected to a server The current time is displayed in the last status box Special Keys Pressing control s while the main window has focus causes the program to save the map image using the information setup for saving images 165 11 4 Map Legend The Map Legend buttons allow you to quickly get a list of counties included in a specific weather type 2011 Weather Me
66. the message with user defined text WxLoader connects to Weather Message server using TCP IP and processes the same products sent to the map client Hint f the system tray icon is outlined with a red circle or a red led appears in the status bar the program is not communicating with the Weather Message Server Note f WxLoader is stopped with the window minimized the next time it is started it will start minimized System Tray When WxLoader is minimized you can restore the main screen by right clicking on the system tray icon m then select open Copyright 2011 Weather Message Software 2011 Weather Message Software WxLoader 209 15 2 Menu Options File Alarms Help L Weather Message Web Loader fo The menu buttons on this screen perform these functions The File menu allows you to setup this program start a processing cycle and exit the program Setup Connect Refresh Alarms Process Now View Logfile Exit e The Setup option opens the Setup window h1 e The Connect option forces the application to attempt a connection to the server e The Refresh Alarm option clears any active alarms and sends a refresh request to Weather Message Server e The Process Now forces the program to start a processing cycle e The View Logfile option displays the log file in notepad e The Exit option shuts down WxLoader The Alarms option displays the Active Alarms ss window Th
67. the right of the first text box you will see a list of codes that can be used The text box at the bottom of the window shows a sample of the decoded format The following is a list of the codes available and their meaning vProduct Product type Operational Test Experimental Experimantal VTEC System Test vAction Action New Cancelled Extended etc vPhenomena Phenomena Severe Thunderstorm Tornado etc vSignificance Significance Watch Warning etc vEvent Event number used to track this message vEventStart Event start time in local AM PM format vEventStart24 Event start time in 24 hour format Note The vEventStart variables can be blank if the incoming message is coded with no event start time Note The vProduct variable will be blank for Operational products The variable will be populated for the remaining product types 2011 Weather Message Software Weather Message Server Setup 49 2 4 8 3 Options Tab The Options Tab allows you to setup user definable text that will be used to populate the UserDef1 short message code a Product Specification Product DEFAULT Default Specifications Short Message VTEC Message Options User Defined Variable 1 Start Sequence Discussion Stop Sequence J c J Enter the starting string sequence in the Start Sequence field and the stopping string sequence in the Stop Sequence field These seq
68. the status message box The status message shows new alarms as they are received You can select whether to show these messages in the color of the type of alarm that is being received Messages not related to arriving alarms are displayed with a white background and black text The Status Message Style can be set to Default background is white text is black Map Color background is text color text is map color or Text Color background is map color text is text color The Pop Up Style allows you to determine how WxMap window reacts to arriving alarms The settings are All All On Top Alarms and Never The All setting causes WxMap to popup the main window if it minimized The All On Top setting causes WxMap to popup the main window if it is minimized and makes the WxMap window the window that appears on top of all other open windows If you use this option any alarm will cause WxMap to appear on top of all other running programs and be the active program The Alarms setting uses the popup and on top 2011 Weather Message Software WxMap Client 159 option on the Alarm tab to determine when the main window should be displayed The Never setting causes WxMap to not popup a minimized window when an alarm arrives The Outline Line Size field specifies the size of the line used to outline counties that have newly issued products or expiring products The Password field allows you to set the password that will be
69. to see the ingest screen you will need to use the Show Ingest menu option in Weather Message Server Note Changing this option does not take effect until the next time the ingest programs are started The Log Received Files option causes the program to record the name of each weather file received The names are recorded in IBFiles txt The Purge Ingest Directories option when checked will cause the program to automatically purge the ingest directories after 24 hours The Log File Size field allows you to specify this size of your ingest log file IBLog txt The default is 50 000 bytes 7 3 3 Ingest Paths Tab The Ingest Paths Tab is used to define the directories that will store the received weather products for processing 2011 Weather Message Software 108 Weather Message Server oC WxWw2000 Setup Settings Common Ingest Paths Ingest Path WxMesgNet WxData RxFiles Additional Distribution Paths The Ingest Path is defined in the Weather Message Server setup screen and would not normally be entered here Note The Ingest Path can be changed if you want to deposit the received messages in a directory other than the one established for Weather Message Server The Additional Distribution Paths can be used to place a copy of the received weather text in different directories for processing by other programs For example if you use Weather Message to receive your weather data
70. using Internet Ingest as a backup data source the fields on the screen may not be updated They will resume showing data when the main serial port begins to receive data Note The program supports a second log file The second format uses a fixed field size for easy analysis This log file is never purged and remains until the user deletes the log files To enable this logging option create the directory NwsLogs in the c program files WxMesgNet directory 6 4 1 Software Demodulator Status The Software Demodulator Status screen can be displayed by opening the Demodulator s7 menu option and clicking on Demodulator Status This window displays status information from the software demodulator 2011 Weather Message Software WxEmwin EMWIN Ingest 93 Software Demodulator Status x m QPSK Receiver Data Source Status Etarte Side Lobe Detected No Carrier Frequency 37 240550 Symbol Track Freq 17968505859 Carrier Track Tracking Duration 3428 272348 Symbol Track Tracking Input Signal Level 324 050633 Front End Signal Present Estimated EbNo jo2 m Bit Processor Cesds Frames Seen 7499 Viterb Bits Decoded 61586344 Cesds Fill Frames 774 Viterbi Sync Errors j Uncorrectable Errors 25 Viterbi Symbol Errors ft 254308 Correctable Errors fi 64 Viterbi Average EsNo 4 30731 1 Note The Demodulator Status screen requires the Weather Message Demodulator service to be installed The Demodulat
71. values print the alarm and group settings and exit the program Export Settings Import Settings Print Settings Utilities gt Exit and Save Exit The Export Settings option will export all of the registry settings for the Weather Message programs They are exported to WxRegSet txt By exporting the registry settings you to easily backup the weather message directory and save all of your settings The Import Settings option will import the registry settings contained in the WxRegSet txt file After the registry entries have been imported the setup program will exit When you restart the setup program the imported registry values will be used You should stop all of the weather applications before importing settings The Print Settings option will print the alarm email fax and paging group setup information The Utilities option opens another menu with the following option e Change Archive Password This option will mass change all archive passwords The Exit and Save option saves any changed data and exits the program e The Exit option exits the program without saving any alarm changes The Support Setup menu allows you to change the systems settings 2011 Weather Message Software 14 Weather Message Server Fax Groups E Mail Groups Paging Groups Data Alerts Options Printer gt Special Prefix Product Specifications User Products WxWords e The Fax Groups option allow
72. will cause the software to create messages named Page asc in the C Program Files WxMesgNet WxData PageGate directory You should configure PageGate to scan this folder for messages 2011 Weather Message Software Weather Message Server Setup 29 The fields on the screen change based on the service type selected For TAP paging enter the service Telephone Number Baud Rate and Parity Bits For SNPP WCTP HTTP or TCP paging enter the service Address and SNPP Port WCTP Port HTTP Port or TCP Port Page Size Most paging devices have a limitation on the number of characters they can receive in one page If your provider has a limit on the size of messages this limit is should be entered in the Maximum Page Size field Entering 0 zero for Size will tell the system to not break the message down into packets Hint Some paging companies restrict the message size that can be sent to their pagers lt you exceed the size limitation the page request may be refused or rejected by the paging company If your page requests are being rejected try a shorter message length Note Due to message size limitations for the TAP protocol you will be required to enter a maximum page size between 1 and 1000 characters Retry Times In the event that a page cannot be delivered you can specify the number of times the software will attempt to deliver the message Enter the number of retries in the Failure Retries field Enter the
73. with a Registration Name and Registration Code Enter these exactly as they are printed These fields are case sensitive After the software is registered we recommend that you stop and restart the software To purchase the software go to http www wxmesg com purchpay htm 2011 Weather Message Software 120 Weather Message Server 9 9 1 Message Client Overview The Weather Message Message Client WxMcli is used to receive processed text and graphic products from Weather Message Server The Message Client can be installed on any computer attached to a TCP IP network Based on your alarms and settings the Message Client can popup a window play different sounds and read the alarm using text to speech The Message Client should be automatically started when your computer is started The Message Client runs from the system tray r Wg Weather Message Message Client lt e E File Silence Tet Request QuickList Product List Image Viewer Help Tornado Warning WUUSS2 KBMX 312004 a TORBMX ALC123 312019 O NEW KBMX TO W 9000 101031T2004Z 101031T2019Z BULLETIN EAS ACTIVATION REQUESTED TORNADO WARNING LEE COUNTY EMERGENCY MANAGEMENT AGENCY 304 PM CDT SUN OCT 31 2010 THIS IS A TEST TEST TEST OF THE LEE COUNTY SKYWARN WEATHER INFORMATION NETWORK LEESKYWIN Connected Weather Message Net 3 04PM Hint f the Password for Setup Exit option has been enabled t
74. your entry in WxWords would be To replace a semicolon with a comma your entry in WxWords would be In order to remove carriage return and line feed characters enter the line n The n string will match any carriage return line feed characters which can be replaced with nothing or any other character string include a blank space 2 4 11 Message Header Trailer The Edit Header Trailer window allows you to enter text that will be added to the beginning and ending of a fax email or pager message 2011 Weather Message Software 52 Weather Message Server Edit Header Trailer Email Header This is a severe weather alert Trailer Generated by Weather Message Software Save Delete Cancel The Header and Trailer are optional 2 5 Register Software The Register menu option allows you to register your software wz Register Software P Registration Name Registration Code ee s When you purchase Weather Message you will be supplied with a Registration Name and Registration Code Enter these exactly as they are printed These fields are case sensitive After the software is registered we recommend that you stop and restart the software To purchase the software go to http www wxmesg com purchpay htm 26 Maintaining Alarms 2 6 1 The Alarm Grid The alarm grid allows you to add edit delete copy paste and set alarms inact
75. 192 Weather Message Server For a Proxy access enter the domain name or TCP IP address of the proxy in the Host Name field Enter the Port number for the firewall If required enter a User Name and Password This should be a user name and password setup for the proxy If HTTP version 1 0 is required for the proxy server check this box The Detect Proxy button will automatically detect the proxy settings for your computer and populate the host name and port fields Note The Firewall Proxy settings are common to all Weather Message applications Changing these settings will automatically change them for the other applications 13 4 3 Ingest Paths Tab The Ingest Paths Tab is used to define the directories that will store the received weather products for processing m WxSchedule Setup Schedule Settings Ingest Paths Ingest Path WxMesagNet WVxData RxFiles Additional Distribution Paths Save Cancel The Ingest Path is defined in the Weather Message Server setup screen and would not normally be entered here The Additional Distribution Paths can be used to place a copy of the received weather text in different directories for processing by other programs For example if you use Weather Message to receive your weather data you can put a copy of the received messages in a second or third directory for processing by RealEMWIN or the Weather Message Retransmission program Note
76. 2 HTTP Post F Variables After selecting the Facebook Service Type click the Authorize button The following screen will appear 2011 Weather Message Software 256 Weather Message Server aCEDOOK B 4 on ne st 1 GVCCUVCVUNSN AUU nA L w f Facebook Login Log in to use your Facebook account with Weather Message Emaik Password Forgot your password Sign up for Facebook Enter your Email address Password and click Login Facebook will ask you if you want to authorize Weather Message Acknowlege that you want to give Weather Message Access Facebook will send Weather Message an access token that will be used to post updates Click Save and then Exit Create a Facebook Paging Group On the Paging Setup window right click in the grid and select Add Fill out the screen as shown below 2011 Weather Message Software Supplement 257 m Edit Paging Group Group Name FaceBook Group Create Group Pager Style Header Trailer Size 420 Edit Group Short Maximum 0 Message Parse Time Zone Central Service Name Facebook sJ Pin Entry Format pin space name 208 John Doe _ me Put each pager pinona separate line lt j Enter a Group Name for your Facebook group You can use any of the available styles see Paging E Mail Formats 246 for a description of each style The Size fiel
77. 2011 Weather Message Software 148 Weather Message Server The Print options prints an image of the map window The Exit option shuts down the Message Client Note f you enable the Password for Setup Exit you will have to enter the a password to access the setup screen or exit the program The Silence menu option allows you to stop a sound that is playing The Map menu allows you to make adjustments to the displayed map and see the active alarms Zoom In Fil zoom Out Fi2 Select Mode Drag Mode Zoom Mode Lock Map Reset Map Show Polygons Label Counties Dock Map Active Alarms The Zoom In option or F11 function key zooms in the map The Zoom Out option or F12 function key zooms out the map The Label Counties option when checked will label each county with their name The program attempts to fit the county name inside the county boundary If this is not possible the county name is not displayed Zooming in and out will effect whether a county name is displayed The Select Mode is the default mode This mode allows you to click on counties to see active weather products The Drag Mode changes the cursor to a hand and allows you to drag the map The Zoom Mode changes the cursor to a hand with a pointing finger This allows you to draw a box around an area and zoom in the drawn area The Lock Map option when checked locks the map When locked the map cannot be zoomed or moved
78. 27 x WZ Request Weather Message a Save Tet Quick List Product Code HWO OBMX Hazardous Weather Outlook FLUS44 KBMX 301555 HWOBMX m HAZARDOUS WEATHER OUTLOOK NATIONAL WEATHER SERVICE BIRMINCHAM AL 1055 AM CDT SAT OCT 30 2010 2LZ011 gt 015 017 gt 050 311600 MARION LAMAR FAYETTE WINSTON WALKER BLOUNT ETOWAH CALHOUN CHEROKEE CLEBURNE PICKENS TUSCALOOSA JEFFERSON SHELBY ST CLAIR TALLADEGA CLAY RANDOLPH SUMTER GREENE HALE PERRY BIBB CHILTON COOSA TALLAPOOSA CHAMBERS MARENGO DALLAS AUTAUGA LOWNDES ELMORE MONTGOMERY MACON BULLOCK LEE RUSSELL PIKE BARBOUR v Read Text E Mail Message Print Message Close The product codes are composed of a 3 character weather product code and either a 2 character state or forecast office code See Weather Forecast Offices for a list of the forecast office codes See Text Product Abbreviations for a list of weather product codes For example a special weather statement for Birmingham Alabama is coded SPSBMX This code can be entered in the Product Code field to get the last special weather statement issued Hint Requesting a product will automatically copy the product s text to the windows clipboard The Product Code field also contains a list of the last 20 products received To view and or select an item from this list click on the down arrow in the Product Code field The Read Text button will read the displayed message using Windows text to s
79. 55 Sel p Qusansi uma unu Aa uu aa aaaea eaaa aa a 156 SERVER Tab uwa a eaa aa aa aaa Aaaama Aae Eaa a Aar Aaaa naa area E Eaa Ea Aaaa sss Q Aaa deur ena aaeain aiaa iaaa E 156 Settings Tab seinare a aa aE a aaea aea A E ee E a Aaea a TaN 157 Alarms Tab uuu uueasqussusasacqhuassushassakasssqhasskaqdusqassapasasssaqaakassSssaqatusa sess akses qtuskt shasqaatapatasssssaqssaskasussphassqasasassska 159 Product Colors Tabb ncsisccccscvssiesissesettcatccssscsasciecsedestcsvesvntceseneedeecsoceiveredscseaterioodessessiesteeicaserscurensteadecsbersveveasctsenresssesuen 160 Product SOtUp exis cccatsevecey caved ccavousevtensasdea cuadegs setaa bev vecayngcdvaend dv cuavdideatdvaa ead ate reeset eave vedas deta denen iaar 161 Other Colors TaD usu s RSS aE a Ea aa Ea a a a a eaaa A a a Aaaa aaa a e E Ea aara eraa aa eaaa ELEA daS Teat 162 Map Base Tab sciccssrsccsicisesasssceiesscasecserectsacscsaussdeadussesebseviavencrsensusanpiavndsassesecssacpssbiusdavectscsaissdeususessedsadevectsdvavssdeadaneieus 163 Map Layers Tab E 164 Save Map Options Tab uuu rnein aa eaaa naecbedsaecegnanesctan dace bevecekeadscestccec aus sues eE aiai 165 Save Legend Options Tab s sisien eiaeaen eara aE aeara eanan Ean Ea CA EAEan Eea NO Pa AA Aaaa EAAS aeaa SEEE 166 Text to Speech ireen ennen aon saaana naaa anhaa aa anaa i ara Ea rana atapa aaa anai dupina aaas aaa aaia 168 Map Landmarks U U U U u u u u nnmnnn nnan u nnmnnn nnmnnn nnmnnn nnmnnn nnmn
80. 8 GOES 1202 OCONUS 1204 Sequence Number 13135048 0 Sequence Number 11267212 0 Received File TIGE59 Received File SRVT20 Last File TIGE57 Last File SXWA50 The main screen shows the status of incoming messages for each channel The Sequence field displays the last sequence number received The Received File and Last File fields displays the current and last file received Note f WxPort is stopped with the window minimized the next time it is started it will start minimized System Tray When WxPort is minimized you can restore the main screen by right clicking on the system tray icon then select open NoaaPort Channels WxPort implements the following NoaaPort channels Channel Address Port NWSTG 224 0 1 1 1201 GOES 224 0 1 2 1202 NWSTG2 224 0 1 3 1203 2011 Weather Message Software WxPort NOAAPort Ingest 113 OCONUS 224 0 1 4 1204 Copyright 2011 Weather Message Software 8 2 Menu Options s WxPort NOAA Port Ingest 3s 1s File Channels Help f Q C The menu buttons on this screen perform these functions The File menu allows you to setup this program view logfiles and exit the program Setup Logfiles b Received Files k Exit The Setup option opens the Setup window ho The Logfiles option displays a list of logfiles to review A logfile is maintained for the application and each NoaaPort channel e The Received Files option displays a list
81. 85 74417 500 Arial 29 77 87 1 500 Arial To add change or delete a landmark click on the line that you want to modify and right click then select the appropriate function Add Edit or Delete When adding or editing a landmark the Edit Landmark window is displayed 2011 Weather Message Software WxMap Client 169 11 10 2 Landmark Edit Landmarks Latitude mioni Fort Name Asal Longitude 85 74417 da ag UD Map Text Font Style k Font Color PPIP Label Background Notes Tallapoosa County Label OutLine Enter the Latitude and Longitude for the landmark This coordinate will be the center position for the landmark The Map Text field contains the text to be displayed on the map This field supports two special codes Enter a period to display a point appears as a small square on the map or a pound sign to display the current date and time The Map Range field allows you to specify the range at which the landmark should be displayed The program determines the number of miles the currently displayed map is in width This is the map range If the range you specify for this landmark is greater than or equal to the current map range it will be shown The Show Label option indicates whether you want a box drawn around the text Check this box to draw an outline The Notes field allows you to enter comments about this landmark This field is
82. A MD ME MI MN MO MS MT NC ND NE NH NJ NM NV NY OH OK OR PA PH PK PM PS PZ PR RI SC SD West Atlantic Ocean Northwest Atlantic Ocean Arkansas American Samoa Arizona California Colorado Connecticut District of Columbia Delaware Florida Georgia Gulf of Mexico Guam Hawaii lowa Idaho Illinois Indiana Kansas Kentucky Louisiana Lake St Clair Lake Erie Lake Huron Lake Michigan Lake Ontario Lake Superior Massachusetts Maryland Maine Michigan Minnesota Missouri Mississippi Montana North Carolina North Dakota Nebraska New Hampshire New Jersey New Mexico Nevada New York Ohio Oklahoma Oregon Pennsylvania Central Pacific Ocean N Pacific Ocean W Pacific Ocean S Central Pacific Ocean Eastern N Pacific Ocean Puerto Rico Rhode Island South Carolina South Dakota 243 2011 Weather Message Software 244 Weather Message Server 17 4 SL TN TX UT VA Vi VT WA WI WV WY St Lawrence River Tennessee Texas Utah Virginia Virgin Islands Vermont Washington Wisconsin West Virginia Wyoming Graphical Product Names ATPATHUS Atlantic Path CMPWLDUS Land Sea Temperatures and Clouds CRB1WBCA Day 1 QPF amp 850 HPA Winds CRB2WBCA Day 2 QPF amp 850 HPA Winds CRB3WBCA Day 3 QPF amp 850 HPA Winds CSA001US Caribbean Surface Analysis CUBARADR Cuba Radar FFG001US 1 Hour Flash Flood Guidance FFG003US 3 Hour Flas
83. ARNING WILL BE ISSUED TO PROVIDE CRITICAL INFORMATION RELATIVE SelectAll Clear File Name WxProd tet s _ 10 17 10 02 41 33 Message Creator has two modes of operation Expert and Simple The Expert mode allows you the most flexibility in creating a message The Simple mode is more suited for first time users Message Creator can create messages in a specific directory referred to as ingest path o or send them directly to the Weather Message Server t28 using TCP IP Hint The ability to send a message to Weather Message Server using a TCP IP connection allows the message client to be located across the internet or on another computer on the same network Copyright 2011 Weather Message Software 2011 Weather Message Software WxMesgText 173 12 2 Menu Options m 7 w WxMesgText Create A Bulletin f kl File Clear Counties Help Oe 8 The menu buttons on this screen perform these functions The File menu allows you to setup this program show details view logfiles and exit the program Open Save Save s Setup Exit The Open option opens a file dialog box for you to select a message template The Save option saves the message that you open with the original file name e The Save As option saves the message that you entered and allows you to enter a file name The Setup option opens the Setup o window e The Exit option shuts down the Messag
84. Auto Reconnect on Server Disconnect Auto Update Server List Weather Wire Backup Use Fixed Address Enable Version 2 7 ra ra ra ra Fixed Server Address 216 248 137 10 Timeout seconds on loss of data 15 The Enabled option should be checked for the Internet Ingest engine to automatically start when WxEmwin is started The Auto Reconnect on Server Disconnect option when checked will cause the Internet Ingest engine to try to connect to another server if it is disconnected from the current server This option is enabled by default and is the recommended setting 2011 Weather Message Software 100 Weather Message Server The Auto Update Server List option when checked will enable automatic maintenance of the available internet servers If Internet Ingest does not maintain this list you will need to manually update the WxSvrus txt file to include the servers that you want it to use Note When the Enable Byte Blaster Server Supporthod option is checked the program uses a fixed list of NWS Byte Blaster Servers These servers are configured in WxSatus txt The servers listed in this file are Byte Blaster servers that are connected directly to a satellite The Weather Wire Backup check box allows you to use Weather Wire as a backup for EMWIN Checking this box will cause the program to automatically start WxWW2000 when EMWIN data is not available This requires subscription and license for Weather W
85. Bell103 0 ES 1 0 1 SNPP Default SNPP Port 444 Connect Mode lv WCTP Default WCTP Port 80 C J G J Select the Serial Port that is attached to your modem The Modem Initialization box is used to enter the initialization string needed for your modem For SNPP Paging enter the Default SNPP Port number Most paging companies use port 444 for SNPP connections The Connect Mode option when check causes the software to remain connected to the SNPP server when sending a group of messages For WCTP Paging enter the Default WCTP Port number Modem Initialization Strings Modem initialization strings can be different for each modem manufacturer and in most cases are different The following generic strings can be used with most modems Generic AT amp FQ0V1 X48 amp D2 Generic 14 4 amp 28 8 AT amp FQOV1X4 amp D2N0S37 5 US Robotics AT amp FOQO0V1X4 amp D28 amp B1 amp KO amp MO0 amp N2 Some US Robotic modems will not communicate with computers at slow baud rates If you encounter problems with your US Robotics modem use the above initialization string and set the baud rate for your users and groups to 19200 In general your initialization string should do the following Send the attention command AT Load factory defaults amp F Turn echo off EO Enable result codes QO Display result codes as words V1 Enable extended result codes X4 could be X0 Enable modem hang up DTR change amp D2 In addition these options should b
86. C Portland WFO Portland WFO Medford WFO Portland WFO Pendleton WFO Philadelphia WFO Philadelphia WFO Central Pennsylvania State College WFO Central Pennsylvania State College WFO Philadelphia WFO Philadelphia BUF ENX EWR ISP JFK LGA NYC OKX ROC SYR CAK CLE CMH CVG DAY ERI ILN KTY LIO MFD OHL OHW TIR TOL YNG FDR FSM MKC OKC OUN SRX TSA TUA TUL TUR WNS AST BNO EUG MAX MEF MFR NMW PDT PDX PQR PTR RTX SIY SLE YKM ABE ACY CCX CTP DIX DOX 235 2011 Weather Message Software 236 Weather Message Server PA PA PA PA PA PA PA PA PA PA PA PA PA PR SC SC SC SC SC SC SC SC SC SD SD SD SD SD SD SD TN TN TN TN TN TN TN TN TX TX TX TX TX TX TX TX TX TX TX TX TX TX TX TX TX TX TX WFO Philadelphia WFO Central Pennsylvania State College WFO Philadelphia WFO Central Pennsylvania State College Middle Atlantic RFC State College WFO Philadelphia WFO Pittsburgh WFO Philadelphia WFO Philadelphia WFO Pittsburgh WFO Philadelphia Middle Atlantic RFC State College WFO Philadelphia WFO San Juan WFO Columbia WFO Greenville Spartanburg WFO Columbia WFO Charleston WFO Greenville Spartanburg WFO Charleston WFO Greenville Spartanburg WFO Charleston WFO Charleston WFO Aberdeen WFO Aberdeen WFO Sioux Falls WFO Sioux Falls WFO Rapid City WFO Sioux Falls WFO Rapid City WFO
87. DY WITH A SLIG CHANCE OF SHOWERS H LOWS IN THE MID 50S CHANCE OF RAIN 20 PE TUESDAY MOSTLY CLOUDY AND COOLER WITH A 60 TO 65 CHANCE OF RAIN 30 PERCENT WEDNESDAY AND THURSDAY MOSTLY CLOUDY WITH A CHANCE OF SHOWERS EACH DAY LOWS IN THE MID 40S HIGHS 60 TO 65 ERIDAY PARTLY CLOUDY LOWS T HE MID 40S HIGHS 6S TO 70 SATURDAY PARTLY CLOUDY LOWS NEAR 50 HIGHS IN THE MID 70S RCENT HANCE OF SHOWERS HIGHS E ALZ018 gt 020 022 gt 024 026 060930 CALHOUN CHEROKEE ETOWAH JEFFERSON PICKENS ST CLAIR TUSCALOOSA INCLUDING THE CITIES OF ANNISTON JACKSONVILLE BIRMINGHAM HOOVER CARROLLTON CENTRE GADSDEN PELL CITY ASHVILLE TUSCALOOSA 405 PM CST SAT APR 5 2003 TONIGHT VARIABLE CLOUDINESS WITH A SLIGHT CHANCE OF A SHOWER LOWS IN THE MID 50S LIGHT WINDS CHANCE OF RAIN 20 PERCENT SUNDAY MOSTLY CLOUDY WITH SHOWERS AND THUNDERSTORMS LIKELY BY AFTERNOON STORMS POSSIBLY SEVERE IN THE AFTERNOON HIGHS 73 TO 77 EAST WINDS 10 TO 15 MPH BECOMING SOUTHEAST IN THE AFTERNOON CHANCE OF RAIN 70 PERCENT SUNDAY NIGHT
88. E EXCLUSION OR LIMITATION OF INCIDENTAL OR CONSEQUENTIAL DAMAGES SO THIS LIMITATION AND EXCLUSION MAY NOT APPLY TO YOU VII HIGH RISK ACTIVITIES The Software is not fault tolerant and is not designed manufactured or intended for use or resale in computer systems in which the failure of the Software could lead directly to death or personal injury Author specifically disclaim any express or implied warranty of fitness for High Risk Activities VIII MISCELLANEOUS This Agreement represents the complete agreement concerning this license and may amended only by a writing executed by both parties If any provision of this Agreement is held to be unenforceable such provision shall be reformed only to the extent necessary to make it enforceable This Agreement shall be governed by the laws of the state of Alabama 2011 Weather Message Software
89. EC is only found in hydrologic products Note These settings are optional If they are left blank the software will alarm all products that match your other alarm criteria Note When you use the Hydrologic VTEC option the received message must contain the Hydrologic VTEC items you select otherwise the message will not be alarmed 2 6 2 2 Area Settings The Area Settings window allows you to further define the geographic area for your alarm This area is defined by entering the coordinates and radius for your area 2011 Weather Message Software Weather Message Server Setup 59 P Area Settings Latitude 32 61 Longitude 85 35 Radius in Miles 1 Look Up Address Latitude Lonaitude Save Cancel Enter the Latitude Longitude and Radius for the alarmed area The Look Up Address Latitude Longitude length can be clicked to launch a browser window that will allow you to lookup the latitude and longitude for an address Note Caution should be used when enabling the Area option This option requires the weather text to contain a LAT LON information line Incorrect settings can cause your alarm to fail 2 6 2 3 Wind Hail Settings The Wind Hail Settings window allows you to define a minimum speed and or Hail Size for the alarm Wind Speed and Hail Settings Wind Speed 65 MPH Hail Size 15 Inches Wind Speed and Hail Size specify the minimum Wind Speed and or Hail Size that
90. Entry Format address space name i Pactic gt john server com John Doe E Mail List 2563972994 page southemlinc com Danny A Put danny wxmesg com address ona separate line Enter the name of the group that you are creating in the Group Name field This name will appear in the alarm setup window as an available email group Select the Style of email to send Select Short for a short message Selected for selected text from the alarmed UGC group Selected No Head for selected text from the alarmed UGC group without the header Full for Full Text Full No Head for Full Text without header Hint The No Head style option removes the heading lines from the messages It removes all of the heading text from the first line in the message or UGC group down to the issued date time line The Subject Override allows you to override the default subject line with one of your choosing You can enter any text and embed the variable described below Subject The original subject description based on the subject style WFO The 3 character office designator extracted from the product identifier Productld The 6 character product identifier lssueTimeZ The product issue time in UTC followed by the letter Z ExpireTimeZ The product expiration time in UTC followed by the letter Z May be blank Message The text that is included in the body of the message Can be used for FaceBook updates The E mail messages can be broken down
91. Little Rock WFO Little Rock WFO Tucson WFO Flagstaff WFO Flagstaff WFO Flagstaff WFO Flagstaff WFO Phoenix WFO Phoenix WFO Phoenix WFO Tucson WFO Tucson WFO Sacramento WFO San Joaquin Valley Hanford WFO Eureka WFO Eureka WFO San Joaquin Valley Hanford WFO Los Angeles WFO San Joaquin Valley Hanford WFO Los Angeles WFO Los Angeles WFO San Francisco Bay Area Monterey WFO San Francisco Bay Area Monterey WFO Sacramento WFO Sacramento ACG ACR AEG AER AFC AFG AJK ALU APD FAI JNU NSB SWB WCM WCZ BHM BMX EVX HSV HTX HUN MGM MOB MSL PNS LIT LZK EMX FGZ FLG FSX INW IWA PHX PSR TUS TWC BBX BFL BHX EKA FAT FWF HNX LAX LOX MRY MTR RBL RDD 2011 Weather Message Software Supplement CA CA CA CA CA CA CA CA CA CA CA CA CA CO CO CO CO CO CO CO CO CO CO DC DC DC DC DC DC DC DC DC DC DC DC DC DC DC DC DC DC DC DC DC DC DC FL FL FL FL FL FL FL FL FL FL FL California Nevada RFC Sacramento WFO Sacramento WFO San Diego WFO Sacramento WFO San Francisco Bay Area Monterey WFO San Diego WFO Los Angeles WFO San Diego WFO Sacramento WFO Los Angeles WFO Sacramento WFO San Joaquin Valley Hanford WFO Los Angeles WFO Pueblo WFO Denver WFO Denver WFO Denver WFO Denver WFO Grand Junction WFO Grand Junction National Earthquake Center WFO Pueblo WFO Pueblo WFO Baltimore Was
92. MMDDYYHHMM followed by the extension for the file Path File Name Variables The following variables are supported in the path file name e MM for the current two digit month e DD for the current two digit day e YY for the current two digit year e YYYY for the current four digit year e UTCHOURS for the current UTC two digit hour e UTCMM for the current UTC two digit month e UTCDD for the current UTC two digit day e UTCYYYYS for the current UTC four digit year e FileName for the EMWIN base file name e Productld for the 4 to 6 character product identifier e FileExt for the file extension e Expire for the message expiration date and time e ExpireUTC for the message expiration date and time in UTC e lssued for the message issued date and time e lssuedUTC for the message issued date and time in UTC Hint The MM DD and YY variables can be used to archive files to a directory structure that includes one of the numeric date variables The variables are two digits in all cases and have a leading zero when single digit is encountered Note The software does not create directories You will need to create the directory structure prior to setting up the alarm Hint The program normally overwrites duplicate files You can use the No Overwrite Archive Option to add a sequential number between the file name and extension The Archive Option indicates whether the resulting message is ap
93. Nashville WFO Knoxville Tri Cities WFO Memphis WFO Memphis WFO Knoxville Tri Cities WFO Memphis WFO Nashville WFO Knoxville Tri Cities WFO San Angelo WFO Dallas Fort Worth WFO Amarillo WFO Austin San Antonio WFO Austin San Antonio WFO Brownsville WFO Houston Galveston WFO Corpus Christi Dallas WFO Dallas Fort Worth WFO Austin San Antonio WFO Dallas Fort Worth WFO El Paso WFO El Paso WFO Austin San Antonio WFO Dallas Fort Worth WFO Dallas Fort Worth West Gulf RFC Forth Worth WFO Dallas Fort Worth GED HAR ILG IPT JAA MPO PBZ PHI PHL PIT RDG RHA TTN SJU AGS AVL CAE CHS CLT CLX GSP NBC SAV ABR BRW FSD HON RAP SUX UNR BNA CHA MEG MEM MRX NQA OHX TYS ABI ACT AMA ATT AUS BRO CLL CRP DAL DFW DRT DYX ELP EPZ EWX FTW FWD FWR FWS 2011 Weather Message Software Supplement TX TX TX TX TX TX TX TX TX TX UT UT UT UT VA VA VA VA VA VA VA VA VA VA VA VA VT VT WA WA WA WA WA WA WA WA WA WI WI WI WI WI WI WI WY WY WY WY WY WY XX XX XX XX XX XX XX WFO Houston Galveston WFO Dallas Fort Worth WFO Houston Galveston WFO Houston Galveston WFO Lubbock WFO Lubbock WFO Midland Odessa WFO Austin San Antonio WFO San Angelo WFO Dallas Fort Worth WFO Salt Lake City WFO Salt Lake City WFO Salt Lake City Colorado Basin RFC Salt Lake City WFO Wakefield WFO Charleston WFO Wakefield WFO Blacksburg WFO Blacksburg
94. New Alarm Outline color specifies the border color for new products Click on the Color button to change this color The Expiring Alarm Outline color specifies the border color for expiring products Click on the Color button to change this color 11 8 6 Map Base Tab The Map Base Tab is used to set colors and options for the base map Weather Message Map Setup x Save Map Options Save Legend Options Server Settings Alarms Product Colors Other Colors Map Base Map Layers Base Layer Viewer Color Color Enable County Zones v Outline Color Enable Marine Zones v Line Size Polygon Style Outine gt s Background Color Polygon Line Size 3 w Transparency 100 Polygon Pattern Label Smart Size 900 Map Zoom Factor 5 The Viewer Color button allows you to change the color of the areas outside of the map This is normally the color of the oceans The Outline Color button allows you to change the outline color of the counties The Line Size field specifies the size of the line used to draw the county outline The Background Color button allows you to change the background of the counties The Transparency field allows you to control how the layer is painted over the viewer One hundred 100 is a completely transparent background while zero 0 is no transparent background The Label Smart Size value is used with the Label Counties option This value sets the min
95. Note f you are running the Message Client on the same computer as Weather Message Server the graphic products will be stored in two different directories One directory is used for the Server and another for the Message Client You can eliminate the double storage on the server by disabling the Receive Graphics option on the message client Then change the graphic directory path on the Image Viewer to the Servers graphic directory This should not be an issue for most users unless disk space is limited 10 6 2 Images Tab The Images Tab is used to 2011 Weather Message Software 144 Weather Message Server Images Category Category ltem Composite GOES Forecast Radar US Radar Other Hurricane Westem Pacific GMS005U5 10 Indian Ocean INDCIRUS 10 GOES 10 Full Disk G10FDIUS 10 Description Composite Description File Name Add Change Delete Add Change Delete Count To add a category enter the category description and click Add To change a category click on the category make any changes and click on Change To delete a category click on the category and press the keyboard delete key or click on the Delete button To add a category item first select the category Enter the category item description file name and count images to animate then click Add To change a category item first select the category then the category
96. PF QPS RCM RDF RDG REC RER RFD RFR RFW RHW RR1 RR2 RRA RRC RRM RRS RTP RVA RVD RVF RVI RVM RVR RVS RWR RWS RZF SAB SAF SAW SCC SCD SCS SDS SEL SEV SFD SFP SFT SHP SIM SLS SMF SMW SPE SPF SPS SPW SRF STA FX NO AC FO WW FO FS FS SD FO FO SX SX FN FR WW WO SR SR SR SR SR SR AS SR FG FG FI SR FG FG AS AW FP WW FN ww AC CX FP FU ww ww FX FP FP SM AT ww FN WH TX WT ww WO FZ NW Prognostic Meteorological Discussion Public Information Statement Post Storm Hurricane Report Probabilistic Tropical Cyclone Wind Speed Public Severe Weather Alert Probabilistic Tropical Cyclone Wind Speed Quantitative Precipitation Forecast Quantitative Precipitation Statement WSR 88D Radar Coded Message Revised Digital Forecast Revised Digital Guidance Recreational Report Record Event Report Rangeland Fire Danger Forecast Route Forecast Red Flag Warning Radiological Hazard Warning Hydrology Meteorology Data Report Part 1 Hydrology Meteorology Data Report Part 2 Automated Hydrologic Observation STA Report SCS Manual Snow Course Data Miscellaneous Hydrologic Data Special Automated Hydromet Data Report Max Min Temperature and Precipitation Table River Summary Daily River Forecast River Forecast River Ice Statement Miscellaneous River Product River Recreation Statement River Statement Weather Roundup Weather Summary Regional Zone Forecas
97. RAD Reflectivity RADSMSVY Lower Mississippi Valley RADSTHES Southeast RADSTHPL Southern Plains RADUMSVY Upper Mississippi Valley SESALLUS Earth View TRKATLUS Atlantic Tropical Cyclones TRKNEPUS Northeast Pacific Tropical Cyclones TRKNINUS North Indian Tropical Cyclones TRKNWPUS Northwest Pacific Tropical Cyclones TRKSEPUS Southeast Pacific Tropical Cyclones TRKSINUS South Indian Tropical Cyclones TRKSWPUS Southwest Pacific Tropical Cyclones TRKWLDUS Worldwide Tropical Cyclones User Defined Products Weather Message comes packaged with a list of weather products that are distributed on the Emergency Managers Weather Information Network EMWIN This list of products is contained in the file Product dat in the WxMesgNet directory From time to time new products are added to the data stream Software updates from Weather Message will automatically update this file with new products Some users have the need to change the name of products or create unique product identifiers for their specific applications User defined products could be used for locally generated products or with the Weather Message Message Creator 8 application User defined products are supported by updating the file ProductUser dat located in the WxMesgNet directory The ProductUser dat file contains a list of user defined products or products that override the default products in Product dat For example you could define the product identifier LWS as Local Weather
98. ServI66Sxuxu usu u uum s cc E teeeascaas clues e EAA avaescivsdeant SN r livin AS Paging Group ais a RREA he Data Alert uy Du E E E A E E OpBtUOnS vesceesccscecaceedecetstdeccesscvateuses ec cguscctenced Aecectserccesducacezecsseeceusnedeiedicedecssassecenutacs cota snvducsstesteateswcvetssteccudecnteces General Tabirin inasnan AEA AEA AAR AAA EA EA DAA r AAE AATAS ERA ani deria PROGUCU 1 Tab T E E E A A E T Collectives TaBe aeaa a anaE civ 03s thea al Eaa a a ya SN aa eo EE o u uu A A A E AE E A A T Protocols Tab Firewall Proxy Purge Tab aus puas n um Perr cee re re Aaa ee rric tr rrrecrerevrer iris aa rere Sus p aa ana creer erty re STA AID AARE EAE EIT ETE T AA isa aasan assay asa TE Printer 0 E E E E E E E E A E E E A E SpecgialiPrefiX uuu au uuu seedies cccenpcateande siezecssedecesdesatescescd ospea coed tsesnezstzacesdupaiszenscuccdsseededessedceststccestes Product Specifications Short Message FADE u uu nm asss r aaen deanas E Ee ARPA A R sti AE AeneA AEA Aara e Sn ANAE EAr E A REE 44 VTEC Message Tab uu u u u uusha Eiai EEES Era Ei ESEA pa AE a a a AS LAES 48 Options Tab ae ue Hines 49 User PrOGUCIS EET E E 49 WxWO0I08 E P EET E A E E 50 Message Header Trailer l u uuu uuu UU TU aaa au awussssssswassasasasssswasusaukuspaskaspasasasssasssussskuss 51 2011 Weather Message Software ll Weather Message Server 5 Regist r SOMWAIC uuu u Aus bali hide ssh sassa Sae aaaea Aaaa gl Qa
99. Statement You could also override the AQA Air Quality Message to change the description to simply Air Quality Changes and or addition of products should be made by updating the ProductUser dat file This insures that future software updates will not overwrite your unique product identifiers or product changes Note For products to alarm properly the product identifier must exist in the Product dat or ProductUser dat file Entering an alarm for a non existant product identifier will cause the alarm to not work The ProductUser dat file has the following layout 3 character product id 2 character wmo prefix 1 digit has UGC lin values O no 1l yes 1 digit has VTEC lin values 0O no 1l yes Bit mask for product specifics 2011 Weather Message Software 246 Weather Message Server None 0 Has Both CZ 1 Has Latitude Longitude 2 Has Time Mot Loc 4 Has Wind Hail 8 Description The description should not contain a comma Here are example entries LWS XX 0 0 0 Local Weather Statement SIR NO 0 0 0 Siren Activation Statement SVR WU 1 1 14 Severe Thunderstorm Warning In the last example the product identifier is SVR The WMO identifier is WU The product has a UGC line 1 The product has a VTEC line 1 For product specifics it has 14 Fourteen comes from the addition of Has Latitude Longitude 2 Has Time Mot Loc 4 and Has Wind Hail 8 The description of the product is Severe T
100. Status txt in notepad e The View Internet Log displays the serial ingest log file WiLog txt in notepad The View Internet Files Received displays the received files log WiFiles txt in notepad e The Exit option shuts down WxEmwin Note n order to view the Files Received Log the Log Received Files option must be enabled The Port menu when present allows you to switch between the main serial port and a backup serial port The Demodulator menu when present allows you to interact with the EMWIN Software Demodulator provided by the National Weather Service Demodulator Status Stop Data Source Service Stop Demodulator Service Launch Control Panel The Demodulator Status opens the software demodulator status window The Stop Data Source Service or Start Data Source Service option stops or starts the software demodulator data source service The Stop Demodulator Service or Start Demodulator Service option stops or starts the software demodulator data source service The Launch Control Panel option launches the software demodulator control panel 2011 Weather Message Software WxEmwin ENWIN Ingest 89 Note When using the EMWIN Software Demodulator both the EMWIN Data Source and Demodulator service must be running Note The Demodulator Status screen requires the Weather Message Demodulator service to be installed The Demodulator service distributed by the National Weather Service does n
101. TP or FTP servers to respond The FTP Use Passive Mode option when checked will cause the ftp program to use the passive mode This option may be needed for firewalls that restrict incoming connections 2011 Weather Message Software WxLoader 213 The Auto Startup option allows you to specify whether WxLoader is automatically started when Windows starts The options are No Yes for the current user and Everyone for any user Note The options available for Auto Startup are based on your user permissions Administrator and Power users will have all of the options Other users may only have the Yes option The Firewall Proxy button allows you to configure Firewall and Proxy settings for your computer See Firewall Proxy 38_ 15 5 2 1 Firewall Proxy The Firewall Proxy window allows you to configure firewall proxy information for your computer Firewall Proxy Settings Firewall Ftp Firewall Http Proxy Host Name Port 0 User Name Password Type 3 Socks5 J G J For a FTP firewall enter the domain name or TCP IP address of the firewall in the Host Name field Enter the Port number for the firewall If required enter a User Name and Password This should be a user name and password setup in the firewall Select the Type of firewall Valid entries are 1 Tunnel 2 Socks version 4 or 3 Socks version 5 2011 Weather Message Software 214
102. Topo J Radar Z Counties Rivers V Highways 7 Cities J Warnings V Legend National Weather Service WSR 88D Image from BMX 10 31 2010 02 30 UTC 9 30 lawrenceburg 24 ference Huntsville Gadsden 9 35 PM RADBMXAL gif copied to ingest When scheduling radar images the images that are received will be copied to directories for other programs to process You can use it in conjunction with Weather Message to FTP images to a website or WxReTran for EMWIN retransmission See Scheduling lo Images processed by Weather Message Server can be made available to the Weather Message Client Image Viewer The Image Viewer can then be used to animate the received radar images Note If WxRadar is stopped with the window minimized the next time it is started it will start minimized System Tray 2011 Weather Message Software WxRadar 199 When WxRadar is minimized you can restore the main screen by right clicking on the system tray icon Bg then select open Copyright 2011 Weather Message Software 14 2 Menu Options u WxRadar e fo File Schedule Retrieve Now Help State AL Radar Site KBMX BIRMINGHAM Alabaster v The menu buttons on this screen perform these functions The File menu allows you to setup this program view logfile print the current radar image and exit the program Setup view Log Print Clear Cache Exit The Setup option opens the
103. Tropical Prediction Center Network Control Facility World Weather Building Weather Message ENS MSG NFD PAN PBP SPC SPN SST THR VHW VRH VUY WCA WNC WNO WXM Text Product Abbreviations 18A 24A 30L 3HR ADA ADM ADR ADV ADW ADX AFD AFM AFP AGF AGO AHO ALT APG AQA AQI ASA AVA AVM AVW AWG AWS AWU AWW BOY CAE CCF CDW CEM CF6 CFW FB 18 Hour Report FB 24 Hour Report FE Monthly Weather Outlook FO 3 hourly Space Weather Conditions and Forecast NO Alarm Alert Administrative Message NO Alert Administrative Message NO Administrative Message NW Official Space Weather Advisory NO Administrative Message for NWWS NT Administrative Alert Non Receipt FX Area Forecast Discussion FO Area Forecast Matrices FL Area Forecast Product FN Agricultural Forecast SH Agricultural Observations UR Air Force High Density Obs WO Space Weather Message Alert AE Air Stagnation Guidance Narrative AE Air Quality Message AE Air Quality Index Statement AE Air Stagnation Advisory WO Avalanche Watch NO Aviation Verification Matrix WO Avalanche Warning WO National Attack Warning AW Area Weather Summary FL Area Weather Update WW Aviation Weather Warning SS Buoy Reports WO Child Abduction Emergency FP Coded City Forecast WO Civil Danger Warning WO Civil Emergency Message CX Climate F 6 products WH Coastal Flood Warnings Watches or Statements 2011 Weather Message Software Supplement
104. Weather Message Net icf This screen is almost identical to Weather Message Server See Weather Message Server 72 for field level details It includes a status bar that shows when you are connected to Weather Message Server and the name of the server 2011 Weather Message Software Weather Message Controller 81 42 Menu Options ig Weather Message Server Controller 3 7 File Help The menu buttons on this screen perform these functions The File menu allows you to setup the controller server view connections log files and exit the program Setup Server Setup View Connections Connect Server 1 Connect Server 2 Start Service view Logfile View Email Log view Pager Log view Fax Log Exit The Setup option displays the setup options for Weather Message Server Controller The Setup Server option launches the Weather Message Server Setup 12 application The View Connections option displays a window with the Active Connections 75 The Connect Server 1 option starts a connection to the address defined for Weather Message Server 1 The Connect Server 2 option starts a connection to the address defined for Weather Message Server 2 This option will only appear if an address has been defined for a second Weather Message Server The Start Service option will appear if Weather Message is running as a service and needs to be started This option will change to Stop Servi
105. Weather Message Server Host Name Port Fora HTTP firewall enter the domain name or TCP IP address of the firewall in the Host Name field Enter the Port number for the firewall If required enter a User Name and Password This should be a user name and password setup in the firewall Select the Type of firewall Valid entries are 1 Tunnel 2 Socks version 4 or 3 Socks version 5 For a Proxy access enter the domain name or TCP IP address of the proxy in the Host Name field Enter the Port number for the firewall If required enter a User Name and Password This should be a user name and password setup for the proxy 2011 Weather Message Software WxLoader 215 If HTTP version 1 0 is required for the proxy server check this box The Detect Proxy button will automatically detect the proxy settings for your computer and populate the host name and port fields Note The Firewall Proxy settings are common to all Weather Message applications Changing these settings will automatically change them for the other applications 15 5 3 Tasks Tab The Tasks Tab is used to maintain WxLoader tasks m L Setup xa Server Program Options Tasks Roundup Test Edit Task Delete Task Save Cancel The Add Edit and Delete Task buttons are used to create change and remove tasks You can also edit tasks by double clicking
106. XVI 1 Part XVII N O Q WD Fl rricane Graphigu u k u uu uuu ate ledceedutbcedieceetesseenzecteedegiesudssteecovvuuseadueedueddes sbietestitscerstesuesboeetuseexuayevvecsenvage 193 SOMITE aI ple ss uu u orian eaae aaaea aana oaa aan iiaea EAEE EEan dues a aaa Ea SE a 194 WxRadar 198 DATLI BYIN A E E E E does E E E E EE E E E EE E E E 198 Men Options nscsnsu L aala Deane apu usasqa a aaa aeaa Oaa ara Eae 199 Main WAN OW u L adi Uu u a aa a Aaaa g ask asa a aai aaa aiaa 200 Scehed ling a uU UU UU vane suueduavsdeudaueabav ease sti suaerunodsaueuteisubesvauvvanruwuouvsararein 201 Setup uu su Q S Su u mia u s a u e 203 S ttings Tabir uu ASS vecessasstessauesusesseessuacdvsesstessecerecessecs ese s 203 Firewall PVOXY lt cs0esdecnsxscsdesceaeesscessceasetsassiusateascenosthesaccnacsaaaeeattsnsnsasstsapcedeeteaus asa ua au assaka a ag uu aa 204 Ingest Paths Tab isis ciccscssccstisseletescceccecadiccereeassiscccetedsacuesacssncedabctagensaccecabertaadeuevesoayensisaddesausissuestassesseusteadcenaassssuencai ye 205 WxLoader 208 OVerVieW siioni sub sqa sd dette A cee dele eee as ae 208 Men 0 00 5 aes 209 Main WINDOW LL uuu aaa cies Cees cds ci haga oiled be cdeunueucueedaducdscdusbeceuscudswes 210 Alain uuu u cc creda m asas s aan a aaaea OL daaa aaaea aE aN 210 Set p RS RE SS PS oD om a 211 Server Tab Junas sence eS ee a a aea a aa Ea EEE Saa aaae a E a a E E 211 Program Options Tab uuu ec ceectcececensacesaistess
107. ability fitness for a particular purpose and non infringement The entire risk as to the quality and performance of the Software is borne by you Should the Software prove defective you and not Author assume the entire cost of any service and repair In addition the security mechanisms implemented by Author software have inherent limitations and you must determine that the Software sufficiently meets your requirements This disclaimer of warranty constitutes an essential part of the agreement SOME JURISDICTIONS DO NOT ALLOW EXCLUSIONS OF AN IMPLIED WARRANTY SO THIS DISCLAIMER MAY NOT APPLY TO YOU AND YOU MAY HAVE OTHER LEGAL RIGHTS THAT VARY BY JURISDICTION I SCOPE OF GRANT You may e use the Weather Message Server on one computer e use the Weather Message Message Client and Map Client on any number of computers up to the capacity of Weather Message Server e copy the Software for archival purposes provided any copy must contain all of the original Software s proprietary notices You may not e permit other individuals to use the Software except under the terms listed above e modify translate reverse engineer decompile disassemble except to the extent applicable laws specifically prohibit such restriction or create derivative works based on the Software e rent lease grant a security interest in or otherwise transfer rights to the Software or e remove any proprietary notices or labels on the Software IV TITLE T
108. ado warning will be used in the examples WFUS54 KBMX 192255 TORBHM ALCIIS 1922330 BULLETIN EAS ACTIVATION REQUESTED TORNADO WARNING ATIONAL WEATHER SERVICE BIRMINGHAM AL 5 5 PM CST WED MAR 19 2003 HE NATIONAL WEATHER SERVICE IN BIRMINGHAM HAS ISSUED A 2011 Weather Message Software Supplement 2 TORNADO WARNING FOR 47 DOPPLER RADAR INDICATED A ST AT 25 MPH THIS STORM TAKE COVER IN AN INTERIOR BANDON MOBILE HOMES AND RUSSELL COUNTY IN SOUTHEAST ALABAMA UNTIL 530 PM CST AT 455 PM CST NATIONAL WEATHER SERVICE TORNADO NEAR FOR ITCHELL MOVING NORTHEA WILL AFFECT RURAL EASTERN RUSSELL COUNTY IF YOU ARE NEAR THE PATH OF THIS TORNADO ROOM ON THE LOWEST FLOOR OR A BASEMENT A VEHICLES FOR MORE SUBSTANTIAL SHELTER CALL 1 800 856 0758 TO REPORT SEVERE WEATHER LAT LON 3229 8514 3213 8504 3226 8492 3247 8499 The Full option will send the message above exactly as printed The Full No Head option will be sent without the heading information Here is an example THE NATIONAL WEA THER S ERVICE TORNADO WARNING FOR IN BIRMINGHAM HAS ISSUED A
109. age Server setup screen and would not normally be entered here Note The Ingest Path can be changed if you want to deposit the received messages in a directory other than the one established for Weather Message Server The Additional Distribution Paths can be used to place a copy of the received weather text in different directories for processing by other programs For example if you use Weather Message to receive your weather data you can put a copy of the received messages in a second or third directory for processing by RealEMWIN or the Weather Message Retransmission program Note Changing the Ingest and Additional Distribution Paths on this screen will automatically change them for WxPort and WxWW2000 2011 Weather Message Software 104 Weather Message Server 7 7 1 WxWw2000 Weather Wire Ingest Overview WxWW2000 is used by Weather Message for Internet or serial port Weather Wire data feeds The ingest program can be started automatically by the Weather Message Server or manually 2 WxWw2000 Weather Wire Ingest E File Source Help Status Data Source Internet Connected Received File RWROR 21 11 14 Last File RR3ACR 21 11 14 Connected The main screen shows the status of incoming messages The Data Source field shows type connection type Internet or Serial Port The Received File and Last File fields display the product identifier of the current and last files received
110. age Software 94 Weather Message Server Symbol Track Frequency Displays the current symbol frequency being tracked by the software demodulator This value will vary between the limits entered in the Software Demodulator Control Panel Duration Displays the time in seconds that the software demodulator has been running Input Signal Level Displays the internal received signal level Estimated EbNo For QPSK displays the estimated energy per bit to noise power spectral density ratio It is a normalized signal to noise ratio Low High Signal For FSK indicates whether the low and high signals are present Bit Processor CCSDS Frames Seen Displays the number of received packets CCSDS formatted packets represents a standard established by the Consultative Committee for Space Data Systems CCSDS Fill Frames Displays the number of received packets that do not contain any data Uncorrectable Errors Displays the number of received packets that could not be corrected This number should remain zero or close to zero Numbers here indicated lost packets Correctable Errors Displays the number of received packets that could be corrected Viterbi Bits Decoded Displays the number of viterbi bits decoded The QPSK receiver uses a viterbi decoder A viterbi decoder uses the Viterbi algorithm for decoding a bitstream that has been encoded using Forward error correction based on a Convolutional code Viterbi Sync Error
111. all Select the Type of firewall Valid entries are 1 Tunnel 2 Socks version 4 or 3 Socks version 5 2011 Weather Message Software WxRadar 205 Firewall Proxy Settings Firewall Http Proxy Host Name 192 168 0 1 HTTP Version 1 0 Port 87 User Name Password Detect Proxy See caj For a Proxy access enter the domain name or TCP IP address of the proxy in the Host Name field Enter the Port number for the firewall If required enter a User Name and Password This should be a user name and password setup for the proxy If HTTP version 1 0 is required for the proxy server check this box The Detect Proxy button will automatically detect the proxy settings for your computer and populate the host name and port fields Note The Firewall Proxy settings are common to all Weather Message applications Changing these settings will automatically change them for the other applications 14 5 2 Ingest Paths Tab The Ingest Paths Tab is used to define the directories that will store the received weather products for processing 2011 Weather Message Software 206 Weather Message Server G WxRadar Setup etings r Pathe Ingest Path _ WxMesgnet wxdata niles Additional Distribution Paths The Ingest Path is defined in the Weather Message Server setup screen and would not normally be entered here The Additional Distribut
112. along with the their respective received times Note Before WxWw2000 will connect to an Internet server you must enter your user name and password in the setup screen For more information about Weather Wire and registering see What is Weather Wire To obtain a user name and password go to this web address https oi weatherwire net Note f you are using the Internet ingest option the program will alternate the program icon in the system tray to let you know that it is connected Note f WxWw2000 is stopped with the window minimized the next time it is started it will start minimized System Tray When WxWw2000 is minimized you can restore the main screen by right clicking on the system tray icon then select open Copyright 2011 Weather Message Software 2011 Weather Message Software WxWw2000 Weather Wire Ingest 105 72 Menu Options 3 WxWw2000 Weather Wire Ingest 6 File Source Help tatus w The menu buttons on this screen perform these functions The File menu allows you to setup this program show details view logfiles and exit the program Connect Setup View Logfile View Files Received Log Exit The Connect option starts a connection to the Internet servers The Setup option opens the Setup window ho The View Logfile displays the ingest log file in notepad The View Files Received Log displays the received files log in notepad The Exit o
113. ate Greater field sets the error rate percentage for switch over to backup This field can be set from 5 to 95 percent Should the error rate of the received data exceed the set amount the program will switch over to the backup port or Internet Ingest If the main port stops sending data for 15 seconds the program will switch to the backup port if one is specified If the backup port does not send data for 15 seconds it will switch to Internet Ingest if Internet Backup is enabled If the backup port is not specified it will switch from the main port directly to Internet Ingest Based on the Switch Back Time specified it will change back over to the main port The process will start all over again If no data is received in 15 seconds it will switch to the backup port and or Internet Ingest Note Once Internet Ingest is started it will not be stopped until Serial Ingest begins to receive valid data from one of the serial ports When the program switches from Serial Ingest to Internet Ingest it will create a notification message in each ingest directory The product identifier for this message is ADMWXM If you 2011 Weather Message Software 98 Weather Message Server want to be alerted when the program switches between ingest sources alarm the product ADMWXLM with no state or county selected The notification message contains the current ingest method and computer name Should the serial port stop sending
114. ation for WxMap 2011 Weather Message Software 158 Weather Message Server Weather Message Map Setup Save Map Options Save Legend Options Server Settings Alas Product Colors Other Colors Map Base Map Layers Password for Setup Exit Password lt Enable Popup Selection V Auto Startup Show Lat Long Single Instance J Small Map Legend 1 Show in Task Ba E Map Legend Style Dynamic2 Status Message Style Default X Pop Up Style A Outline Line Size 2 gt The Password for Setup Exit option allows you to require a password to access the Setup menu or exit the program The Enable Popup Selection when checked will give the user the capability to enable or disable the applications popup operation The Enable Disable option will appear on the system tray menu The Show Lat Long when checked displays the latitude and longitude for the mouse cursor in the status bar The Small Map Legend when checked will reduce the size of the buttons that appear in the map legend The Map Legend Style determines the style of the map legend Static displays all products in the legend that have the Include In Legend option checked Dynamic 1 only displays active products in the legend that have the Include In Legend option checked Dynamic 2 displays all active products in the legend The Status Message Style allows you to select the color scheme used for
115. ax to send Select Selected for selected text from the alarmed UGC group Selected No Head for selected text from the alarmed UGC group without the header Full for Full Text Full No Head for Full Text without header Hint The No Head style option removes the heading lines from the messages This option removes all of the heading text from the first line in the message or UGC group down to the issued date time line The Subject Style allows you to specify how the fax subject line is formatted Full gives you the description for example Tornado Warning Product gives you just the product AWIPS code for example TORBHM The None option causes the faxing program to not include a subject line The Subject Override allows you to override the default subject line with one of your choosing You can enter any text and embed the variable described below Subject The original subject description based on the subject style WFO The 3 character office designator extracted from the product identifier Productld The 6 character product identifier lssueTimeZ The product issue time in UTC followed by the letter Z ExpireTimeZ The product expiration time in UTC followed by the letter Z May be blank The Parse option can be used to reduce the size of the fax messages sent Selecting Y tells the system to parse the messages for this group against the WxWords word substitution file Enter the fax telephone numbers in the Fax List box
116. bal Ingest Paths option controls whether WxPort uses global ingest paths Global ingest paths are shared between all of the ingest programs Unchecking this box will allow you to define ingest paths that are different from the global ingest paths 2011 Weather Message Software WxPort NOAAPort Ingest 115 The Binary Files option allows you to specify now WxPort processes messages that contain binary data They can be saved with the extension txt bin or dropped The Save GOES Images option indicates how you want the GOES images saved The options are No BMP JPG PNG and TIF The Name by AWIPS option when checked causes the program to name the received files using the AWIPS identifier found in the message followed by the originating station s state abbreviation When it is not checked the received files are named using the first 3 characters of the AWIPS identifier followed by the originating station s 3 character abbreviation followed by the originating station s state abbreviation 8 3 2 Common Tab The Common Tab is used to define options common or shared by all ingest programs g WxPort Setup Settings Common Fitters Ingest Paths Run in Background Log Received Files v Purge Ingest Directories V Log File Size 500000 Save Cancel The Run in Background check box allows you to specify whether you want the ingest programs to run in the background When this box is checked the ingest p
117. be the time that you want paging emailing or faxing stopped in this example 22 00 From 22 00 2011 Weather Message Software 64 Weather Message Server through 07 00 messages will be held until 07 00 At 07 00 any held messages will be evaluated and the last one received for a product will be sent Any messages that arrive from 07 00 through 22 00 it will be paged emailed or faxed as soon as they arrive Note For Hold Last restriction the system groups the held messages using the original product identifier and group name It sends the last message received for the product and group When the Time Restrict option is used you must select the Days of Week that you want the message sent Check the days that you want the message sent If a day is unchecked the message will not be sent 2 6 5 Archive Html Exe Print Tab The Archive Html Exe Print tab is used to specify an alarm action for these categories Fi Edit Alarm 1 TORBMX List Products List Forecast Offices List States Aam Cient Map X10 Paging Emai Fax Archive Htmi Exe Print Notes Archive Action Ful FTP HTTP HTML Setup Archive Type Local Archive Path ftobmchtm sid Archive Option Overwrite Execute Program Print Action No The Archive Action field indicates the style of message to archive Select No for no archiving Short for a short message Selected for selected text from the
118. ce The Use Defined Ingest Paths check box when checked will cause the program to use the 2011 Weather Message Software 190 Weather Message Server ingest paths defined in the ingest programs If you want to define your own ingest paths for the scheduler uncheck this box The Timeout field allows you to specify the maximum amount of time the program will wait for the HTTP or FTP servers to respond The Log File Size field allows you to specify this size of your log file SchedLog txt The default is 50 000 bytes The FTP Use Passive Mode option when checked will cause the ftp program to use the passive mode This option may be needed for firewalls that restrict incoming connections The Auto Startup option allows you to specify whether WxSched is automatically started when Windows starts The options are No Yes for the current user and Everyone for any user Note The options available for Auto Startup are based on your user permissions Administrator and Power users will have all of the options Other users may only have the Yes option The Run as a service option when checked will setup WxSched to run as a Windows service When this option is selected WxSched will be automatically started as a service when the WxSched application is exited When WxSched is started again the service will be stopped so that you can change the programs settings Note WxSched will continue to process your s
119. ce if the service is presently running The View Logfile displays the server log file in notepad The View Email Log displays the email log in notepad The View Pager Log displays the pager log in notepad The View Fax Log displays the fax log in notepad The Exit option shuts down Weather Message Server Controller Note The View Logfile Email Log Pager Log and Fax log options will only be displayed when 2011 Weather Message Software 82 Weather Message Server there is a log file to view The Help menu allows you to see this manual and display information about the program Weather Message Help About Weather Message on the Web E Mail Program Support 43 Setup The Setup window allows you to set general program operations Weather Message Server Control Setup xs Server 1 Address Server 2 Address Auto Startup No The Server 1 Address field is normally left blank When it is blank the program will attempt to connect to Weather Message Server running on the local computer If Weather Message Server is not running on the local computer enter the TCP IP address of the server in this field The Server 2 Address field can be used to monitor a second Weather Message Server Enter the address for the second server The Auto Startup option allows you to specify whether Weather Message Server Controller is automatically started when Windows starts The options are No Yes for th
120. ces button is used to setup paging service providers Paging services must be established before adding paging groups See Paging Services 28 The Create Pager Header Trailer button allows you to create text that will be added to the beginning and end of selected and full pager messages See Message Header Trailer s51 for an example When you click on this button a screen will be displayed for you to enter the header trailer If you only want a header trailer message for specific groups see the Editing Paging Groups section Note Weather Message removes all control characters from messages sent to a pager Most paging companies do not allow embedded control characters Hint Clicking on one of the column headers will sort the list for that column To edit an existing group double click the group For other options select the group and right click to see these menu options Add Edit Delete Copy The Add option will add a new group The Edit option will edit the selected group The Delete option will delete the selected group The Copy option will copy the selected group The Paste option will paste the last copied group as a new group 2 4 3 2 Paging Options The Paging Options window allows you to set modem SNPP and WCTP information 2011 Weather Message Software Weather Message Server Setup 27 a Paging Options Modem Serial Port l3 Modem Initialization AT amp FQ0V1X48D2 MS
121. ch The Print option if checked will print out the received weather product to your default printer The Execute Program option allows you to start a third party program when an alarm occurs Enter the full path and program name for the third party program The Message Client can create a temporary file with the text so that it can be passed to the external program as a command line argument To do this put one space after the program name and enter the characters 1 For example to start Notepad each time an alarm is triggered enter Notepad exe 1 in the Execute Program field Hint f the path to the executable contains a space you should enclose the path and program name in quotes For example c program files myprogram exe 1 The Color button allows you to select a foreground and background color for the weather product description Left click to change the background color Right click to change the foreground color The Pop Up Client option specifies whether Message Client pops up a minimized window when this alarm arrives The Client On Top setting can be used to make the Message Client window the window that appears on top of all other windows If you use this option an alarm will cause Message Client to appear on top of all other running programs 9 7 5 Product Colors Tab The Product Colors Tab is used to 2011 Weather Message Software 134 Weather Message Server Product Colors
122. chedule regardless of whether it is running as a service or an application The Firewall Proxy button allows you to configure Firewall and Proxy settings for your computer See Firewall Proxy 38_ 13 4 2 1 Firewall Proxy The Firewall Proxy window allows you to configure firewall proxy information for your computer Firewall Proxy Settings Firewall Ftp Firewall Http Proxy Host Name Port 0 User Name Password Type 3 Socks5 Save Cancel For a FTP firewall enter the domain name or TCP IP address of the firewall in the Host Name 2011 Weather Message Software WxScheduler field Enter the Port number for the firewall If required enter a User Name and Password This should be a user name and password setup in the firewall 191 Select the Type of firewall Valid entries are 1 Tunnel 2 Socks version 4 or 3 Socks version 5 Fora HTTP firewall enter the domain name or TCP IP address of the firewall in the Host Name field Enter the Port number for the firewall If required enter a User Name and Password This should be a user name and password setup in the firewall Select the Type of firewall Valid entries are 1 Tunnel 2 Socks version 4 or 3 Socks version 5 Firewall Ftp Firewall Http Proxy Host Name HTTP Version 1 0 F Port User Name Password 0 2011 Weather Message Software
123. click on the up or down buttons adjacent to the Type field Click on the Browse button to select a wave file Each wave file can be played Once for 1 minute or Continuous To hear the sound associated with the alarm click the Play Wave File button Alarms can be silenced by clicking on the Silence button The number of the alarm to be played is determined when the Alarm is established in Weather Message Server Setup The Wave Option controls how WxMap plays sounds for matching alarms For standard wave files select Play Wave to play sounds based on product identifier select AWIPS to Wave to announce the product using text to speech select Read Short and to read the received message using text to speech select the Read Text option Note The text to speech options work on Windows XP and later operating systems The Product to Wave option is used when you want a specific sound to be played based on the product identifier When using this option you will create a wave file that has the same name as the product identifier This wave file should be saved in the Sounds directory located in the WxMesgNet directory When this option is enabled the program will look for a wave file in the Sounds directory that is named like the product being received It will first look for the complete 6 character product identifier and play that file If the 6 character product identifier is not found it will look for a file with the first 3 characters of t
124. clicking on the Port menu option The Total Blocks field shows the total number of blocks received for a one hour period the Bad Blocks field shows how many of the total blocks received were defective The bad blocks field is a total of the Packet Length Bad Header and Check Sum fields The Block Count field counts the number of messages that any blocks missing The Error Percent field shows the error percentage of the blocks received verses bad blocks You want this field as low as possible The background color of this field will change based on the quality of the received data If the background is white the received data has 10 or fewer errors If the background is yellow the received data has between 10 and 20 errors If the background is red the received data has an error rate greater than 20 If the received message is text you will see the text associated with the packet being processed in the text box The ingest program will attempt to repair defective messages if a duplicate message is sent through the EMWIN data stream WxEmwin Serial Ingest supports a backup satellite system retransmission receiver and or backup by Internet This option is enabled on the Setup Serial Ingest Tab ls Should the Serial Ingest engine stop receiving data the status bar will display a message in red indicating that data has stopped A notification icon will also appear in the system try If the Send Data Alerts ho option is enabled a text m
125. cure SMTP connections If your ISP requires a secure SMTP connection using SSL or TLS download this document for details The Email Options button is used to setup SMTP port authentication retries and backup e mail servers See Email Options 20 The Create E Mail Header Trailer button allows you to create text that will be added to the beginning and end of all selected and full email messages See Message Header Trailer st for an example When you click on this button a screen will be displayed for you to enter the header and trailer If you only want a header trailer message for certain groups see the Email Group 22 section 2011 Weather Message Software 20 Weather Message Server Hint Clicking on one of the column headers will sort the list for that column Note When you are ingesting from the Internet WxEmwin uses the email address entered on this screen to validate you as a user To edit an existing group double click the group For other options select the group and right click to see these menu options Add Edit Delete Copy e The Add option will add a new group e The Edit option will edit the selected group e The Delete option will delete the selected group e The Copy option will copy the selected group e The Paste option will paste the last copied group as a new group 2 4 2 2 Email Options The Email Options window allows you to set STMP port authentication retries an
126. d try a shorter message length The Parse option can be used to reduce the size of email messages sent Selecting Y tells the system to parse the messages for this group against the WxWords word substitution file The Time Zone option allows you to select the time zone for this group This option is used when the Style is set to Short The system will adjust the received message to the selected time zone Select a paging service provider from the Service Name drop down list See Paging Services 28 to add a new service Enter the pager pins in the Pager Pin List box Put one pin per line You can also enter a name associated with each pin by following the pin with a single space then the name Entering a name will help you identify the person associated with the pager The Create Group Pager Header Trailer button allows you to create text that will be added to the beginning and end of selected and full pager messages for this group When you click on this button a screen will be displayed for you to enter the header and trailer See Message Header Trailer st for an example The Create Group Short Message button allows you to create a short message for this group This option allows you to modify the system short message format for this group See Short Message 44 for additional information Note f you enter a short message for a group it overrides the default and product specific specifications 2 4 4 Data Alerts The Data A
127. d Now F Item Schedule Script Day of Month ow Week of Month B Day of Week M Time Interval 00 05 At This Time Every Time Message Duration 00 00 2011 Weather Message Software WxScheduler 195 Item Schedule Script If ReceivedD ata Length 0 Then A Return String Empty F End If split the data into an array Dim wsData As String Split ReceivedD ata vbLf loop through the data looking for our call sign Dim wsResults As New System Text StringBuilder For wiResultIndex As Int32 0 To wsData GetUpperB ound 0 trim the spaces wsD ata wiResultIndex wsD ata vulResultlndex T rimE nd c find our call sign Me The full text of the script is shown below If ReceivedData Length 0 Then Return String Empty End If split the data into an array Dim wsData As String Split ReceivedData vbLf loop through the data looking for our call sign Dim wsResults As New System Text StringBuilder For wiResultIndex As Int82 0 To wsData GetUpperBound 0 trim the spaces wsData wiResultIndex wsData wiResultIndex TrimEnd c find our call sign If wsData wiResultIndex IndexOf KSBN lt gt 1 Then remove that invalid character wsData wiResultIndex wsData wiResultIndex Replace ChrW 30 String Empty copy the data to our results For wiCopylndex As Int32 wiResultIndex To wsData GetUpperBound 0 cop
128. d backup e mail servers 2011 Weather Message Software Weather Message Server Setup 21 m Email Options Primary Server SMTP Port 25 SMTP Authentication SSL Required No User Name kb4mdd hughes r Send Using BCC 7 Password ae Metod Faam gt J Append Time F Failure Retries 2 Test Server Has nice 2 Backup Server Server smtp everyone net a rna Backup SMTP Authentication SSL Required User Name danny wxmesg cc Password 14m1 Test Server Method Password Cancel The SMTP Port defaults to port 25 If your ISP uses a different port enter that port number in this field Hint SSL secure connections use port 465 or 587 If your email server requires a secure connection set the SSL Required field to Auto Implicit or Explicit The Auto setting will work for most secure email servers Hint The Implicit setting starts the connection to the server with a secure channel The Explicit settings starts the connection to the server with an unsecured channel then uses the STARTTLS command to switch to a secure channel Google s port 465 uses Auto or Implicit Google s port 587 uses Explicit The Send Using BCC field should be checked if you want to send email using the email field BCC Blind Carbon Copy The email program normally sends email using the email field To Using the BCC email field prevents each email address that you entered for a group from appearing in each email
129. d graphic files The Graphics Purge Time field defines the amount of time in hours to retain graphic images After an image exceeds this time it is deleted The Start Up Wave File allows you to specify a wave file to play or read a text to speech message when the program is started Use the Browse button to locate a wave file To hear the wave file click Play If you do not want a wave file to play at startup enter None in this field For a text to speech message enter TTS followed by the message to speak For example TTS Weather Message Starting The Password field allows you to set the password that will be used for the Password for Setup Exit option The Auto Startup option allows you to specify whether the Message Client is automatically started when Windows starts The options are No Yes for the current user and Everyone for any user Note The options available for Auto Startup are based on your user permissions Administrator and Power users will have all of the options Other users may only have the Yes option The Show in Task Bar option when checked will move the program from the system tray to the task bar 2011 Weather Message Software Message Client 131 The Single Instance option when checked will only allow one copy of the Message Client to start 9 7 3 Settings Tab 2 The Settings 2 Tab is used to set operational information for the Message Client Weather Message Client Setup
130. d must be set to 420 characters Facebook only allows 420 characters and will truncate any posts that exceed that limit The Maximum field can be set to zero to send multiple posts should the message exceed 420 characters Set the Time Zone field to your time zone Set the Service Name to the Facebook Service The Pager Pin List should be blank to post updates to your personal Facebook page To post updates to another page that you administer enter the name of the page or the page identifier Hint To determine the Facebook page name log into Facebook Click on the Account option then Manage Pages The page names will be listed Type the page name exaclly as it appears To use the page identifier page number navigate to your page The pager identfier will be a 10 to 15 digit number that appears in the address bar s url If you do not see the page number in the address bar hover over the profile picture in the upper left part of the page The page identifier will appear after id Example page names Tallapoosa County Weather Alerts My Weather Alert Page Example page identifiers http www facebook com pages Tallapoosa County Weather Alerts 1 057647328 16676 ref sgm http www facebook com album php profile 1 amp id 1057647328 16676 After entering the above information click Save Click Save again to save the paging groups 2011 Weather Message Software 258 Weather Message Server Associate an Alarm
131. d the message exceed 140 characters Set the Time Zone field to your time zone Set the Service Name to the Twitter Service The Pager Pin List should be empty The Pin is not used by Twitter After entering the above information click Save Click Save again to save the paging groups Associate an Alarm On the main window select the alarm that you want sent to Twitter On the Paging Email Faxing tab select your Twitter group in the Paging list box Do this for each alarm that you want sent to Twitter 2011 Weather Message Software Supplement 255 17 10 Facebook Status Updates Weather Message supports posting status updates on F8SZSDUU9KIM This ability is possible by using the dedicated Facebook service option in the paging setup To setup Weather Message for Facebook you need to setup a Facebook service provider establish a Facebook paging group and associate this group with your alarms The following procedure outlines these steps Create a Facebook Service Provider Start Weather Message Server Setup Click Support Setup then Paging Groups Click Paging Services the Paging Services window will appear Click the New Button and fill out the screen as shown below m Paging Services Setup Service Facebook v Service Type TAP SNPP PageGate WCTP HTTP Post HTTP Get TCP Twitter Facebook User Name 11044550234490 Password Maximum O Page Size Authorize Failure Retries 0 Retry Minutes
132. d to get a list of the special weather statements for Birmingham currently stored in Weather Message To view one of the listed messages click on the message identifier in the product column Clicking on the expiration date column will sort the list in ascending or descending order 97 Setup 9 7 1 Server Tab The Server Tab is used to define the communication settings for your Weather Message Server 2011 Weather Message Software Message Client 129 Weather Message Client Setup z Server Settings 1 Settings 2 Alarms Product Colors Quick List Weather Message Server Host TCP IP Address Host TCP IP Port 9501 Backup Address Backup Port 9501 Client Identifier The Host TCP IP Address is the address of the Weather Message Server Enter the address of your primary server in this field Note When the Host TCP IP Address field is left blank the Message Client will try to discover the address and port of the Weather Message Server If your server is on the same local network as the client it will automatically obtain the address and port If the client is running on a different network you will need to enter the address and port of the server The Host TCP IP Port is the port defined by Weather Message Server for connections The default is 9501 The Backup Address is the TCP IP address of your backup Weather Message Server Do not enter an address in this field if you do
133. data and no backup source is selected a data loss notification message is created in each ingest directory The product identifier for this message is ADMWXM If you want to be alerted when the program loses data alarm the product ADMWX M with no state or county selected Note This program communicates with WxBBSrvr using UDP port 9510 on the local loop back address 6 6 2 Software Demod Tab The Serial Ingest Tab is used to define the communication port backup options and other general operations 5 WxEmwin Setup Serial Ingest Software Demod Intemet Ingest Common Ingest Paths Enabled v Not Installed Address 192 168 1 71 Port 18000 nternet Backup Error Rate Greater 15 Log Demod Stats The Enabled option should be checked if you want the Software Demodulator Ingest engine to automatically start when WxEmwin is started The Address field should contains the address of the software demodulator The default setting is 127 0 0 1 The Port field should contain the address of the EWMWIN Demodulator service The default port is 18000 The Error Rate Greater field sets the error rate percentage for switch over to Internet Ingest backup This field can be set from 5 to 95 percent Should the error rate of the received data exceed the set amount the program will switch over to Internet Ingest if Internet Backup is enabled If the software demodulator stops sending data for 8 seconds the program will switch t
134. data has 10 or fewer errors If the background is yellow the received data has between 10 and 20 errors If the background is red the received data has an error rate greater than 20 2011 Weather Message Software 92 Weather Message Server If the received message is text you will see the text associated with the packet being processed in the text box The ingest program will attempt to repair defective messages if a duplicate message is sent through the EMWIN data stream WxEmwin Software Demodulator ingest supports a backup satellite system retransmission receiver and or backup by Internet This option is enabled on the Setup Software Demod Tablss Should the Software Demodulator ingest engine stop receiving data the status bar will display a message in red indicating that data has stopped A notification icon will also appear in the system try If the Send Data Alerts hod option is enabled a text message is generated and placed in the ingest directory for processing by Weather Message You can alarm the product ADMWXM to receive notifications of data loss Note t is recommended that you run the ingest program on a computer that will not be used for normal user programs The software demodulator requires a large percentage of your computer processor in order to decode the data This process can be interrupted by other software programs which can result in lost weather products Note While the program is
135. dd Product button to add this product to the list Note This product must be alarmed to the map client Hint Product identifiers can contain the wild card characters and Hint AWIPS identifiers can include WFO abbreviations as shown above To delete a product highlight the product and click Delete Product or press the Delete key 15 5 3 1 4 Products VTEC Tab The Products VTEC Tab allows you to specify the products that should be processed for this task based on the VTEC identifier 2011 Weather Message Software 220 Weather Message Server Task Destination Products AWIPS Products VTEC Counties Html Products To Process TOW Enter a VTEC phenomena and significance to process in the Product Identifier field Click the Add Product button to add this product to the list Note This product must be alarmed to the map client Hint VTEC phenomena and significance codes do not allow WFO identifiers To delete a product highlight the product and click Delete Product or press the Delete key 15 5 3 1 5 Counties Tab The Counties Tab allows you to specify the counties that should be processed for this task 2011 Weather Message Software WxLoader 221 p L Edit Task File Separator Default Message Task Destination Products AWIPS Products VTEC Counties Html County Identifier Add Coun
136. dy gt lt html gt When you use the template option you only get one message per template For this reason most people will want to use server side includes With server side includes you are not limited Note The first line of the template should begin with lt html gt When a template begins with lt html gt Weather Message will replace any HTML reserved characters found in the weather text with their appropriate HTML abbreviation This prevents html browsers from misinterpreting the weather text as html code 17 8 Sending HTML Email Weather Message allows you to send HTML encoded email This is accomplished by setting up a Header and Trailer for the email group Enter the HTML code that should precede the weather text Here is some sample code lt html gt lt head gt lt META http equiv Content Type content text html charset iso 8859 1 gt lt META content MSHTML name GENERATOR gt lt head gt lt body bgColor ffffff gt lt p align center gt Test Weather Message lt p gt lt p align center gt amp nbsp lt p gt lt p align left gt lt PRE gt Next enter the HTML code that should follow the weather text Here is some sample code lt PRE gt lt body gt lt html gt HTML coding allows you to include links to other websites and format the message with different fonts and colors 2011 Weather Message Sof
137. e Creator Note The Open option defaults to the WxMesgNet WxData WxLocal directory This is the suggested directory for storing message templates The Clear Counties menu clears any counties selected in the County Selection box The Help menu allows you to see this manual and display information about the program Weather Message Help About Weather Message on the Web E Mail Program Support 2011 Weather Message Software 174 Weather Message Server 12 3 Expert Mode File Clear Counties Help D g Ri WMO VUUS52 KBMX WXUTCS AWIPSID ToRBMX Expires UTC 10 17 2010 02 56 County Selection Message sWkxCounties WxExpire E Couty Body O NEW KBMX TO W 9000 WxVteclssue WxViecExpire r auga BULLETIN EAS ACTIVATION REQUESTED d h TORNADO WARNING Ta LEE COUNTY EMERGENCY MANAGEMENT AGENCY E WxDate Appling THIS IS A TEST TEST TEST OF THE LEE COUNTY SKYWARN WEATHER INFORMATION NETWORK LEESKYWIN THIS MESSAGE IS FORMATTED AS A TORNADO WARNING FOR THE PURPOSE OF ACTIVATING ALARMS IN THE LEESKYWIN NO TORNADO WARNINGS EXIST T emilia WHEN REQUIRED THIS TYPE MESSAGE A TORNADO WARNING WILL BE ISSUED TO PROVIDE CRITICAL INFORMATION RELATIVE Select All Clear File Name WxProd tet Sen 10 17 10 02 41 33 In the Expert mode the application attempts to load the default message template file WxPr
138. e Help menu allows you to see this manual and display information about the program Weather Message Help About Weather Message on the Web E Mail Program Support 2011 Weather Message Software 210 Weather Message Server 15 3 Main Window File Alarms Help Active Tasks 3 Active Alarms rp 20 Processing Task Test rol su The main processing window shows the status of WxLoader When it is processing tasks you will see status messages in the status bar WxLoader works by processing products that have been alarmed gt to the map client This allows Weather Message Server to handle the alarms and message content while WxLoader handles uploads and message expirations 15 4 Alarms The Active Alarms Menu option allows you to view the current alarms AWIPS Expiration Date County gt ERIE oo sasana nmana asa U The alarm grid display information about each active alarm The columns and rows can be expanded to show hidden information The columns and rows can be extended by clicking a row or column line and dragging the line You can also sort the information by clicking on the column 2011 Weather Message Software WxLoader 211 identifier Right click an entry to expire a product or click the Expire All button to expire all active alarms The Refresh button will refresh the alarm grid Note The alarm grid will automatically refresh every 30 seconds
139. e Weather Statement Severe Storm Outlook Narrative State Weather Roundup State Weather Summary Regional Synopsis Terminal Aerodrome Forecast Travelers Forecast Table Tropical Cyclone Advisory Tropical Cyclone Discussion Tropical Cyclone Position Estimate Marine Aviation Tropical Cyclone Advisory Public Tropical Cyclone Advisory Satellite Tropical Cyclone Summary Tropical Cyclone Update Tropical Cyclone Watch Warning Tsunami Information Bulletin Tide Report Tsunami Tide Seismic Message Acknowledgment 911 Telephone Outage Emergency Tornado Warning Temperature Precipitation Table Tsunami Tide Seismic Message Test Message Tsunami Watch Warning Travelers Forecast Tropical Weather Discussion Tropical Weather Outlook and Summary Tropical Weather Summary Ultraviolet Index Volcanic Activity Advisory Volcano Warning Space Environment Warning Space Weather Message Watch Watch County Notification Weekly Weather and Crop Report Weekly Data for Agriculture 27 day Space Weather Forecast Watch Outline Update Local Work File Winter Weather Warnings Watches Advisories Warning Verification Message Watch Status Report Severe Thunderstorm Watch Probabilities Zone Forecast Product State Marine Zone Abbreviations AK AL Alaska Alabama 2011 Weather Message Software Supplement AM AN AR AS AZ CA CO CT DC DE FL GA GM GU HI IA ID IL IN KS KY LA Lie LE LH LM LO LS M
140. e background color is light gray VTEC is not available for this product Set Area The Set Areals button is used to establish a geographic area for the alarm This geographic area is based on a location s latitude and longitude and a radius in miles The color of the Set Area button indicates the status of this option If the background color is light green Area has been setup for this alarm If the background color is white Area is available but not set If the background color is light gray Area is not available for this product Note Caution should be used when enabling the Area option This option requires the weather text to contain a LAT LON information line This is associated with polygon watch warnings Set Wind Wind Speed and Hail Size The Set Wind s button is used to establish wind speed and or hail size for the alarm Wind Speed and Hail size is included in Severe Thunderstorm and Severe Weather Statements 2011 Weather Message Software Weather Message Server Setup 57 The color of the Set Wind button indicates the status of this option If the background color is light green Wind and or Hail has been setup for this alarm If the background color is white Wind and Hail are available but not set If the background color is light gray Wind and Hail is not available for this product Note The Set Wind option is now being tested by the NWS Central Region forecast products Users
141. e current user and Everyone for any user Note The options available for Auto Startup are based on your user permissions Administrator and Power users will have all of the options Other users may only have the Yes option 2011 Weather Message Software 84 Weather Message Server 5 Third party Applications Weather Message can be setup to provide data for use by other third party programs The ingest programs have the ability to copy received files to multiple directories This ability allows third party programs to have their own dedicated ingest directory To setup the Weather Message Ingest programs for multiple directory support see the section on WxEmwin WxWw2000 or WxPort The Paths tab in the ingest programs allows you to specify additional distribution paths for third party programs to pick up the arriving files a WxEmwin Setup Serial Ingest Software Demod Intemet Ingest Common Ingest Paths Ingest Path b WxMesgNet WxData RxFiles Additional Distribution Paths 2011 Weather Message Software 86 Weather Message Server 6 WxEmwin ENWIN Ingest 6 1 Overview WxEmwin is used by Weather Message to receive EMWIN data EMWIN data can be received from a serial port software demodulator or Internet The ingest program can be started automatically by the Weather Message Server or manually WxEmwin EMWIN Ingest Engine
142. e groups FPUS54 KBMX 052153 ZFP BHM for Russell County Until 05 30 PM AT ER SERVICE DOPPL HI EAR 2011 Weather Message Software 248 Weather Message Server ZONE FORECAST PRODUCT NATIONAL WEATHER SERVICE BIRMINGHAM AL 405 PM CST SAT APR 5 2003 ALZOLIS01L5 017 060930 BLOUNT FAYETTE LAMAR MARION WALKER WINSTON INCLUDING THE CITIES OF as DOUBLE SPRINGS FAYETTE oa HAMILTON oa JASPER ONEONTA VERNON 405 PM CST SAT APR 5 2003 TONIGHT INCREASING CLOUDS A SLIGHT CHANCE OF A SHOWER AFTER MIDNIGHT LOWS IN THE LOWER 50S NORTHEAST WINDS 5 TO 10 MPH CHANCE OF RAIN 20 PERCENT SUNDAY MOSTLY CLOUDY WITH SHOWERS AND THUNDERSTORMS LIKELY BY AFTERNOON STORMS POSSIBLY SEVERE IN THE AFTERNOON HIGHS IN THE LOWER 70S EAST WINDS 10 TO 15 MPH BECOMING SOUTHEAST IN THE AFTERNOON CHANCE OF RAIN 70 PERCENT SUNDAY NIGHT SHOWERS AND THUNDERSTORMS STORMS POSSIBLY SEVERE LOWS IN THE LOWER 60S SOUTHEAST WINDS 10 TO 15 MPH CHANCE OF RAIN 80 PERCENT MONDAY VARIABLE CLOUDINESS WITH A CHANCE OF THUNDERSTORMS HIGHS IN THE UPPER 70S CHANCE OF RAIN 30 PERCENT MONDAY NIGHT PARTLY CLOU
143. e specified they vary by manufacturer Turn off data compression 2011 Weather Message Software 28 Weather Message Server Turn off error correction Turn off flow control If these codes do not work with your modem send e mail to help wxmesg com Include your modem model number and we will try to send you an initialization string that will work 2 4 3 3 Paging Services The Paging Services window allows you to setup different paging services Fi Paging Services Setup Service AirMessage v Service Type TAP SNPP PageGate WCTP HTTP Post HTTP Get Les Twitter Facebook Address airmessage net SNPP Port 444 User Name Password Maximum Page Size 400 Failure Retries 2 Retry Minutes 2 HTTP Post z Variables New Service Delete Save Exit To add a new service click the New Service button and enter a new Service name To delete a service select the service from the drop down list and click the Delete button To change a service select the service from the drop down list Service Type The Service Type field allows you to specify the type of paging service Select TAP for modem dial up paging SNPP or WCTP for direct Internet paging HTTP Post or HTTP Get to interface with a web page web server TCP for TCP connections PageGate if you want to interface with PageGate software Twitter to post updates to Twitter or Facebook to post updates to Facebook Note The PageGate option
144. e the full path including the name of the map image Select the Save To type Local FTP FTPS SFTP with Password SFTP with Certificate or HTTP If one of the FTP options or HTTP is selected the program will allow you to enter information about your FTP or HTTP server Enter the FTP Server address Port number User Name and Password These settings will be used to log into your server Note When using the SFTP with Certificate option you should enter your private key password in the password field Your private certificate must be saved in c Program Files WxMesgNet SSHKeys directory The file should be named as follows server name plus underscore character plus user name with the extension pem For example wxmesg com_danny pem 11 8 9 Save Legend Options Tab The Save Legend Options Tab is used to set options for saving the map legend to a directory or website 2011 Weather Message Software WxMap Client 167 Weather Message Map Setup xa Server Settings Alarms Product Colors Other Colors Map Base Map Layers Save Map Options Save Legend Options Save Legend Minimum Width 200 Legend Style 1 vJ Maximum Width 0 Background Color Color Minimum Height 146 Foreground Color Color Maximum Height 0 Border Color Text Font Font MS Sans Serif 8 0 Image Path c wamesgnet wxdata archive The Save Legend Options can be used in conjunction
145. e the ingest directories after 24 hours The Enable Byte Blaster Server Support option when checked will cause the program to output data for use by WxBBSrvr If you intend on running the Byte Blaster server software this option must be enabled The Log File Size field allows you to specify this size of your ingest log files The default is 50 000 bytes The Global Ingest Paths option controls whether WxEmwin uses global ingest paths Global ingest paths are shared between all of the ingest programs Unchecking this box will allow you to define ingest paths that are different from the global ingest paths The Log Bad Blocks option when checked will cause the program to log bad block information in the associated ingest engine s log file 2011 Weather Message Software 102 Weather Message Server 6 6 5 The Send Data Loss Alerts option when checked will cause the program to generate data loss and com port switch messages To receive these notifications an alarm for the product ADMWXM must be setup in Weather Message Setup Ingest Paths Tab The Ingest Paths Tab is used to define the directories that will store the received weather products for processing WxEmwin Setup T Serial Ingest Software Demod Intemet Ingest Common Ingest Paths Ingest Path amp WxMesgNet WxData RxFiles Additional Distribution Paths The Ingest Path is defined in the Weather Mess
146. eccsestetantencccedssidanastusdkcesteduceees di cceuratdvcucnivscesdceeteduecnessasseasuasate 212 Firewall Proxy assaini iana aa e aaar AREA Eaa A aeae Geen vel save dave aA E Aea Ta t saa EE Ai 213 MASKS TAD J E A E E E S A E AE GE A A E E A O 215 Editinga haskuutau n Sa TENEO E SEEE rea Erana Eee aE EEE EAR E A 215 Task Tab dehscadavadadssisandadhdeaddenicdcinavassedceides iudasseataveipSunsatagateisnades seaincdigadsccesdciisaassareiaadedtasstdeas tacieteaes 215 Destination raD s isere e tnana sania aE EAE ae aa aaen neea 217 Products AWIPS Ta D ra a ie sel a eee 218 Products VTEC Tabo cccccccccscccsssscccssseccessceccessseccssseecessseccssseeccuseeecsssececsesecesseescsesecesasecesseeecesseesenseeeenses 219 Counties Tabs Aku ices Sse eee aie ites Ac wide sea 220 PAM Tab Sener ecesesnssescsican E SE shunt dadetessual os sasazatess cess nected onesies dice 221 File Separator Tabi a usa usasapa hanes ieee eae a eee naa eee 222 Defauli Message aD sisi u m A S S us nku mua a ias asa haku aha wan aaa Siaka 223 Alarm Setup uuu u un aa oe se aE aaa ee aaee E aea ee aae eaaa 224 WxWire Weather Wire Utility 228 COVERVICW E E EE E E E E E E ben E E E E E 228 Supplement 230 Weather Forecast Office Abbreviations uuu u 1 230 Text Product Abbreviations u uu ul u u uu u uuu uu uuu aaan naaa aaa aaa aaa aaa aaa aaan aaa 238 State Marine Zone Abbreviations
147. een issued for Tallapoosa AL county until 9 20 PM A Severe Thunderstorm Watch has been issued for Tallapoosa AL county until 9 20 PM Here is an example message created with the Short by State option A Tornado Warning has been issued for the following county in Alabama Tallapoosa county until 9 20 PM A Severe Thunderstorm Watch has been issued for the following county in Alabama Tallapoosa county until 9 20 PM The Issue Time Style allows you to include the start time and day for a message that will begin in the future The options are None Time and Time Day The None option does not insert the issue time The Time option insert the issue time if the issue time is in the future The Time Day option inserts the issue time and day of week if the issue time is in the future Hint The Issue Time Style is not available if the Full style is selected 2011 Weather Message Software WxLoader 217 Hint The Issue Time Style option is deactivated when the Combine Like Products options is checked The Expire Time Style allows you to select different styles for the expiration time The options are Time Time Day and Time Day Next The Time option inserts the expiration time The Time Day option inserts the expiration time and day of week The Time Day Next option inserts the expiration time and inserts the day of week if the current day and expiration day are different Hint The Expire Time Style is not available if the Ful
148. eight of 0 zero indicates no height limit 2011 Weather Message Software 168 Weather Message Server 11 9 Textto Speech The Message Client now has limited support for text to speech using Microsoft s text to speech processor on Windows XP and later operating systems The Sam voice that is installed with Microsoft XP is very poor Windows Vista s Anna voice is more natural Microsoft released two additional voices for Windows XP that are better than the default voice You can download them from this link http www text speech com voices Sp5TTIntXP msi After they are installed you will find Mike and Mary available in the speech control panel These two are much better than the default SAM voice The voice used by the Message Client is the default one selected in the speech control panel Using the speech control panel you can change the voice and set the speaking speed There are several commercial TTS text to speech engine providers Cepstral has good voices You can demo them at http www cepstral com demos Their voices are around 30 00 Nextup has demos of the AT amp T voices at http www nextup com attnv html The AT amp T voices cost 35 00 11 10 Map Landmarks 11 10 1 Overview You can setup landmarks to be displayed on the map These landmarks can be a simple point a name or the current date and time Weather Message Map Landmarks Latitude Longitude Text Range Font Name 32 94688
149. elete Cancel 11 7 Active Alarms The Active Alarms Menu option allows you to view the current alarms 2011 Weather Message Software 156 Weather Message Server County AWIPS Office VTEC Expiration Date Clay MN 0 1007 FLS FLW 56 11 06 2010 22 00 The Islands to Vermili MWW SCY 61 11 01 2010 03 00 Vermilion to Avon Poi MWW SCY 61 11 01 2010 03 00 Avon Point to Willowi MWW SCY 61 11 01 2010 03 00 Willowick to Geneve Mww SCY 61 11 01 2010 03 00 Geneva onthe Lake MWW SCY 61 11 01 2010 03 00 Conneaut OH to Rip MWW 11 01 2010 03 00 a 45 AS 2010 O l The alarm grid display information about each active alarm The columns and rows can be expanded to show hidden information The columns and rows can be extended by clicking a row or column line and dragging the line You can also sort the information by clicking on the column identifier Right click an entry to expire a product or click the Expire All button to expire all active alarms The Refresh button will refresh the alarm grid Note The alarm grid will automatically refresh every 30 seconds 11 8 Setup 11 8 1 Server Tab The Server Tab is used to define the communication settings for your Weather Message Server 2011 Weather Message Software WxMap Client 157 Weather Message Map Setup Sc Save Map Options Save Legend Options al aes as
150. ell phone provider click the button 25 to see a list of cell phone provider formats The Create Group E Mail Header Trailer button allows you to create text that will be added to the beginning and end of selected and full e mail messages for this group When you click on this button a screen will be displayed for you to enter the header and trailer See Message Header Trailer 5t for an example The Create Group Short Message button allows you to create a short message for this group This option allows you to modify the system short message format for this group See Short Message 44 for additional information Note f you enter a short message for a group it overrides the default and product specific specifications 2 4 2 3 1 Phone Provider Formats The Phone Provider Formats window displays a list of cell phone providers along with the format for sending messages to their phones 2011 Weather Message Software Weather Message Server Setup 25 If you have updated information for your cell phone provider please forward the information to support wxmesg com 2 4 3 Paging Groups 2 4 3 1 Paging Settings The Paging Setup window allows you to set the paging information along with your paging groups The Paging Options button is used to setup the paging subsystem See Paging Options 26 2011 Weather Message Software 26 Weather Message Server The Paging Servi
151. eople that make reporting and responding to severe weather a priority Your dedication saves lives Our Goal To provide users with software that can help save lives If one life is saved through our combined efforts the value is immeasurable Contents l Table of Contents Part Il O N a Foreword 0 Introduction 8 OvernieW 5 Si aka E E 8 Data Warning MEE 8 Obtaining Helg UIV UYUNI Au a ass as 9 EE e a a a E E E 9 Weather Message Server Setup 12 OVerV eW osanaan annaa RAAN EAA AA AAAA KAEA AERA AAAA 12 Men Options uuu a a hac aaaea a aaa eaaa uuu a ha Su Saaai 12 Main WAN OW 255 SSS usss 14 SUpport SOUP uuu A EE E AEA R a u ua am uu a Susa aa aaa asss ds Fax Groups u E A E E A E A AE A eva EA TA T A A S ELEREN AE E E A A E EMail Group E EAE A E EAA ET Email Settings ss PIE O ONS i cakes sn s R A E A ae A E E e a t Test Email SOttim Qs sassccsndecssts cashes ides scdlepadecxecean Sch ceacdsavadaaued aS Sua eaaa eaaa aAa T ES Sea 22 Emal GROUP sm a A aaa a a aaa EE A e a a E e E E EE EEEE 22 Phone Provider FOIMaAlS u LIL Sasa EAEn SaaS aan SAna rE ATSANA raa aa A RENEA 24 Paging Groups u I sctdceccsndeeessectecattcacecieecessdvecedccedseccveati cocctesseectesapesteessveccsenisctvced sus decesustetensracecus ccdsacsececheistezecies Paging SC THIS as nu aeai usnu sa a u an suhu u usu u u ca ee Paging OPUOMS uy m Aaa Asa atis ayasa A Ae spa yaaa Nak E aaraa Saa Sky aysaykun ai assay ashtu EA PAGING
152. er Product Fire Weather Notification Fire Weather Observation Suppression Forecast Freezing Level Data Great Lakes Forecast Great Lakes Storm Outlook Great Lakes Storm Summary General Status Message Hydrometeorlogical Coordination Message Hurricane Local Statement Hydrometeorological Discussion Hazardous Materials Warning Hourly Weather Roundup High Seas Forecast Hazardous Weather Outlook Rainfall Reports Monthly Hydrometerological Plain Language Product Ice Forecast Ice Observation Keep Alive Message Local Area Emergency Great Lakes Weather Observation Local Cooperative Observation Law Enforcement Warning Local Forecast Low Level Sounding Lakeshore Warning or Statement Local Storm Report Lightning Data GFS Based MOS Guidance ETA Based MOS Guidance GFX Extended Based MOS Guidance Marine Interpretation Message Miscellaneous Local Product Test Message METAR Formatted Surface Weather Observation Marine Weather Statement Marine Weather Message Short Term Forecast Non Precipitation Warnings Watches Advisories Nearshore Marine Forecast Surf Forecast Nuclear Power Plant Warning Other Aviation Products Offshore Forecast Other Marine Products Other Public Products Other Surface Observations Prescribed Burn Forecast Point Forecast Matrices Point Fire Weather Forecast Matrices Plain Language Ship Report 2011 Weather Message Software Supplement 241 PMD PNS PSH PWD PWO PWS Q
153. es if a duplicate message is sent through the EMWIN data stream WxEmwin Internet Ingest supports backup with the Weather Wire Ingest program This option is enabled on the Setup Internet Ingest Tab 9 Note To use Weather Wire Ingest as a backup you must have an active subscription for Weather Wire and have purchased a license from Weather Message for that ingest engine Should the Internet Ingest engine stop receiving data the status bar will display a message in red indicating that data has stopped A notification icon will also appear in the system try If the Send Data Alerts ho option is enabled a text message is generated and placed in the ingest directory for processing by Weather Message You can alarm the product ADMWXM to receive notifications of data loss Note While the program is using Weather Wire Ingest as a backup data source the fields on the screen may not be updated They will resume showing data when a Byte Blaster Server begins to send data Note The program supports a second log file The second format uses a fixed field size for easy analysis This log file is never purged and remains until the user deletes the log files To enable this logging option create the directory NwsLogs in the c program files WxMesgNet directory Note The Internet Ingest engine has the ability to block a user defined list of EMWIN Byte Blaster servers To enable this option create the file WxSvrBlock txt in the application direct
154. essage is generated and placed in the ingest directory for processing by Weather Message You can alarm the product ADMWXM to receive notifications of data loss Note t is recommended that you run the ingest program on a computer that will not be used for normal user programs The processing of serial data can be interrupted by other software programs which can result in lost weather products Note While the program is using Internet Ingest as a backup data source the fields on the screen may not be updated They will resume showing data when the main serial port begins to receive data Note The program supports a second log file The second format uses a fixed field size for easy analysis This log file is never purged and remains until the user deletes the log files To enable this logging option create the directory NwsLogs in the c program files WxMesgNet directory Note Some computers may detect your satellite receiver as a serial mouse This generally occurs when the satellite receiver is turned on when booting the computer If this occurs your mouse will begin to move on it s own To correct this problem turn off the satellite receiver Download the comdisable tool from Microsoft at this web address http support microsoft com default aspx scid kb en us 819036 2011 Weather Message Software WxEmwin EMWIN Ingest 91 6 4 Software Demodulator Tab The Software Demodulator tab when visible shows t
155. etup 15 W Weather Message Setup r File Support Setup Help TCP IP Pot 9501 Ingest Engine Emwin Serial Weather Wire Ingest Path c WxeKMesaNetWxDataNReFiles Emwin Internet NoaaPort Data Path C WxMesgNet WxData Wx Text 2 Emwin So De Graphics Path C WxMesgNet WxData WxGraph Alarm File 1 v Nam 7 Product State County s Pager Group s 977777 None FAL None FFA None FFS None FLS None GO8HURUS The main screen is used to setup the TCP IP Port address that the clients will use to access the Weather Message Server Weather Message uses the port specified plus the next sequential port number If you specify port 9501 the program will also use port 9502 The Ingest Path field contains the directory path where received weather files are initially stored Weather Message Server looks in this directory for incoming files to process This path is used by the EMWIN ingest WxEmwin weather wire ingest WxWw2000 and NOAAPort WxPort programs to store received weather files The Data Path field contains the directory path to store processed text weather messages The Graphics Path field contains the directory path to store processed graphic products The Alarm File field allows you to select from 1 to 9 different alarm files Only one alarm file is active at atime This option is useful if you want to define a different set of alarms for different times of the year Select the Ingest E
156. fixes and enter products by typing them into the list Note All of the products assigned to each list must use the same UGC coding sequence zone or FIPS 2 4 8 Product Specifications The Product Specifications window allows you establish short message formats for products These specifications are used to create a short message for email paging and archive operations Default The Default product specification is used for any short message that does not match a product in the list 2011 Weather Message Software 44 Weather Message Server Note You cannot delete the Default product To edit an existing Product double click the product For other options select the Product and right click to see these menu options Add Edit Delete e The Add option will add a new product specification e The Edit option will edit the selected product e The Delete option will delete the select product specification When adding or editing the Product Specification 44 window is displayed Hint Product Specifications can be entered for a three character product identifier or a complete 6 character product plus WFO identifier 2 4 8 1 Short Message Tab The Short Message Tab allows you establish a short message iC Product Specification Product DEFAULT Default Specifications Short Message VTEC Message Options Short Message Text Available Variables NWS has Action a MesgType ifCoun
157. ftware The Add Header option when selected will add an expanded header to the first line of the message This option expands the AWIPS identifier and makes it the first line in the message The Remove Return option when selected will remove the extra return character from processed messages Click on PIL Format to send messages in PIL format Click on WMO Format to send messages in WMO format This setting depends on the application that will be receiving the data The Stop button can be used to pause the file that is currently being sent This button will toggle between Stop and Start Note You must click the Stop button to make changes to the Settings Copyright 2011 Weather Message Software 2011 Weather Message Software 230 Weather Message Server 17 17 1 Supplement Weather Forecast Office Abbreviations AK AK AK AK AK AK AK AK AK AK AK AK AK AK AK AL AL AL AL AL AL AL AL AL AL AR AR AZ AZ AZ AZ AZ AZ AZ AZ AZ AZ CA CA CA CA CA CA CA CA CA CA CA CA CA WFO Juneau RFC Alaska Anchorage WFO Fairbanks WFO Anchorage WFO Anchorage WFO Fairbanks WFO Juneau WFO Anchorage WFO Fairbanks WFO Fairbanks WFO Juneau WFO Fairbanks WFO Anchorage WFO Anchorage WFO Fairbanks WFO Birmingham WFO Birmingham WFO Mobile WFO Huntsville WFO Birmingham WFO Huntsville WFO Birmingham WFO Mobile WFO Huntsville WFO Mobile WFO
158. g Products defined here will override any product already defined in Product dat 2 4 10 WxWords The WxWords Window is used to establish word substitutions These entries are used when the Parse option is enabled on Fax Email and Paging groups This capability is specifically designed to reduce the size of paged messages 2011 Weather Message Software Weather Message Server Setup 51 m WxWords Dictionary n NATIONAL WEATHER SERVICE NWS EMERGENCY MANAGEMENT AGENCY EMA INFORMATION INFO DOPPLER SPECIAL WEATHER STATEMENT SIGNIFICANT WEATHER ALERT Dictionary Format OldWord NewWord Save Cancel The format for WxWords is original word s replacement word There must be a comma between the original word and replacement word You will notice that the comma is shown in a different color Note The words are not case sensitive however the program will replace the words in the case that you use in WxWords Note A sample WxWords dat file is available on the Weather Message Additional Downloads webpage This file contains the most common abbreviations http www wxmesg com misdownloads htm Since the format for WxWords uses a comma to separate the original word s and replacement word s a special procedure should be used to replace a comma To replace a comma you must enclose the comma character with single quotes For example to replace the comma with a semicolon
159. g on one of the column headers will sort the list for that column Note WinFax Pro is not provided with Weather Message This third party software can be purchased directly from Symantec Note For faxing to work properly you must have your faxing software setup properly It is recommended that you test your faxing software setup before instructing Weather Message to send faxes To edit an existing group double click the group For other options select the group and right click to see these menu options Add Edit Delete Copy e The Add option will add a new group e The Edit option will edit the selected group e The Delete option will delete the selected group e The Copy option will copy the selected group e The Paste option will paste the last copied group as a new group 2 4 1 2 Fax Group The Edit Fax Group window allows to setup a group to receive faxes 2011 Weather Message Software 18 Weather Message Server Fa Edit Fax Group Group Name FaxOffice Create Group Fax Syle Selected gt s Subject Style Fup SubjectOveride tt t s Parse Telephone Entry Format telephone space Name 555 1212 John Doe Fax List 256 329 0952 Danny Weather Message Put each fax number ona separate line x Save Cancel Enter the name of the group to be setup in the Group Name field This name will appear in the alarm setup window as an available fax group Select the Style of f
160. ge Software 78 Weather Message Server renamed with the extension old and new debug file is created Note Should you need to increase the size of these debug files you can add the following registry key HKEY_Local_Machine Software Weather Message Net WxMesg Shared DebugLogSize and set the log file size in bytes This is accomplished by using RegEdit and navigating to HKEY_Local_Machine Software Weather Message Net WxMesg Shared Then right clicking on Share and selecting New String Value Enter the name DebugLogSize then right click on DebugLogSize and enter the size of the logfile in bytes 2011 Weather Message Software 80 Weather Message Server 4 4 1 Weather Message Controller Overview Weather Message Server Controller is used to monitor Weather Message Server when it is running as a service When you start Weather Message Server Controller it runs from the system tray gt Weather Message Server Controller 3 7 aXe File Help Processing Status File OMRMTRCA_TXT TCP IP Office KMTR Date z 120325 Email Local 09 11 2010 22 25 WMO SxUS86 AWIPS OMRMTR Fax Other Marine Products Send Client C Alarm 1 Type 0 Page Image Send Completed RADRCKST0912100325 jpg v X10 Processing File Name Archive FTP RXFILES OMRMTRCA TXT Processed 11678 0 Message Clients 1 Print Alarm File 1 Map Clients 1 Connected to Weather Message Server
161. ge to Restore Zoom Clicking the Restore Zoom button will restore the original map view The Read Text button will read the displayed message using Windows text to speech processor When the text to speech processor starts the button will change to Cancel Reading Clicking Cancel Reading will stop the text to speech processor See Text to Speech 135 for more details The E Mail Message button opens your email application and inserts the message text in the body of the message The Print Message button prints the message text to your default printer The Close button closes this window Right clicking in the text window displays the following menu options that allow you to copy paste print and speak selected text Undo Ctrl Z Cut Ctrl X Copy Ctrl C Paste Ctrl V Delete Del Print Ctrl P Speak Ctrl S Right Clicking on a county displays this menu 2011 Weather Message Software 154 Weather Message Server Show County Information Show Notes Label County Toggle On Off Select Show County Information to display National Weather Service information about the county County Tallapoosa Forecast Office BMX FIPS Code 01123 State Area EC Hint This screen can help you identify the Forecast Office assigned to your county The Show Notes option opens a window that allow you to record information about that county Tallapoosa AL 01123 EMA Director Joe Paul Boone 825 1078
162. ges you can specify the Agency Name to use in the created message The default is National Weather Service In order to select counties on the State Counties Tab you must enter one or more states in the State field If you enter multiple states they must be delimited by commas The Ingest Path should contain the path to the Weather Message Server received files directory This field should be populated by default 2011 Weather Message Software 178 Weather Message Server 12 5 2 State Counties Tab The Settings Tab is used to select the counties that appear in the County Selection list box Place a check mark next to each county that you want to appear in the County Selection list box 12 5 3 Server Tab The Server Tab is used to define the communication settings for your Weather Message Server Weather Message Server Host TCP IP Address 127 0 0 1 Host TCP IP Port 9501 Client Identifier A vJ Pass Code Send to Server 2011 Weather Message Software WxMesgText 179 The Host TCP IP Address is the address of the Weather Message Server Enter the address of your server in this field The Host TCP IP Port is the port defined by Weather Message Server for connections The default is 9501 The Client Identifier field allows you to assign each Message Client Map and Message Creator a different identification number The default setting for all clients is o
163. h Flood Guidance FFG006US 6 Hour Flash Flood Guidance G08CIRUS GOES 8 Satellite Image All United States GO8HURUS GOES 8 Satellite Image Southern US Caribbean G10CIRUS GOES 10 Satellite Image Western United States G10FDIUS GOES 10 Satellite Image Pacific Ocean GMS005US Satellite Image Earth View Pacific Ocean GPHJ88US Significant River Flood Outlook IMGFNTOO 0000Z Surface Analysis IMGFNT06 0600Z Surface Analysis IMGFNT12 1200Z Surface Analysis IMGFNT18 1800Z Surface Analysis IMGSJUPR Satellite Image Caribbean Islands IMGSNDUS GOES Sounder IMGSWPUS Satellite Image Southwestern Pacific IMGWWAUS United States Warnings Watches and Advisories INDCIRUS Satellite Image Earth View Indian Ocean METFIREU Satellite Image Earth View Africa MOD91EUS 6 Hour QPF 91e MOD92FBW 12 Hour Forecast of Fronts Pressure and Weather MOD93SUS 6 Hour QPF 93e MOD94SUS Excessive Rainfall Potential Outlook MOD96FBW 36 Hour Forecast of Fronts Pressure and Weather MODDY1US Day 1 Convective Outlook MODDY2US Day 2 Convective Outlook MODQP1US 24 Hour Day 1 QPF 94q MODQP2US 24 Hour Day 2 QPF 98q RADALLAK Alaska RADALLGU Guam RADALLHI Hawaii RADALLPR Puerto Rico 2011 Weather Message Software Supplement 245 17 5 RADALLUS NEXRAD All US RADGRTLK Central Great Lakes RADNTHES Northeast RADPACNW Pacific Northwest RADPACSW Pacific Southwest RADRCKNT Northern Rockies RADRCKST Southern Rockies RADREFUS NEX
164. he button only appears if more than one image is available for animation Start F8 Stop F9 Increase Speed Fil Decrease Speed F12 e The Start option or F8 function key starts the animation e The Stop option or F9 function key stops the animation e The Increase Speed option or F11 function key increases the animation speed e The Decrease Speed option or F12 function key decreases the animation speed The Help menu allows you to see this manual 10 3 Image Options The displayed image can automatically be resize by selecting on of the Imagels menu options File SelectImage Browse Image Animate Image GO8CIRUS 10 31 10 17 33 2011 Weather Message Software Image Viewer 141 There are also a number of zoom options available by right clicking on the image Right click on the image to see this menu Pan Zoom In Zoom Out ADD Zoom Window Zoom 100 s Zoom Fit S Dep Magnify Zoom 600 Zoom 400 Zoom 200 Zoom 75 Zoom 50 Zoom 25 Zoom 10 The default view is Zoom 100 10 4 Selecting Images Images are selected by either clicking on a graphics product in the Product List selecting a recently viewed image from the File menu browsing for an image using the Image Browser or using the Select Image window 5 GOES fF gt Goes 8 IR i Goes 8 Huricane Goes 10 IR Goes Sounder ome Puerto Rico
165. he option of the Software Demodulator ingest engine Serial Ingest Software Demodulator Intemet Ingest Processing File Block File Size a Total Blocks Packet Length Bad Blocks Bad Header Error Percent Check Sum Block Count The Processing File Block and File Size fields show information about the received file A green or red led appears to the right of the Processing File field This led will normally appear green If any of the blocks received for this message are defective the led will change to red Note n order to process data the EMWIN Data Source service and EMWIN Demodulator service must be running Use the Demodulator menu to start and stop these services To monitor the received blocks click on the green or red led The following window will appear displaying the received blocks Serial Blocks z Received Blocks The Total Blocks field shows the total number of blocks received for a one hour period the Bad Blocks field shows how many of the total blocks received were defective The bad blocks field is a total of the Packet Length Bad Header and Check Sum fields The Block Count field counts the number of messages that any blocks missing The Error Percent field shows the error percentage of the blocks received verses bad blocks You want this field as low as possible The background color of this field will change based on the quality of the received data If the background is white the received
166. he product identifier and play that file If neither are found it will play the default wave file associated with this alarm Here are some examples of using the Product to Wave option The following files are stored in the Sounds directory TORBHM wav TOR wav With the Product to Wave enabled for Alarm Type 1 the program will look at each received product associated with Alarm Type 1 If the incoming message contains the product identifier TORBHM the program will play the file TORBHM wav If it receives TORHUN it will play the file TOR wav since it cannot locate a file labeled TORHUN wav The Read Short option will announce the received product using text to speech The software will attempt to create a short message describing the received product The short message will generally include the product type counties effected and the expiration time See Text to Speech 135 for more details The Read Text option will read the text of the received message using text to speech The Pop Up Map option specifies whether WxMap pops up a minimized window when this alarm arrives The Map On Top setting can be used to make the WxMap window the window that appears on top of all other windows If you use this option an alarm will cause WxMap to appear on top of all other running programs 11 8 4 Product Colors Tab The Product Colors Tab is used to establish colors for products listed in the map and map legend 2011 Weather Mes
167. he user requests the web page they will always get the latest messages HTML Templates A html template is a web page that will be used by Weather Message to insert the weather text Weather Message takes your html template and searches for the code MESSAGE and replaces that code with the weather text 2011 Weather Message Software Supplement 251 use FrontPage to create a blank page or one with some text formatting and put the code MESSAGE where want the weather text to appear This template is stored in the WxMesg directory The ftp command will need to include the template name Weather Message will take this template insert the weather text and then ftp that html file to the server You will need to have a main web page that has a link to this uploaded html file Note If you use the html tags lt PRE gt lt PRE gt around the weather text the text will be properly formatted Here is a sample template lt html gt lt head gt lt meta http equiv Content Language content en us gt lt meta http equiv Content Type content text html charset windows 1252 gt lt title gt Weather Message Sample Template lt title gt lt head gt lt body gt lt p align center gt Weather Message Sample Template lt p gt lt p align center gt Weather Text Follows lt p gt lt p align center gt amp nbsp lt p gt lt p align left gt lt PRE gt SMESSAGES lt PRE gt lt p gt lt bo
168. hington D C National Centers For Environmental Prediction National Centers For Environmental Prediction National Centers For Environmental Prediction National Centers For Environmental Prediction National Centers For Environmental Prediction National Centers For Environmental Prediction National Centers For Environmental Prediction National Centers For Environmental Prediction National Centers For Environmental Prediction WFO Baltimore Washington D C National Centers For Environmental Prediction National Centers For Environmental Prediction WFO Baltimore Washington D C National Centers For Environmental Prediction National Centers For Environmental Prediction National Centers For Environmental Prediction National Centers For Environmental Prediction National Centers For Environmental Prediction National Centers For Environmental Prediction National Centers For Environmental Prediction National Centers For Environmental Prediction National Centers For Environmental Prediction WFO Key West WFO Miami WFO Melbourne WFO Tallahassee WFO Key West WFO Miami WFO Tampa Bay Area Ruskin WFO Jacksonville WFO Jacksonville WFO Key West WFO Melbourne RSA SAC SAN SCK SFO SGX SMX SOX STO UCR USA USJ VTX ALS BOU COS DEN FTG GJT GJX NEC PUB PUX BWI CAC CAN CRN EPD EPI ERD ERN HSD HUR IAD INT LAT LWX MRD NAM NMC PFD QLM SPD SUS WRN WSH AMX APF DAB EOX EYW FLL FMY GNV JAX KEY MCO 231
169. his program cannot be terminated with the X button without a password This feature insures that the user does not accidentally stop weather alerts Hint f the system tray icon is outlined with a red circle or a red led appears in the status bar the program is not communicating with the Weather Message Server Note The Silence button to the right of message description only appears when a one minute or continuous sound plays It disappears when the sound finishes or Silence is clicked Note If WxMcli is stopped with the window minimized the next time it is started it will start minimized System Tray When WxMcli is minimized you can restore the main screen by right clicking on the system tray icon m then select open 2011 Weather Message Software Message Client 121 Copyright 2011 Weather Message Software 92 Menu Options Tabular State Forecast The menu buttons on this screen perform these functions The File menu allows you to setup this program show details view logfiles and exit the program Setup Printer b Connect Exit The Setup option opens the Setup Windowl2 The Printer option selects the default printer and font size The Connect option forces the application to attempt a connection to the server The Exit option shuts down the Message Client Note f you enable the Password for Setup Exit you will have to enter the a password to access the setup screen or exi
170. hort for a short message Selected for selected text from the alarmed UGC group Selected No Head for selected text from the alarmed UGC group without the header Full for Full Text or Full No Head for Full Text without header 2 6 6 Notes The Archive Himl Exe Print tab is used to specify an alarm action for these categories 2011 Weather Message Software Weather Message Server Setup 67 ListProducts ListForecast Offices Alam Client Map X10 Notes Notes enter notes about this alarm here Optionally enter any information about this alarm 2 6 7 FTP HTTP Html Setup The Html Setup is used to select upload protocols and associate an optional html template for merging weather text 2011 Weather Message Software 68 Weather Message Server g FTP HTTP HTML Setup Settings Template FileName C WxMesgNet WxData Template Template htm Browse Destination File Name c wxmesgnet wxdata archive Sfilename Sexpire fileext Save To Local X Server Address Port 0 User Name Password lt meta http equiv Content Type content tet html charset windows 1252 gt lt itle gt Sample Template File lt title gt lt head gt lt body gt lt p align center gt Test Weather Message lt p gt lt p align center gt amp nbsp lt p gt m r asar caera mrar Use SMESSAGES to include Se weather text in your html code Ke
171. hunderstorm Warning Each of the values for this product identifier are separated by acomma Each product should appear on a individual line There should not be any blank lines in the file To deactivate an entry without deleting the line prefix the line with a single quote Lines that start with a single quote are considered comments Any products that appear in ProductUser dat are automatically added to the internal Product dat when the Weather Message applications start Products defined in ProductUser dat will override any product that already exists in Product dat 17 6 Paging E Mail Formats Weather Message supports a number of paging and e mail formats ranging from the full message text to a short message for pagers cell phones This section gives examples of the different formats The following paging e mail formats are available Full Full No Head Selected Selected No Head and Short In addition the message can be broken down into a number of packets for distribution to pagers cell phones The system will allow you to specify the size of these packets and the number of packets to send For messages sent via e mail you can specify the type of subject line sent You can send no subject line the product identifier or a text description of the product Regardless of the format selected the system has a parse option that allows you to abbreviate or remove words from the paged e mailed message The following torn
172. i Server Settings Alarms Product Colors Other Colors Map Base Map Layers Weather Message Server Host TCP IP Address Host TCP IP Port 9501 Backup Address Backup Port 9501 Client Identifier The Host TCP IP Address is the address of the Weather Message Server Enter the address of your primary server in this field Note When the Host TCP IP Address field is left blank WxMap will try to discover the address and port of the Weather Message Server If your server is on the same local network as the client it will automatically obtain the address and port If the client is running on a different network you will need to enter the address and port of the server The Host TCP IP Port is the port defined by Weather Message Server for connections The default is 9501 The Backup Address is the TCP IP address of your backup Weather Message Server Do not enter an address in this field if you do not have a backup Weather Message Server This address is used when the program cannot contact your primary Weather Message Server The Backup Port is the port defined for use by the backup Weather Message Server The default is 9501 The Client Identifier field allows you to assign each Message or Map Client a different identification number This identifier can be used to send a specific alarm to a specific client or group of clients 11 8 2 Settings Tab The Settings Tab is used to set operational inform
173. i u anaiona aaa a ao aiaa dahaa e a aa A h edia liceuesen Par aahei dedeuadiceyacentesestec 98 Internet Ingest Tab u u U U u UI UI UU us ssuasussasasusassassaaa 99 Common Tab uuu a uuu au a u asseussshukasqastaqstasusy as sk aiad da obddacuctssiaeuibedebes scedediat oti secaisecedetensde cesideebesecdes 100 Ingest Paths Tab E uuu asusa sassa 102 2011 Weather Message Software Contents III Part VII WxWw2000 Weather Wire Ingest 104 A OVORVICW E askhas cedtyccsstettececnctvencareantecndueestae siteegceeeutede A 104 2 Men OptiorniS uy u TS Qu S uu kusqa a vet eta ceceetenaveccectnuetetemuvPeteicend 105 3 Setup X susasamasatushakhusaSaaa au h vc emetic pce esta cence oe sta even cte meen ae aaa aaa aaan 106 Settings Tab uss cacs specs cscs castecc cethnt cca dete cess a ccades Pactabiaucincedatentdpetcaiy a 106 Common Tab uuu ask u S Sees aha cade ace ese a Eaa aA w sagu Sas Sead E etl 106 Ingest Paths Tab scsscsscssssessessessessesesseseeseesesessaesaeseeseesecasnaeseeseeaeeaeeaesaesenseesecaseaeseesesassaesaesaesesassnesenaesateaesansseass 107 4 Register SOT WANG u l a aispa aaa aa aa a aaa aaa aaa anaa 108 Part VIII WxPort NOAAPort Ingest 112 T OVerVIeW AR Oe SS ush kuah ahus e aeara aa Kaaa a aa aa ene ne 112 2 Men Options uuu au aus aa testes pec cence dace pune ad aana deaa aaea aa sa reaa aaa 113 3 lt Set p uum unai a aaa aaa A aaa aaea a Aaaa A aa 114 Settings Tab sersisiir renaisans ra
174. iation Area Forecast Southeast U S Aviation Area Forecast North Cent U S Aviation Area Forecast South Cent U S Aviation Area Forecast U S Rocky Mts Aviation Area Forecast U S West Coast Aviation Area Forecast Juneau Aviation Area Forecast Anchorage Aviation Area Forecast Fairbanks Fire Danger Indices Flash Flood Watch Flash Flood Guidance Headwater Guidance Flash Flood Statement Flash Flood Warning National Flood Summary Flood Statement Flood Warning Forecast Medium Range Guidance Upper Wind Fallout Forecast ETA FOUS Freezing and Relative Humidity Fire Warning Urban and Small Stream Flood Advisory WSR 88D Radar Outage Notification Fire Weather Administrative Message 2011 Weather Message Software 240 Weather Message Server FWC FWD FWE FWF FWL FWM FWN FWO FWS FZL GLF GLO GLS GSM HCM HLS HMD HMW HRR HSF HWO HYD HYM ICE IOB KPA LAE LAW LCO LEW LFP LLS LSH LSR LTG MAV MET MEX MIM MIS MON MTR MWS MWW NOW NPW NSH NUW OAV OFF OMR OPU OSO PBF PFM PFW PLS FO FN FE FN FN FN SH SH FN UX FZ FZ WW NX NG WT AG WO AS FZ FL SX cs FZ SV NT WO SM SX WO FL UX WH NW SF FO FO FE AG AX NT SA FZ WH FP WW FZ WO NO FZ SX FP SX FN FO FN SX NGM Mos Guidance Fire Weather Outlook Discussion Extended Fire Weather Outlook Routine Fire WX Forecasts Land Management Forecasts Miscellaneous Fire Weath
175. ices Weather Message provides the ability to view weather text and weather graphics on computers connected to a network with audible alerts for severe weather provides a map for seeing a visual representation of weather alerts can send abbreviated or full text weather messages to pagers e mail addresses fax machines and social networks archives weather products locally or to a website retrieves radar images and has the ability to activate electrical devices using X10 control Weather Message operates as a server for connected clients The Weather Message Server can be run as a standalone application or as a Windows service The message viewer image viewer and map are considered clients These clients can be run on the same computer as the server or located on a number of computers on your network Weather Message works by receiving weather products from the National Weather Service EMWIN data stream Weather Wire Service or NOAAPort For additional information see What is EMWIN What is Weather Wire and What is NOAAPORT Weather Message can receive weather products from satellite radio modem or Internet The received weather products are processed against alarms you setup in Weather Message Why use Weather Message It allows you to send abbreviated messages to pagers and cellular phones in addition it allows you to send weather products to other computers on your network and even ftp weather messages and warning maps to a website It i
176. identifier can be used when setting up your alarms 224 to send a specific product to WxLoader 15 5 2 Program Options Tab The Settings Tab is used to set operational information for WxLoader 5 LL Setup Server Program Options Tasks Upload On Change Z Firewall Proxy Update Every 60 Minutes Log File Size 50000 Timeout seconds 129 FTP Use Passive Mode Auto Startup No Save Cancel The Upload On Change option indicates whether WxLoader should process tasks when a new file arrives or a product expires Check this option if you want the program to process tasks when a new file arrives or a product expires If this option is not checked the process task cycle will occur based on the Update Every Minutes setting The Update Every Minutes option establishes the amount of time in minutes to process tasks The task processing cycle time can be set from 0 to 60 minutes If you set this field to zero minutes you must check the Upload On Change option Care should be used when setting this value When the specified amount of time lapses the program will process and upload each task Note Setting this value too low can cause the program to get behind when you have a slow internet connection The Log File Size field allows you to specify this size of your log file LoadLog txt The default is 50 000 bytes The Timeout field allows you to specific the maximum amount of time the program will wait on the HT
177. ies in the Retry Minutes field Clicking the Test Server 22 option will open a window that will test your Email Server settings The Backup Server and Backup SMTP Authentication fields can be used for a backup email server In the event that the primary server fails to respond the software will automatically switch to the backup server 2 4 2 2 1 Test Email Settings The Test Server option will display this window Use this option to test your email settings ri Email Server Test smtp hughes net x Email Server Responses gt DATA A lt 354 End data with lt CR gt lt LF gt lt CR gt lt LF gt lt 250 2 0 0 Ok queued as CD2394BB677A Forcing disconnection from SMTP server gt QUIT lt 221 2 0 0 Bye Remote host disconnected Status 0 OK Disconnected Email Succeeded Click the Test button to test your Email Server The text box will show the responses from your email server If you have your Email Server settings correct you will see the Email Succeeded message otherwise an error message will be displayed 2 4 2 3 Email Group The Edit Email Group window allows to setup a group to receive emails 2011 Weather Message Software Weather Message Server Setup 23 Edit E Mail Group Group Name Phone Create Group E Mail Subject Style None Create Group Short m n Message Maximum 0 Subject Overide Parse Address
178. ified TCP IP address and port It will send the group name followed by the message The group name appears in the first 20 characters The message starts at position 21 The message 2011 Weather Message Software 30 Weather Message Server is terminated with a carriage return line feed After the message is sent the application disconnects Twitter Facebook The Twitter and Facebook options require you to authorize Weather Message to post status updates When you select the Twitter or Facebook option an authorize button will appear in the window Click this option to display a browser window You will need to log into your account and authorize Weather Message The web page will give you the instructions for authorizing Weather Message When you authorize Weather Message the browser window will close The respective service will give Weather Message an access token to send updates to Twitter or Facebook For more information see Sending Tweets using Twitter s and Facebook Status Updates bs in the Supplement 2 4 3 4 Paging Group The Edit Paging Group window allows to setup a group to receive pages Pi Edit Paging Group Group Name Groupl Create Group Pager Style Header Trailer Size 0 Create Group Short Maximum 0 Message Parse V Tine Zone Gril sJ Pin Entry Format Service Name FireDept pin space 208 John Doe Pager Pin List 208 Danny
179. imum size of a county before the county name label is displayed 2011 Weather Message Software 164 Weather Message Server Check the Enable County Zones option to enable the county zone layer This layer is optional see the optional map layer noteles Check the Enable Marine Zones option to enable the marine zone layer This layer is optional see the optional map layer note hes The Polygon Style selects the style used to draw polygon lines The options are Pattern Area and Outline The Pattern option draws an outline using a pattern based on the color of the alarm The Area option draws an outline around the polygon and paints it the color of the alarm The Outline option draws a single outline based on the color of the alarm The Outline option does not paint the county The Polygon Line Size field specifies the size of the line used to draw the polygon outline The Polygon Pattern selects the pattern that is used to fill a polygon set to style Outline The options are blank Dot Cross Diagonal Cross Left slanting Diagonal Right slanting Diagonal Horizontal Vertical and Fill The Dot pattern draws small dots that same color of the alarm The Cross Diagonal Cross Left Diagonal Right Diagonal Horizontal and Vertical patterns draw fill lines based on the pattern selected The Fill option completely fills the interior of the polygon Hint f you change the Polygon Style Polygon Line Size or Polygon Pattern
180. in other areas of the country should not use this option until your local weather service office implements the WIND HAIL line in their Severe Thunderstorm products Alarm Validation When the alarm is saved the program performs a number of validations to insure that the alarm will work properly Any errors or warning messages are displayed to let you know about potential problems 2 6 2 1 VTEC Settings The VTEC Settings window allows you to further define your alarm requirements for the product If the product identifer associated with the alarm is VTEC enabled this window will be initially populated with all of the Phenomena and Significance supported by the product E VTEC Settings Primary VTEC Hydrologic VTEC Products Actions Phenomena Significance Operational 7 New v 7 Tomado A Warning Z Test E E Air Stagnation Extend Time 7 gn Advisoy r Experimental Extend Area F _ Areal Flood Statement F Extend Both Z Ashfall Outlook VTEC Canceled T Avalanche F t F Experimental oi f Upgraded Blizzard Synopsis System Test Expired E 4 m Correction F fie _ SelectAll Actions J Select All Significance Cer Sesion cee Primary VTEC In order to use Primary VTEC you must select at least one item from Products Actions Phenomena and Significance You can select multiple items from each category The Select All Action
181. ion When an alarm is received the system tray icon changes to the color red until all alarms have expired When alarms expire the time remaining field changes to expired Expired items remain in this list for 15 minutes Click on a row in the list to read the message that caused the alarm Hint Clicking on a row will automatically launch the message viewing window It also copies the displayed text to the windows clipboard 9 4 Product List The Message Client features a floating received products window You can minimize the main window and keep this small window open to monitor received products You can click on any of the received products to see the text or image associated with the product name Hint Clicking on a text product will automatically launch the message viewing window It also copies the displayed text to the windows clipboard To see a list of products received with the same product identifier hold down the shift key before clicking on the received product Note For products to appear in this list an alarm must be established in Weather Message Server 2011 Weather Message Software Message Client 125 G WZ Product List m RWRJKL AFMMEG FWFSGX SXMS50 RWRLA OSOTLH NOWYAK AFDMQT SFTJAN a The default product list has several options To see a list of options right click to see this menu Show All Wild Card BMX Split Li
182. ion Paths can be used to place a copy of the received weather text in different directories for processing by other programs For example if you use Weather Message to receive your weather data you can put a copy of the received messages in a second or third directory for processing by RealEMWIN or the Weather Message Retransmission program Note f the Use Defined Ingest Paths setting is checked you will not be able to change the paths listed 2011 Weather Message Software 208 Weather Message Server 15 15 1 WxLoader Overview WxLoader is a support application that can be used to manage weather content for websites provide data for other third party applications or control Pro Lite LED Signs If you plan to use WxLoader it should be placed in the startup box in Windows This will insure that the program is automatically started each time the computer is booted LL Weather Message Web Loader koba File Alarms Help Active Tasks 3 Active Alarms 0 Processing Task Test Process Completed at 07 06 2010 20 42 25 8 42PM Although Weather Message has provisions for uploading weather text and graphics it does not monitor expiration dates times for the uploaded products WxLoader working in conjunction with Weather Message Server has the ability to upload text products and monitor the expiration date times of these products This allows WxLoader to remove expired products and or replace
183. ire See the Weather Wire help for details When the program switches from Internet Ingest to WxWW2000 it will create a notification message in each ingest directory The product identifier for this message is ADMWXM If you want to be alerted when the program switches between ingest sources alarm the product ADMWX M with no state or county selected The notification message contains the current ingest method and computer name Should the Internet Ingest engine stop receiving data for 49 seconds and no backup source is selected a data loss notification message is created in each ingest directory The product identifier for this message is ADMWXM If you want to be alerted when the program loses data alarm the product ADMWX M with no state or county selected A fixed TCP IP server address can be used Enter the fixed TCP IP address in the Enter Fixed Address field Click on Use Fixed Address to only connect to that specific server The Timeout seconds on loss of data is set by default to 15 seconds The timeout can range from 10 to 600 seconds Setting this option to zero will disable the data loss timeout The Enable Version 2 option when checked will enable support for version 2 EMWIN packets This option is enabled by default and is the recommended setting Note This program communicates with WxBBSrvr using UDP port 9510 on the local loop back address 6 6 4 Common Tab The Common Tab is used to define options common or shared by
184. item Make any changes and click on Change To delete a category item first select the category then the category item and press the keyboard delete key or click on the Delete button Note The program will not allow you to enter a duplicate file name 2011 Weather Message Software 146 Weather Message Server 11 WxMap Client 11 1 Overview The Weather Message Mapping application WxMap is used to visually plot received weather products from Weather Message Server on a graphical map WxMap uses GIS technology to allow you to view any part of the United States map and its possessions WxMap can be installed on any computer attached to a TCP IP network Based on your alarms and settings WxMap can popup a window play different sounds and read the alarm using text to speech WxMap should be automatically started when your computer is started WxMap runs from the system tray The map included with the default installation does not show interstate roads forecast zones or marine zones To add these optional map layers download and install the optional map layers from your CD or the Weather Message downloads page r x t Weather Message Map nol wS File Silence Map Views Savelmage Help Map Legend St Clair AL Tornado Warning Tornado Watch TOR continued at 10 26 2010 15 30 00 Connected Weather Message Net Se 33 8403688 86 1785645 48 3 08PM Hin
185. itle ownership rights and intellectual property rights in the Software shall remain in Author The Software is protected by copyright laws Title and related rights in the content accessed through the Software is the property of the applicable content owner and may be protected by applicable law This License gives you no rights to such content V TERMINATION The license will terminate automatically if you fail to comply with the limitations described herein On termination you must destroy all copies of the Software VI LIMITATION OF LIABILITY UNDER NO CIRCUMSTANCES AND UNDER NO LEGAL THEORY TORT CONTRACT OR OTHERWISE SHALL AUTHOR OR ITS SUPPLIERS OR RESELLERS BE LIABLE TO YOU OR ANY OTHER PERSON FOR ANY INDIRECT SPECIAL INCIDENTAL OR CONSEQUENTIAL DAMAGES OF ANY CHARACTER INCLUDING WITHOUT LIMITATION DAMAGES FOR LOSS OF GOODWILL WORK STOPPAGE COMPUTER FAILURE OR MALFUNCTION OR ANY AND ALL OTHER COMMERCIAL DAMAGES OR LOSSES IN NO EVENT WILL AUTHOR BE LIABLE FOR ANY DAMAGES IN EXCESS OF THE AMOUNT AUTHOR RECEIVED FROM YOU FOR A LICENSE TO THE SOFTWARE EVEN IF AUTHOR SHALL HAVE BEEN INFORMED OF THE POSSIBILITY OF SUCH DAMAGES OR FOR ANY CLAIM BY ANY OTHER PARTY THIS LIMITATION OF LIABILITY SHALL NOT APPLY TO 2011 Weather Message Software Software License 263 LIABILITY FOR DEATH OR PERSONAL INJURY TO THE EXTENT APPLICABLE LAW PROHIBITS SUCH LIMITATION FURTHERMORE SOME JURISDICTIONS DO NOT ALLOW TH
186. ive 2011 Weather Message Software Weather Message Server Setup 53 Product State County s Client Map Alarm Type Pager Groups Pere Yes No None Ni wm Na ve O A N Hint Alarms that appear with a yellow background are inactive To edit an exiting alarm double click the alarm For other options select the alarm and right click to see these menu options Set In ctive Test Alarm The Add option will add a new alarm The Edit option will edit the selected alarm The Delete option will delete the select alarm The Copy option will copy the selected option The Paste option will paste the last copied alarm as a new alarm The Set InActive option will disable an alarm You can also set and alarm inactive on the alarm screen e The Test Alarm option will generate a test message that matches your alarm Note The Test Alarm option may not work for alarms that have wild card characters 2 6 2 Alarm Tab When adding or editing an alarm this window is displayed The alarm tab contains the information for selecting the weather products to alarm 2011 Weather Message Software 54 Weather Message Server Edit Alarm 1 TORBMX List Products List Forecast Offices List States Alam Cient Map X10 Paging Email Fax Archive Html Exe Print Notes Tornado Warni Product TORBMX WFO Birmingham AL States Counties V Alabama a X Talla
187. k insert spotter line Counties A list of the counties alarmed CountiesState A list of the counties alarmed followed by their state IfCounty word If county names are available include word IfExpire word If expiration time is available include word IfExpires word If expiration time is available and not VTEC cancellation include word UserDef1 Paragraphs that start with a user defined string Lines x y Include y lines starting at line x Now For Now product insert the now statement Concerning For SWOMCD product insert the concerning statement AreasAffected For SWOMCD product insert the areas affected statement Location Paragraphs starting with LOCATION or LOCATION HvSiteld IHVTEC site identifier HvSiteDesc IHVTEC site identifier description HvSeverity IHVTEC Flood Severity HvCause IHVTEC Cause HvBegin HVTEC Event Beginning Time AM PM HvBegin24 HVTEC Event Beginning Time 24 hour HvCrest IHVTEC Crest Time AM PM HvCrest24 IHVTEC Crest Time 24 hour HvEnd IHVTEC Event Ending Time AM PM HvEnd24 IHVTEC Event Ending Time 24 hour WindSpeed Wind speed in miles per hour HailSize Hail size in inches The lfCounty word lfExpire word and lfExpires word codes can be used to insert words if the message will include county names and or an expiration time In the example shown above the code lfCounty for means to include the word
188. l result in TONIGHT INCREASING CLOUDS A SLIGHT CHANCE OF A SHOWER AFTER MIDNIGHT LOWS IN THE LOWER 50S NORTHEAST WINDS 5 TO 10 MPH CHANCE OF RAIN 20 PERCENT W SUNDAY MOSTLY CLOUDY WITH SHOWERS AND THUNDERSTORMS LIKELY BY AFTERNOON STORMS POSSIBLY SEVERE IN THE AFTERNOON HIGHS IN THE LOWER 70S EAST WINDS 10 TO 15 MPH BECOMING SOUTHEAST IN THE AFTERNOON CHANCE OF RAIN 70 PERCENT SUNDAY NIGHT SHOWERS AND THUNDERSTORMS STORMS POSSIBLY SEVERE LOWS IN THE LOWER 60S SOUTHEAST WINDS 10 TO 15 MPH CHANCE OF RAIN 80 PERCENT MONDAY VARIABLE CLOUDINESS WITH A CHANCE OF THUNDERSTORMS HIGHS IN THE UPPER 70S CHANCE OF RAIN 30 PERCENT MONDAY NIGHT PARTLY CLOUDY WITH A SLIGHT CHANCE OF SHOWERS LOWS IN THE MID 50S CHANCE OF RAIN 20 PERCENT TUESDAY MOSTLY CLOUDY AND COOLER WITH A CHANCE OF SHOWERS HIGHS 60 TO 65 CHANCE OF RAIN 30 PERCENT WEDNESDAY AND THURSDAY MOSTLY CLOUDY WITH A CHANCE OF SHOWERS EACH DAY LOWS IN THE MID 40S HIGHS 60 TO 65 FRIDAY PARTLY CLOUDY LOWS IN THE MID 40S HIGHS 65 TO 70 SATURDAY PARTLY CLOUDY LOWS NEAR 50 HIGHS IN THE MID 70S T
189. l special prefixes WRO WRP and WRQ can also be used These prefixes are not defined and can be setup using the Support Setup Special Prefix 42 menu option Hint To alarm METAR products enter MTR as the first three letters of the product identifier followed by the four letter station identifier For example to alarm the METAR for KALX enter MTRKALX for the product identifier Note If a message does not contain a valid Product identifier the program will use the first six characters of the WMO header This allows you to alarm products that do not have Product identifiers 2011 Weather Message Software Weather Message Server Setup 55 In addition to text products you can setup alarms for graphic products Graphic products cannot be sent to the map or paged They can be sent to the message client emailed archived and passed to an external exe program To alarm a graphic product use its 8 character EMWIN file name Hint The product identifier GRAPHI will match all graphic products To aid you with the entry of product identifiers you can click on List Products to view and select a product To view or select a weather forecast office click on List Forecast Offices Note The product and forecast office list may not include all products or forecast offices distributed by EMWIN NWWS or NOAAPort The National Weather Service routinely updates these lists As they are updated they are incorporated into the nex
190. l style is selected The Combine Like Products option is used with the short format It causes the program to combine like messages into one sentence The Delete Inactive option when checked will cause the program to remove the destination file when the message to upload is empty The Expire Adjustment field allows you to modify the expiration times of received products For example you could specify 10 or 10 minutes In some applications you may want the message to remain active longer than the actual expiration time In other applications you may want the message to expire before the actual expiration time The Expire After Minutes option is used to expire products that do not contain an expiration date time Products that do not contain UGC lines do not have an expiration date time The amount of time specified for this option will be added to the product issue date time to determine the expiration date time This value does not effect products that contain UGC lines Hint f you alarm products that do not contain UGC lines you should enter a value in the Expire After Minutes field Failing to do so will result in the message expiring immediately 15 5 3 1 2 Destination Tab The Destination window is used to set destination path and method for the task 2011 Weather Message Software 218 Weather Message Server L Edit Task x File Separator Default Message Task Destination Products
191. lay error messages We recommend that you backup the current file before making any modifications 2011 Weather Message Software Weather Message Server 77 3 7 Log Files Weather Message creates a number of log files to record the operation of the software For Weather Message Server the main log file is named LogFile txt This log file records alarms activated for pagers emails faxes clients archives and print requests This file is located in the WxMesgNet directory It also contains connection requests from clients and disconnect request from clients You will also find any program error messages encountered when processing weather messages If you send messages to an email paging or fax group a log file is created for these operations Email activity is recorded in EmailLog txt pager activity is recorded in PagerLog txt fax activity is recorded in FaxLog txt The Weather Message Server Setup screen allows you to change the log file size The default size is 50 000 bytes Once it reaches this limit it is copied to the file LogFile old and a new log file is created This prevents your hard drive from filling up with large log files If you have the Daily Logs option enabled the log files are stored in the WxLogs directory 3 8 Debug Files Weather Message creates a number of debug files to assist users when they encounter trouble with Email Paging Faxing Archiving and X10 control The following debug file
192. lerts window allows you to configure the software to notify a group of people if it does not receive data for a specific period of time 2011 Weather Message Software 32 Weather Message Server Data Alerts Setup Pager Group E Mail Group Message Client Alert when no data is received for Minutes Send Alert Execute Program To activate data alerting set the number of minutes that the program should wait without receiving data before sending an alert You can specify a Pager Group Email Group Message Client to receive the message The program will send a brief message indicating it is no longer receiving data The message will also includes the name of the computer When data resumes you will get a second message indicating that it has resumed In addition to sending Pager and Email alerts you can also execute an external program Enter the external program including the full path in the Execute Program field This program will be executed when data stops It will not execute the program when data resumes Hint Loss of data occurs when Weather Message server does not find any files in the Ingest Directory 1 for the period specified 2 4 5 Options 2 4 5 1 General Tab The Option s General Tab contains general settings for the server 2011 Weather Message Software Weather Message Server Setup 33 Program Options General Product Collectives FTP
193. leted Note Weather Message starts a product purge cycle every 30 minutes 2 4 5 7 Service Tab The Option s Service Tab allows you to configure Weather Message Server to run as a Windows service Program Options General Product Collectives FTP Ingest Protocols Purge Service Service Status Not installed as a service Install Service Start Service Save Cancel To run Weather Message Server as a Windows service you need to click the Install Service button This will perform the steps to install Weather Message Server as a service After the installation completes the Install Service button will change to Uninstall Service You can click Uninstall Service to return to normal operation If Weather Message is installed as a service the Start Service button will be enabled Click Start Service to start Weather Message Server in the background After the service starts the Start Service button will change to Stop Service You can stop the service by clicking Stop Service Hint After installing Weather Message Server as a service the user interface and system tray icon for the server will not be visible Use Weather Message Controller 8 to monitor the server Note When Weather Message Server is running as a service Weather Message Server will automatically start in the background when your computer is started You do not have to log into the computer for the server to start
194. lors E i o uA A E E 133 Quick List Tab DAE 134 8 Texttt Speech saris u Sua aa usasapa aa 135 Part X Image Viewer 138 1 OVerVIieW iaioe aaaea a a aa a aaa a e a spa ua asa aaa uu iss a uuuwa u aso 138 2 IPQ TMU Options irc uuu ua Saam as aw a aE eaa 138 3 Mage Options u au uu Du scene anc esate iS ua q i uki Eea aaa aa a 140 4 Selecting Images U U U u u uu u u uuu uuu uu u 141 5 Image BOWSER noe ececcccsccentecdsscccsenecectecvencues snseesnecddenecesnieeddeceeuaecdstuecsdnctiednccestuececestsvsnesetuecseendenaie 142 6 Set p RE eo eo oS SS on OR oS BS SOB oe PE En EB sunum usss 142 Program N o M T T E E 142 Images TAD jesceccscisssencssgeatistedeascacocecadiucetvenssvactcncadsacecascssueed abceineusausecavestanisdesusniyedecsdudepuapissuentassasyeustsducesuaptasgertazexs 143 2011 Weather Message Software Weather Message Server Part XI ON oO Q WD Part XII a O N a Part XIII O N WxMap Client 146 OVER T E E E E S E E E fvosuceovsacuuectuaaeeds 146 Men OptiorniS u u aaa aaa S Saa S Areaan aea Eaa eaaa aan 147 Main WiINdOwW u u E 150 Map Legend uu L anani aaaea aaa iaaa aaa aN a aa iaaa aaa aaa 151 County Informatio in IL L ua SS R asia a aaa su 152 VIEWS G Sussaukuasssmapamiaswassnikasas kushassstayssisuskakassskakayasasaskasastakakqasskayapaschywkassstakaspusaiasss 155 Active Alarme snan nA ARR beveauedstuaawed i seaueesvtaaucussbvaawebisvaauedsvvaauedednaueeds 1
195. m the Message Creator or Siren Controller The Pass Code entered in the Message Creator and Siren Controller must match this Pass Code otherwise the received messages will be ignored 2 4 5 2 Product Tab The Product Tab allows you to specify validation options for received products a Program Options General Product Collectives FTP Ingest Protocols Purge Service Product Validation Maximum expiration time 72 hours Defective UGC expires in 30 minutes Log defective products v The Maximum expiration time limits the expiration date and time of a received product to the number of hours entered If the product expiration time as compared to the product issue time exceeds the number of hours entered the expiration time is reset to the number of hours 2011 Weather Message Software Weather Message Server Setup 35 entered The Defective UGC expires field sets the number of minutes that should be used for the expiration time should a received product have a defective UGC line If a received product has a defective UGC line these minutes will be added to the product issue time to establish the product expiration time The Log defective products option when checked will cause the software to log all defective products in the log file 2 4 5 3 Collectives Tab The Option s Collectives Tab allows you to optionally store collectives in a user defined directory E Prog
196. med for closer inspection To activate these features right click on the image and select one of the displayed options 2011 Weather Message Software WxRadar 201 Pan Zoom In Zoom Out BAD EG Zoom Window Zoom 100 5 Zoom Fit S NP Magnify Zoom 600 Zoom 400 zoom 200 zoom 75 zoom 50 zoom 25 zoom 10 The default view is Zoom 100 To print the displayed image click on the File menu and select Print The image will be printed to your default printer Note If WxRadar cannot download the requested radar image a Radar Unavailable image will be displayed The Radar Unavailable image can be customized by changing the RadUnavl gif file 14 4 Scheduling To schedule radar images for automatic retrieval click on the Schedule menu The main window will change to allow you to setup schedules 2011 Weather Message Software 202 Weather Message Server u WxRadar Sh mee File Preview Retrieve Now Help State Radar Site KBMX BIRMINGHAM Alabaster Image Reflectivity 124 miles z Layers Topo V Radar V Counties F Rivers V Highways v Cities Z Warnings V Legend Radar Site Interval Image File Name KBMX 5 Minutes Reflectivity 124 miles RADBMXAL KMXX 4 Minutes Reflectivity 124 miles RADMXXAL HI h lt Interval 4 lt Minutes File Name Id 9 36 PM RADMXXAL gif copied to ingest
197. ment Directors Public Safety Officials Amateur Radio Operators Business Owners Media Outlets Weather Hobbyists Schools Hospitals Anyone who has a need for up to date weather information can benefit from EMWIN 2011 Weather Message Software Supplement 259 For additional information on EMWIN visit the National Weather Service s EMWIN Information web page Weather Message uses this data stream to provide desktop alerts of impending weather situations 17 12 What is Weather Wire The National Oceanic and Atmospheric Administration Weather Wire Service NWWS is a satellite broadcast system that delivers critical National Weather Service information CSC Systems amp Solutions operates NWWS This service is available using their proprietary C band service or Internet connection This system routinely delivers 99 percent of all messages within six seconds Established in October 2000 the system collects data from 141 U S Weather Centers and special centers around the country and broadcasts a continuous stream of alphanumeric information Users may receive as much of the information as they want for a low fixed annual fee Current customers include radio television and cable stations universities state and federal emergency management services and many other government agencies For more information on NWWS see DynCorp s website at http www weatherwire net or NOAA s website at http www nws noaa gov n
198. ncludes support for posting weather alerts on Facebook and Twitter Weather Message Server Message Client and Weather Message Map run in the background on the client computers Weather Message can be downloaded from the Internet and has a 30 day evaluation period You can download it at http Awww wxmesg com Weather Message Weather Alerting Software http www wxmesg com Copyright 2011 Weather Message Software Data Warning Warning Due to the nature of the EMWIN Weather Wire and NOAAPORT data streams it is possible on rare occasions for weather messages to be missed or not processed This can be caused by satellite black out technical problems weather conditions poor Internet connections or corrupted messages Weather Message makes deliberate attempts to process all received messages even those that may have been corrupted Because of 2011 Weather Message Software Introduction 9 1 3 1 4 this the expiration times of some messages may be set to a default of 30 minutes or 72 hours With any watch or warning you should read the text of the message to validate the expiration time Obtaining Help Email Support If you need help with Weather Message send an email to help wxmesg com Mail Support You can reach the program author by mail to Weather Message Software 203 Old Shepard Road Dadeville Alabama 36853 Weather Message Website You can check for software updates and info
199. ne The Pass Code field contains the password or pass code used to validate the Message Creator The Pass Code must agree with the one setup for Weather Message Server otherwise the message will be ignored The Send to Server option when checked will cause the Message Creator to send messages through a tcp ip connection to the server When the option is unchecked the Message Creator will create messages in the ingest directory ies 2011 Weather Message Software 182 Weather Message Server 13 13 1 Overview WxScheduler The Weather Message Scheduling application WxScheduler is used to schedule user defined messages or retrieve internet products WxScheduler can be run as a standalone application or as a Windows service F 8 WxScheduler F J J File Pause Help 01 22 11 14 41 01 22 11 20 41 system tray icon WxScheduler is generally used for two purposes to schedule monthly tests of the software and or download weather text or graphics from the Internet By allowing text and graphics to be downloaded from the Internet weather products not available from EMWIN or Weather Wire can still be obtained for local use and processing You can establish schedules to retrieve messages or graphics from local directories or from the Internet using the FTP or HTTP protocol The retrieved products are automatically copied to the ingest directory at the user defined time or interval The
200. ngine s to be automatically started when Weather Message Server is loaded Check Emwin Serial to start the EMWIN serial port ingest program Check Emwin Internet to start the EMWIN Internet ingest program Check Emwin So De to start the EMWIN Software Demodulator ingest Check Weather Wire to start the Weather Wire ingest program Check NOAAPort to start the NOAAPort ingest program Note Weather Message supports simultaneous ingesting from all data sources If you want to receive data from multiple sources select each source as appropriate Weather Message will filter duplicate messages so they will not be alarmed twice Simultaneous ingesting provides a level of redundancy When the Save button is clicked the Ingest Data and Graphics paths are validated If they do 2011 Weather Message Software 16 Weather Message Server not exist a message box will appear asking you if they should be created This screen also contains a grid for entering alarms The alarms displayed in the grid are from the alarm file selected in the Alarm File field The alarm grid can be sort by clicking on the column header Click once for descending order click again for ascending order Hint The widths of the alarm columns can be changed To change a column width position your cursor over the column line hold down the left mouse button and drag the column line Hint The location of a column can be changed by dragging the column to anothe
201. nirea ara a araia ranae Aa E raare E aTa eara sinia naa aaea oara iarasi aai 114 COMMON Tea ug u T T sunset E E E A 115 UCTC e u A A E E E E 116 Ingest Paths Tab ullu u luu u u ul UU UU u u Sau sss sswsssawsswawassssmssmausasssas awsswasassssssssswsasss 116 4 FREGISTCr SoftWare u uu Uu a scent aS aaa a a Aaaa aaa iaa e a Aaaa aa Aaea aaa iaa aaaea aaan 117 Part IX Message Client 120 T OV rVISW Ja nidaou anaana andaian auqa aaea aaae HE aaa eda qa t aa ua quwaq aa aaa sagu Aaaa Sa 120 2 M u Option uu uuu aaa E E aukaquwaquu qawa u qu 121 3 Main Window UU UU UU ANNANN NNNNA NARRAN RANN ANANN 123 A Prod ct List II ct aaan aeaaeae aa Goce saat penta aAa aaea aa aaae Aaea aaa aena aeai daa 124 5 Request PFrod 8t II IIS aa aiaa aaa eaaa aaa aaa aa a daadaa 126 6 Request Product List J U U U u uu uu u u uu uu uu u 128 f SID vestnevccnernsececceccecuerecnccesenaveescte econ susveanccceceedsuacvuseassuactestabedvecnnesccueseaucercetavstereoedesteeuiude 128 Server Tab en a E E E ee es 128 Settings Tab Trinia a scan Sespewscactteseedee decpanks cath dadacesOdeecvauy aces pas cas eacesessdusieeuesentecesd 129 Settings Tab ou u a S a ae sS sss ace Eee s au Q au aN eek il a cee oe eth 131 Alarms Tab ws tscvesssasssseccoecnsesessiasesscvansreascsnsdiieadssacsenaasaieacsnenubantidvecseseuneadsaandedusdubiensesavoaicadssucdduuadabiensessvoaieacssesses 131 Prod et Go
202. nn annaa 168 EAr eTo en E a e E E E A P E Cu us 168 Landmark I uu as sisa asss sSisssssawassisssasaskascsSaykss says aasSssass sassa s Sasa raa ara Koca ikue PEES datar Eai anrs aeina asiaasi Arasia sana 169 WxMesgText 172 S N a EE E E E E E E E E E E 172 AUSTRO oiio a l DAAE AE A cette stadia lengecue senate sate weatecereeedtederaduersuecedeedrese 173 Expert Mode sea AAA AEA EANA 174 Simple Mode III saaana aaa aana eh anai aa ee redbeesicn aaaeaii aai aada iaaeaie 175 SeluD E a a E E E E E S E N EE SS 177 Settings Tab sssrini paiiar a E A eain aia a Eaa eaaa ai EE osian aaa aoaaa iaaiiai 177 State Counties T p uu a an u aaa raaa aa huan uqa asua a diaig 178 SeiVeriTaD Cg W E W S S Susu ua aw a Saa 178 WxScheduler 182 OVERVICW E A E EEE EEE EAE A evi eve vedas eevee 182 Menu Option S pismie u Ruku aaa mua asa 183 Creating Text Messages l u u u uu u u uuu u J J J J 183 Set p usus u au sss Di aus s au u u asas 184 SOME CUMS TaD uyu E um u m A E n S u Su sumata 184 Edit Sehed lediilteni n u au su naam n tapuy ae aeaa a aaa 185 Settings Tab Qu uu asss 189 Firewall OXY ses u scaacelsayasnsatessdexsctncaaeenacssiscaaicrvactescusssceiieecausenestesahsabaptdetesasiissecasstiansahsteeasssscas s 190 Ingest Paths Tab EEE E E ite 192 Examples Lu u A E A E E 193 2011 Weather Message Software Contents V Part XIV a WO N Part XV a W N 6 Part
203. nneapolis EAU MN WFO Duluth INL MN WFO Minneapolis MPX MN WFO Minneapolis MSP MN North Central RFC Chanhassen MSR MN WFO Minneapolis STC MO WFO St Louis COU MO WFO Kansas City Pleasant Hill EAX MO Missouri Basin RFC Pleasant Hill KRF MO WFO St Louis LSX 2011 Weather Message Software 234 Weather Message Server MO MO MO MS MS MS MT MT MT MT MT MT MT MT MT MT MT MT NB NB NB NB NB NB NC NC NC NC NC NC NC NC ND ND ND ND ND NE NE NE NM NM NM NV NV NV NV NV NV NV NV NV NY NY NY NY NY WFO Kansas City Pleasant Hill WFO Springfield WFO St Louis WFO Jackson WFO Jackson WFO Jackson WFO Billings WFO Billings WFO Missoula WFO Billings WFO Missoula WFO Glasgow WFO Great Falls WFO Great Falls WFO Missoula WFO Glasgow WFO Billings WFO Great Falls WFO Hastings WFO Hastings WFO Omaha WFO Omaha WFO Omaha WFO Hastings WFO Wilmington WFO Raleigh Durham WFO Morehead City WFO Wilmington WFO Morehead City WFO Wilmington WFO Raleigh Durham WFO Raleigh Durham WFO Bismarck WFO Eastern North Dakota Grand Forks WFO Eastern North Dakota Grand Forks WFO Bismarck WFO Bismarck WFO North Platte WFO North Platte WFO North Platte WFO Albuquerque WFO Albuquerque WFO Albuquerque WFO Elko WFO Elko WFO Las Vegas WFO Elko WFO Elko WFO Reno WFO Reno WFO Las Vegas WFO Elko WFO Albany WFO Albany WFO Binghamton WFO New York Ci
204. not have a backup Weather Message Server This address is used when the program cannot contact your primary Weather Message Server The Backup Port is the port defined for use by the backup Weather Message Server The default is 9501 The Client Identifier field allows you to assign each Message Client a different identification number This identifier can be used to send a specific alarm to a specific client or group of clients 9 7 2 Settings Tab 1 The Settings 1 Tab is used to set operational information for the Message Client 2011 Weather Message Software 130 Weather Message Server Weather Message Client Setup ax Server Settings 1 Settings 2 Alams Product Colors Quick List Password for Setup Exit F Password anan Enable Popup Selection Auto Startup No x Receive Graphics W wa E s Graphics Purge Time 12 Hours Single Instance V Start Up Wave File TTS Weather Message Client Starting Browse Play The Password for Setup Exit option allows you to require a password to access the Setup menu or exit the program The Enable Popup Selection when checked will give the user the capability to enable or disable the applications popup operation The Enable Disable option will appear on the system tray menu The Receive Graphics field should be checked if you want to receive weather graphics Note Weather Message Server would also have to be setup to sen
205. not otherwise used by the software The font for the landmark can be selected by clicking on the Font button Although each font field can be manually changed the recommended method is to use the Font button to select the font The color of the font can be selected by clicking on the color shown next to the Font Color label The Label Background and Label Outline buttons allow you to establish colors for these respective items 2011 Weather Message Software 172 Weather Message Server 12 WxMesgText 12 1 Overview Weather Message Message Creator is a support application that can be used to create test weather messages These message can be used to test your alarms or create local messages for other alerting purposes File Clear Counties Help Dad amp WMO VUUS52 KBMX SWXUTCS AWIPSID TORBMX Expires UTC 10 17 2010 02 56 j County Selection Message WxCounties WxExpire gt County Body O NEW KBMX TO W 9000 WxWeclssue WxViecExpire J re L Autauga BULLETIN EAS ACTIVATION REQUESTED d i TORNADO WARNING s Tat LEE COUNTY EMERGENCY MANAGEMENT AGENCY eee WxDate Appling THIS IS A TEST TEST TEST OF THE LEE COUNTY SKYWARN WEATHER INFORMATION NETWORK LEESKYWIN THIS MESSAGE IS FORMATTED AS A TORNADO WARNING FOR THE PURPOSE OF ACTIVATING ALARMS IN THE LEESKYWIN NO TORNADO WARNINGS EXIST 4 alii WHEN REQUIRED THIS TYPE MESSAGE A TORNADO W
206. nt The left and right pane can be resized by dragging the white separator line between the panes System Tray When Weather Message Server is minimized you can restore the main screen by right clicking on the system tray icon Ee then select open Special Keys Pressing control u while the main window has focus causes the program to start a file purge cycle 3 2 Menu Options WX Weather Message Server 3 7 File Help The menu buttons on this screen perform these functions The File menu allows you to setup the server view connections log files show the active ingest programs and exit the program 2011 Weather Message Software 74 Weather Message Server 3 3 Setup View Connections View Logfile View Email Log View Pager Log View Fax Log FTP Ingest Show Ingest Exit The Setup option launches the Weather Message Server Setup 12 application The View Connections option displays a window with the Active Connections 75 The View Logfile displays the server log file in notepad The View Email Log displays the email log in notepad The View Pager Log displays the pager log in notepad The View Fax Log displays the fax log in notepad The FTP Ingest option display a window to manually request a ETP file ingest 7 The Show Ingest option shows the main window of each ingest program running the background The Exit option shuts down Weather Message Server
207. o Internet Ingest if Internet Backup is enabled Note Once Internet Ingest is started it will not be stopped until the Software Demodulator 2011 Weather Message Software WxEmwin EMWIN Ingest 99 Ingest begins to receive valid data When the program switches to Internet Ingest it will create a notification message in each ingest directory The product identifier for this message is ADMWXLM If you want to be alerted when the program switches between ingest sources alarm the product ADMWXLM with no state or county selected The notification message contains the current ingest method and computer name Should the tcp ip port associated with the software demodulator stop sending data and no backup source is selected a data loss notification message is created in each ingest directory The product identifier for this message is ADMWXM If you want to be alerted when the program loses data alarm the product ADMWXLM with no state or county selected The Log Demod Status when checked will cause the program to log the software demodulator statistics every three seconds Note This program communicates with WxBBSrvr using UDP port 9510 on the local loop back address 6 6 3 Internet Ingest Tab The Serial Ingest Tab is used to define the communication port backup options and other general operations E WxEmwin Setup Serial Ingest Software Demod Intemet ingest Common Ingest Paths Enabled
208. o the Message Client This Alarm Type causes the Message Client to play a wave file and pop up a minimized screen based on your settings In addition it uses the color associated with the alarm type to display the message description on the status line and in the Product List window Message Client supports up to 40 different alarm types To select a specific alarm type click on the up or down buttons adjacent to the Type field Click on the Browse button to select a wave file Each wave file can be played Once for 1 minute or Continuous To hear the sound associated with the alarm click the Play Wave File button Alarms can be silenced by clicking on the Silence button The number of the alarm to be played is determined when the Alarm is established in Weather Message Server Setup The Wave Option controls how the message client plays sounds for matching alarms For standard wave files select Play Wave to play sounds based on product identifier select AWIPS to Wave to announce the product using text to speech select Read Short and to read the received message using text to speech select the Read Text option Note The text to speech options work on Windows XP and later operating systems The Product to Wave option is used when you want a specific sound to be played based on the product identifier When using this option you will create a wave file that has the same name as the product identifier This wave file should be saved in the S
209. od txt from the directory WxMesgNet WxData WxLocal This directory is used when Opening and Saving message templates The message must be formatted like a standard National Weather Service Message You can view actual NWS products at http www wxmesg com asp recprod asp The actual messages can be used as examples for formatting The following special codes can be used in the message WxUTC Current UTC time in the format ddhhmm WxExpire Expiration time in the format ddhhmm WxDate Current local date and time WxVteclssue Issue time for the VTEC line WxVtecExpire Expiration time for the VTEC line WxCounties The counties selected for this message By using these codes the program will automatically substitute the current UTC time message expiration time and the current local date and time in the test message This keeps you from having to manually enter those parameters The expiration time is set to 15 minutes after the 2011 Weather Message Software WxMesgText 175 current time Look at the screen shot above for the proper location of these variables You can change the AWIPS ID and other information to agree with the alarm that you want to test To test an alarm the AWIPS identifier and associated counties must match your alarm in Weather Message The Select All button will select all of the listed counties The Clear button will clear the county selections After you have the test message
210. of received files to review A received files list is maintained for each NoaaPort channel e The Exit option shuts down WxPort Note n order to view the Files Received Log the Log Received Files option must be enabled The Register menu allows you to register s2 the WxPort software This button does not appear if the software is registered Note If the software is not registered after 60 days it will stop functioning The Channels menu allows you to enable or disable a NoaaPort channel 2011 Weather Message Software 114 Weather Message Server NWSTG 1201 GOES 1202 NWSTG2 1203 OCONUS 1204 Check a channel to activate that channel Uncheck a channel to disable that channel The Help menu allows you to see this manual and display information about the program Weather Message Help About Weather Message on the Web E Mail Program Support 8 3 Setup 8 3 1 Settings Tab The Settings Tab is used to define the communication port backup options and other general operations WxPort Setup Settings Common Filters ingest Paths Interface Address Global Ingest Paths Binary Files Drop Save GOES Images BMP Name by AWIPS Z The Interface Address is the TCP IP address of the network device that will be providing the multicast packets This field can left blank to default to the local network interface card The Glo
211. ons allow you to compose complex matching patterns For more information on regular expressions visit Regular Expressions info You can test regular expressions at this RegExLib com or RegExr Online Regular Expression Testing Tool Here is an example using regular expressions Severe Thunderstorm products normally contain the text WINDS IN EXCESS OF XX MPH If you want to alarm this product when the winds are 65 MPH to 99 MPH use this regular expression in the Match Text Field s WINDS s IN s EXCESS s OF s 6 5 9 7 9 0 9 S Remember to check the RegEx box For Hazardous Weather Outlook products it is common to prevent the alarming of the message when storm spotters are not needed Enter this regular expression in the Exclude Text field s 4 IS SNOT SANTICIPATED WILL SNOT SBE SNEEDED NO SHAZARDOUS sWEAT HER sIS SEXPECTED Remember to check the RegEx box Alarm Active Option The Alarm Active option is used to enable disable an alarm When an alarm is disabled it is shown in the main alarm grid with a yellow background Set VTEC Valid Time Event Code The Set VTEC s7 button is used to setup specific VTEC events primary and hydrologic to be matched for this product The color of the Set VTEC button indicates the status of this option Camee Serre Ifthe background color is light green VTEC has been setup for this alarm If the background color is white VTEC is available but not set If th
212. or messages that have been received since the server was started The number to the right of the slash is the number of messages that are queued for processing but have not been processed The Alarm File box displays the number of the alarm file current loaded See Alarm File 14 in Weather Message Server Setup for information on selecting alarm files The Message Clients box contains the number of connected message clients The Map Clients box contains the number of connected map clients Note Weather Message currently allows for 50 client connections This can be increased to 2011 Weather Message Software Weather Message Server 73 100 or 250 by purchasing a 100 or 250 user license Note f Weather Message is stopped with the window minimized the next time it is started it will start minimized Note Weather Message will process files with the extensions txt gif jpg zis Zip bmp png tif and bin Other extensions will be handled as a regular text file Note f Weather Message is running as a service you will not see this window or the system tray icon Use Weather Message Controllerls to monitor the operation of the server Service setup information can be found in Weather Message Server Setup Support Setup Options Service Tab 41 Status The right pane contains status messages from the subsystems Each subsystem displays status messages as they process messages that meet your alarm criteria Hi
213. or service distributed by the National Weather Service does not output statistics Depending on the EMWIN signal being decoded the first group will display FSK Receiver or QPSK Receiver When the FSK Receiver is being used the Bit Processor will not display any data The following information is a brief and non technical explanation of the fields QPSK FSK Receiver Data Source Status Display the state of the software demodulator These status messages may appear Not Configured Not Connected Connected Opened Started Retry Unknown The operating status is Started Carrier Frequency Displays the current frequency being tracked by the software demodulator This value will normally be zero however it may appear as plus or minus numbers based on your receiver hardware Carrier Track Displays the state of the internal carrier tracking software These status messages may appear Acquire Verify False Lock Tracking Unknown The operating status is Tracking Symbol Track Displays the state of the internal symbol tracking software These status messages may appear Acquire Verify False Lock Tracking Unknown The operating status is Tracking Front End Signal Indicates whether the software demodulator has detected a signal This field will display Present or Absent The operating status is Present Side Lobe Detected Indicates whether a side lobe has been detected The operating status is No 2011 Weather Mess
214. or the Delete button To add a category item first select the category Enter the category item description and product description then click Add To change a category item first select the category then the category item Make any changes and click on Change To delete a category item first select the category then the category item and press the keyboard delete key or click the Delete button Hint f you suffix the product name with the program will display a list of products instead of the last product received The default option of the quick list is similar to the Request Product option When the product name contains an it operates similar to the Request List option 9 8 Text to Speech The Message Client now has limited support for text to speech using Microsoft s text to speech processor on Windows XP and later operating systems The Sam voice that is installed with Microsoft XP is very poor Windows Vista s Anna voice is more natural Microsoft released two additional voices for Windows XP that are better than the default voice You can download them from this link http www text speech com voices Sp5TTIntXP msi After they are installed you will find Mike and Mary available in the speech control panel These two are much better than the default SAM voice The voice used by the Message Client is the default one selected in the speech control panel Using the speech control panel you can change the voice and set the
215. ord and new archive password When change it clicked this utility will search through your alarms and change the archive passwords on the alarms that match the old password 2011 Weather Message Software 72 Weather Message Server 3 3 1 Weather Message Server Overview Weather Message Server is the heart of the Weather Message applications When you start the Weather Message Server as an application it runs from the system tray When it starts it will automatically start the ingest program s that you selected in Weather Message Setup g Es Weather Message Server T F I File Help Processing Status File MISDCPMG TXT a TCP IP Office KWAL Connection Closed 127 0 0 1 Date z 120322 Email Local 09 11 2010 22 22 WMO SXMG40 Loaded Settings AWIPS SXMG40 Fax Coast Guard Surface Report Loaded Settings Send Client C Alarm 1 Type 0 Page Loaded Settings Image Send Completed TRKSEPUS0912100314 gif X10 Completed House A Units 3 Command Off Processing File Name Archive FTP RXFILES MISDCPMG TXT Sent Local Message c wxmesgnet wxdata archive Processed 1653 0 Message Clients 1 Print Alarm File 1 Map Clients 0 Processing The left pane contains the current processing information The last decoded message information is displayed This file currently being processed is displayed in the Processing File Name box The Processed box displays the number of alarms
216. ory Enter the server addresses to block exactly as they appear in the WxSvrus tt file This option should only be used in special situations 6 6 Setup 6 6 1 Serial Ingest Tab The Serial Ingest Tab is used to define the communication port backup options and other general operations 2011 Weather Message Software WxEmwin EMWIN Ingest 97 ic WxEmwin Setup Serial Ingest Software Demod Intemet Ingest Common Ingest Paths Enabled v Backup Options Comm Port f aT Ta Switch Back Time 10 nternet Backup Error Rate Greater 10 Save Cancel The Enabled option should be checked if you want the Serial Ingest engine to automatically start when WxEmwin is started Primary Receiver Select the Comm Port communications port or serial port for your satellite receiver along with the Baud Rate for that device For EMWIN satellite reception select a baud rate of 9600 N 8 1 Secondary Receiver Backup Options If you have a second satellite system or retransmission receiver enter the Comm Port and Baud Rate under the backup options Also if you want to use Internet Ingest as a backup check that option The Switch Back Time is used to specify the number of minutes that the program should check back to see if the main port is functioning when using a second serial port If the Switch Back Time is set to zero the program will not attempt to switch back to the main port The Error R
217. ot output statistics The Connect or Disconnect menu when present allows you to force the Internet Ingest engine to disconnect and connect to the next available Internet EMWIN server The Help menu allows you to see this manual and display information about the program Weather Message Help About Weather Message on the Web E Mail Program Support 63 Serial Ingest Tab The Serial Ingest tab when visible shows the option of the serial ingest engine Serial Ingest Software Demodulator Intemet Ingest Processing File Block TIDMHXNC TXT 1of2 Port Com4 Packet Length Total Blocks 1136 Bad Header Bad Blocks 0 Check Sum Error Percent 0 0 Block Count SOUS42 KMHX 070110 TIDMHX TIDAL INFORMATION So gt The Processing File Block and File Size fields show information about the received file A green or red led appears to the right of the Processing File field This led will normally appear green If any of the blocks received for this message are defective the led will change to red To monitor the received blocks click on the green or red led The following window will appear displaying the received blocks 2011 Weather Message Software 90 Weather Message Server Serial Blocks 8 Received Blocks The Port field displays the serial port that is receiving the data If you have a second receiver you can switch to the backup port by
218. ounds directory located in the WxMesgNet directory When this option is enabled the program will look for a wave file in the Sounds directory that is named like the product being received It will first look for the complete 6 character product identifier and play that file If the 6 character product identifier is not found it will look for a file with the first 3 characters of the product identifier and play that file If neither are found it will play the default wave file associated with this alarm Here are some examples of using the Product to Wave option The following files are stored in the Sounds directory TORBHM wav TOR wav With the Product to Wave enabled for Alarm Type 1 the program will look at each received product associated with Alarm Type 1 If 2011 Weather Message Software Message Client 133 the incoming message contains the product identifier TORBHM the program will play the file TORBHM wav If it receives TORHUN it will play the file TOR wav since it cannot locate a file labeled TORHUN wav The Read Short option will announce the received product using text to speech The software will attempt to create a short message describing the received product The short message will generally include the product type counties effected and the expiration time See Text to Speech i35 for more details The Read Text option will read the text of the received message using text to spee
219. peech processor When the text to speech processor starts the button will change to Cancel Reading Clicking Cancel Reading will stop the text to speech processor See Text to Speech h35 for more details The E Mail Message button opens your email application and inserts the message text in the body of the message The Print Message button prints the message text to your default printer The Close button closes this window Right clicking in the text window displays the following menu options that allow you to copy paste print and speak selected text 2011 Weather Message Software 128 Weather Message Server Undo Ctrl Z Cut Ctrl X Copy Ctrl C Paste Ctrl V Delete Del Print Ctrl P Speak Ctrl S 9 6 Request Product List The Request File List window allows you to request a list of products by identifier m WZ Request File List Ea Product Code RWRAL Product Expiration Date Time RWRAL 10 30 10 09 00 PM RWRAL 10 30 10 10 00 PM RWRALY 10 30 10 09 00 PM RWRALY 10 30 10 10 00 PM Close The product codes are composed of a 3 character weather product code and either a 2 character state or forecast office code See Weather Forecast Offices for a list of the forecast office codes See Text Product Abbreviations for a list of weather product codes For example a special weather statement for Birmingham Alabama is coded SPSBMX This code can be entered in the request fiel
220. pended overwritten or made unique if it already exists Selecting the Append option will cause the program to append the an exiting file with the archived data The Overwrite option will overwrite any existing message The No Overwrite option will cause the program to insert a sequential number to the message to make the file name unique Note The Append option works with FTP FTPS SFTP and Local FTP HTTP HTML Button 2011 Weather Message Software 66 Weather Message Server The FTP HTTP HTML 67 button will launch the FTP HTTP HTML Setup window It can be used to create html templates select upload protocols and set your server options Execute External Program The Exe Program field is used to start a third party program when an alarm occurs Enter the full path and program name for the third party program Weather Message can pass the file name of the message that caused the alarm To do this put one space after the program name and enter the characters 1 For example to start Notepad each time an alarm is triggered enter Notepad exe 1 in the Exe Program field Hint f the path to the executable contains a space you should enclose the path and program name in quotes For example c program files myprogram exe 1 Print Action To print a text or graphic product to a printer setup on the computer running Weather Message Server select one of these print options Select No for no printing S
221. poosa ALC123 Alaska F Any County ALC000 West Atlantic Oceai Autauga ALC001 E Northwest Atlantic C T Baldwin ALC003 Arkansas _ El Barbour ALC005 A 4 THI h 4 l III h Match Text RegEx Exclude Text RegEx F Alarm Active v The Product field contains the product identifier that you want to alarm The product identifier is assigned by the National Weather Service It is commonly referred to as an AWIPS identifier Weather product codes AWIPS identifiers are listed in Text Product Abbreviations You can also create user define products identifiers See User Defined Products 245 for more information Text message product codes are generally composed of a three character message type followed by a three character weather forecast office code There are some product identifiers are four or five characters in length For example the regional weather round up for Alabama is RWRAL If you do not know whether a product uses four five or six characters look up the weather forecast office s products using this Internet address http www wxmesg com asp recprod asp Hint The product code can be an actual product code or can contain question mark s or asterisk for wildcard operation Hint The special prefix WRN can be entered in the product code field to catch all of the standard warnings It includes SVR TOR and FFW This can be a time saver when establishing your alarms Three additiona
222. ption shuts down Wxlngest Note n order to view the Files Received Log the Log Received Files option must be enabled The Source menu allows you to toggle between the Internet servers and serial port connection The Register menu allows you to register s WxWW2000 This button does not appear if the software is registered Note If the software is not registered after 60 days it will stop functioning The Help menu allows you to see this manual and display information about the program Weather Message Help About Weather Message on the Web E Mail Program Support 2011 Weather Message Software 106 Weather Message Server 73 Setup 7 3 1 Settings Tab The Settings Tab is used to define the Internet settings user name password communications port and other general operations g WxWw2000 Setup Settings Common Ingest Paths Weather Wire URL pi weatherwire net ee an a Weather Wire Pot 15000 Internet 9 User Name wxmesg Password cem zj Baud Rate 9600 N 8 1 gt Name by AWIPS kd Global Ingest Paths V se c Select the Ingest Type Serial Port or Internet For Internet ingesting you must specify the Weather Wire URL Weather Wire Port User Name and Password The program will provide defaults for the URL and port You will need to enter the User Name and Password that you supplied to DynaCorp when you signed up for this service To register for a use
223. r each day in the WxMesgNet WxLogs directory The logs for each day are copied to this directory The log file name is appended with the day number These logs will be overwritten with the next month s logs After enabling this option you must restart all Weather Message programs Note Enabling the Daily Logs option disables the log file size option The Setup Shutdown Password if entered will cause the Weather Message Server WxEmwin and WxRadar programs to prompt the user for a password before stopping the respective program The Weather Message Server Setup program will also require this password before 2011 Weather Message Software 34 Weather Message Server allowing setup options to be changed Hint Entering a password will prevent the server and ingest programs from being accidentally shutdown The Server Name field is used to record a name for your Weather Message Server The server name is transmitted to each connected client The Auto Startup option allows you to specify whether Weather Message Server is automatically started when Windows starts The options are No Yes for the current user and Everyone for any user Note The options available for Auto Startup are based on your user permissions Administrator and Power users will have all of the options Other users may only have the Yes option The Client Pass Code field contains the password or pass code used to validate messages sent fro
224. r location Hint Inactive alarms are shown in the alarm grid with a yellow background Weather Message 50 connections supports 1000 alarms 500 e mail groups 500 fax groups and 500 pager groups Weather Message 100 and 250 connections support 5000 alarms 2500 e mail groups 2500 fax groups and 2500 pager groups Note Changing any of the alarms will cause the setup program to notify Weather Message Server that changes have occurred The Server will reload the current alarm file You will see the message Loaded Alarm Table on the Weather Message Server status screen If you change the TCP IP port you must stop and restart Weather Message Server 24 Support Setup 2 4 1 Fax Groups 2 4 1 1 Fax Settings The Fax Setup window allows you to set the faxing program to use along with your fax groups Fax Name From Weather Message Fax Telephone 256 329 0952 Enter your name in the Fax Name From field Enter your fax telephone number in the Fax Telephone field 2011 Weather Message Software Weather Message Server Setup 17 The Create Fax Header Trailer button allows you to create text that will be added to the beginning and end of selected and full fax messages See Message Header Trailer st for an example When you click on this button a screen will be displayed to enter the header and trailer If you only want a head trailer message for certain groups see the Fax Group 17 section Hint Clickin
225. r name and password go to this web address https oi weatherwire net For Serial Port ingesting select the appropriate Comm Port and Baud Rate The Name by AWIPS option when checked causes the program to name the received files using the AWIPS identifier found in the message followed by the originating station s state abbreviation When it is not checked the received files are named using the first 3 characters of the AWIPS identifier followed by the originating station s 3 character abbreviation followed by the originating station s state abbreviation The Global Ingest Paths option controls whether WxWw2000 uses global ingest paths Global ingest paths are shared between all of the ingest programs Unchecking this box will allow you to define ingest paths that are different from the global ingest paths 7 3 2 Common Tab The Common Tab is used to define options common or shared by all ingest programs 2011 Weather Message Software WxWw2000 Weather Wire Ingest 107 a WxWw2000 Setup Settings Common Ingest Paths Run in Background Log Received Files V Purge Ingest Directories JZ Log File Size 500000 The Run in Background check box allows you to specify whether you want the ingest programs to run in the background When this box is checked the ingest programs will not show in the system tray Once this option is enabled you will not see the ingest programs running In order
226. ram Options General Product Collectives FTP Ingest Protocols Purge Service SAHOURLY Store Hourly c wxmesgnet wxdata archive Observations in this Path The software currently supports the SAHOURLY collective Enter the directory path to store this file 2 4 5 4 FTP Ingest Tab The Option s FTP Ingest Tab allows you to configure FTP ingesting of EMWIN data 2011 Weather Message Software 36 Weather Message Server Program Options General Product Collectives FTP ingest Protocols Purge Service FTP Ingest on Startup FTP Ingest Interval None The FTP Ingest on Startup when checked will cause Weather Message to automatically request the three hour file when the program is first launched Hint This option pre loads the system with the last three hours of EMWIN data This can be used when Weather Message is not run continuously The FTP Ingest Interval allows you to specify whether you want the software to automatically request FTP files for ingesting You can select these options None for no FTP Ingesting 15 Minutes for FTP Ingesting every 15 minutes 1 Hour for FTP Ingesting every hour and 3 Hour for FTP Ingesting every 3 hours Note FTP Ingesting requires an Internet connection 2 4 5 5 Protocols Tab The Option s Protocol Tab allows you to configure the protocols used by Weather Message 2011 Weather Me
227. receiving Serial data Copyright 2011 Weather Message Software 62 Menu Options WxEmwin EMWIN Ingest Engine o J File Port Help Serial Ingest Software Demodulator Intemet Ingest The menu buttons on this screen perform these functions Note The Port menu option only appears when the Serial Ingest tab is selected The Demodulator menu option only appears when the Software Demodulator tab is selected The Connect menu option only appears when the Internet Ingest tab is selected The File menu allows you to setup this program view logfiles and exit the program 2011 Weather Message Software 88 Weather Message Server Setup Reset Stats View Main Logfile View Serial Log View Serial Files Received View Demodulator Log View Demodlulator Files Received View Demodulator Statistics View Internet Log View Internet Files Received Exit The Setup option opens the Setup window The View Main Logfile displays the main log file WeLog txt in notepad The View Serial Log displays the serial ingest log file WsLog txt in notepad The View Serial Files Received displays the received files log WsFiles txt in notepad The View Demodulator Log displays the serial ingest log file WdLog txt in notepad The View Demodulator Files Received displays the received files log WdFiles txt in notepad The View Demodulator Statistics displays the demodulator statistics log Wd
228. rmation on the Weather Message Website Discussion Group A Yahoo Discussion Group has also been established for users to exchange ideas and help each other You can join this group at http groups yahoo com group WxMesg join Installation Weather Message can be purchased on CD or downloaded from the website The CD will automatically load the installation program If you download the software from the Internet you will need the full installation executable It contains all of the files necessary for a full installation A Quick Start guide can be downloaded from the website to assist you with installation and initial setup Updates to the software can also be downloaded from the Internet The program updates only contain changes to the Weather Message programs It cannot be used for a full installation Weather Message can be uninstalled using the standard Windows Add Remove Programs facility The uninstaller will not delete files created while running Weather Message After uninstalling the software you can safely remove the WxMesgNet directory Weather Message features a full 30 day fully functional evaluation During the evaluation period all aspects of the software function normally At the end of the 30 day evaluation the software will display an message asking you to register the software Note f your installation will use multiple user login names profiles we recommend that you install Weather Message using the administrator
229. rograms will not show in the system tray Once this option is enabled you will not see the ingest programs running In order to see the ingest screen you will need to use the Show Ingest menu option in Weather Message Server Note Changing this option does not take effect until the next time the ingest programs are started The Log Received Files option causes the program to record the name of each weather file received The names are recorded in IBFiles txt The Purge Ingest Directories option when checked will cause the program to automatically purge the ingest directories after 24 hours The Log File Size field allows you to specify this size of your ingest log file IBLog txt The default is 50 000 bytes 2011 Weather Message Software 116 Weather Message Server 8 3 3 Filters Tab The Filters Tab is used to establish product filters for each NoaaPort channel g WxPort Setup Filter 1201 BMX Filter 1202 PGWE4SIPGWI47PGN098 Filter 1203 BMX Filter 1204 BMX Save Cancel The filter option can be used to filter each channel The filter is a regular expression If a filter is specified the program will used the AWIPS identifier or WMO identifier for comparison Only products that match the regular expression are stored for processing For more information on regular expressions visit Regular Expressions info You can test regular expressions at this RegExLib com 8 3 4
230. rver will disconnect clients that have not received data stored in the internal buffer within the specified time The minimum time value allowed is 30 seconds The X10 Port field allows you to specify the serial port that is connected to X10 interface hardware If X10 is not used select an unused port The X10 Device field is used to select the type of X10 interface device connected to your system The valid options are CM17 and CM11 The Firewall Proxy button allows you to configure Firewall and Proxy settings for your computer See Firewall Proxy 38 2011 Weather Message Software 38 Weather Message Server 2 4 5 5 1 Firewall Proxy The Firewall Proxy window allows you to configure firewall proxy information for your computer For a FTP firewall enter the domain name or TCP IP address of the firewall in the Host Name field Enter the Port number for the firewall If required enter a User Name and Password This should be a user name and password setup in the firewall Select the Type of firewall Valid entries are 1 Tunnel 2 Socks version 4 or 3 Socks version 5 User Name Password Type Fora HTTP firewall enter the domain name or TCP IP address of the firewall in the Host Name field 2011 Weather Message Software Weather Message Server Setup 39 Enter the Port number for the firewall If required enter a User Name and Password
231. s Displays the number of viterbi synchronization errors Viterbi Symbol Errors Displays the number of viterbi symbols errors Viterbi Average EsNo Displays the average energy per symbol to noise power spectral density 6 5 Internet Ingest Tab The Internet Ingest tab when visible shows the option of the Internet ingest engine 2011 Weather Message Software WxEmwin EMWIN Ingest 95 Serial Ingest Software Demodulator Intemet Ingest Processing File Block File Size WWAWNSUS TXT 1of2 2048 Server 140 90 128 132 Connect Time 0 01 26 Total Blocks 67 Bad Header 0 Bad Blocks 0 Check Sum 0 Error Percent 00 Block Count 1 WOUS20 KWNS 070137 a WWASPC SPC WW A 070140 DZ000 070240 A Internet Ingest uses information from EMWIN Byte Blaster Servers to maintain a list of public servers It attempts to connect to the first available server Should a server stop functioning the Internet Ingest engine will attempt to contact the next available server Every 10 minutes the internal list of servers are updated Internet Ingest uses TCP IP port 1000 or 2211 to communication with the servers If you have a firewall port 1000 and 2211 must be open for outbound connections The Processing File Block and File Size fields show information about the received file A green or red led appears to the right of the Processing File field This led will normally appear green If any of the blocks received for this me
232. s are located in the WxMesgNet directory File Name Description DebugEm txt This file contains the communciations between Weather Message and your SMTP email server If you encounter trouble with delivery of emails this file can be used to help diagnose the problem DebugFt txt This file contains entries for archive operations You will find different entries depending on the protocol used for archiving For HTTP and FTP it contains the communications between Weather Message and your server If you encounter trouble with archiving operations this file can be used to help diagnose the problem DebugFx txt This file contains the communications between Weather Message and your Fax server If you encounter trouble with faxing operations this file can be used to help diagnose the problem DebugPg txt This file contains entries for paging operations You will find different entries depending on the protocol used for paging For each protocol it contains the communications between Weather Message and the paging server If you encounter trouble with paging operations this file can be used to help diagnose the problem DebugX1 txt This file contains the communications between Weather Message and your X10 controller If you encounter trouble with X10 operation this file can be used to help diagnose the problem These debug files are limited in size to 50 000 bytes Once they reach this limit the original file is 2011 Weather Messa
233. s button will select all action items The Select All Significance button will select all significance items The Clear Selections button will reset all selections for both Primary and Hydrologic 2011 Weather Message Software 58 Weather Message Server Note You can select Phenomena that may not be included in the message that is being alarmed You need to verify that the message you are alarming can contain the Phenomena that you select Note When you use the Primary VTEC option the received message must contain the Primary VTEC items you select otherwise the message will not be alarmed Note The System Test product type is not issued by the National Weather Service Code L is reserved for local system testing Hydrologic VTEC fa VTEC Settings Primary VTEC Hydrologic VTEC Site Identifier Flood Severity W HBPA1 AL Tallapoosa River at Horseshoe Bend a None E E 00000 Areal Flood or Flash Flood Observation F AAKA AK Antler River near Antler River k a F ABLA AK Kobuk River at Ambler Major ACSA2 AK Susitna River at Alexander Creek Unknown F ALKA2 AK Alsek River at Walker Glacier ALLA AK Koyukuk River at Allakaket F APBA2 AK Anchor River at Anchor Point APTA AK _Anrhnr River at New Stedina Hwv Clear Selections Ces Enter Site Identifier s for the flood area Select Flood Severity ies from the drop down list Note Hydrologic VT
234. s radar images and place them in the local Wxlmages directory for viewing in the Message Client The Firewall Proxy button allows you to configure Firewall and Proxy settings for your computer See Firewall Proxy 38 2011 Weather Message Software 204 Weather Message Server The Map Background button allows you to set the color of the radar image background The Image Type list allows you to select an image format for the received image Radar images are received by default in GIF format You can select GIF JPG PNG BMP and TIF formats The Auto Startup option allows you to specify whether WxRadar is automatically started when Windows starts The options are No Yes for the current user and Everyone for any user Note The options available for Auto Startup are based on your user permissions Administrator and Power users will have all of the options Other users may only have the Yes option 14 5 1 1 Firewall Proxy The Firewall Proxy window allows you to configure firewall proxy information for your computer ic Firewall Proxy Settings Firewall Http Proxy Host Name Port 0 User Name Password Type 3 Socks5 Save Cancel For a HTTP firewall enter the domain name or TCP IP address of the firewall in the Host Name field Enter the Port number for the firewall If required enter a User Name and Password This should be a user name and password setup in the firew
235. s that start with AT or AT Bullet Paragraphs that start with Issued Time message issued in local AM PM format Issued24 Time message issued in local 24 hour format Expire Time message expires in local AM PM format Expire24 Time message expires in local 24 hour format ExpDay Day name when the message expires ExpDay Abr Abbreviated day name when the message expires ExpMonthName Month name when the message expires ExpMonthNameAbr Abbreviated month name when the message expires ExpDayNbr Day of month when the message expires TimeZone Time zone selected for the email or paging group Start Time event starts in local AM PM format Start24 Time event starts in local 24 hour format StartDay Day name when the event starts StartDay Abr Abbreviated day name when the event starts StartMonthName Month name when the event starts StartMonthNameAbr Abbreviated month name when the event starts StartDayNbr Day of month when the event starts 2011 Weather Message Software 46 Weather Message Server Today For Zone Forecasts insert the today line Tonight For Zone Forecasts insert the tonight line Forecast For Zone Forecasts insert the first forecast line DayOne For Hazardous Weather Outlook insert day one line Spotter For Hazardous Weather Outloo
236. s you to setup fax groups and fax associated settings e The E Mail Groups option allows you to setup email groups and fax associated settings e The Paging Groups option allows you to setup fax groups and fax associated settings e The Options option allows you to specify general program operation settings e The Printer option opens another menu with the following options e Default Printer Allows you to select the default printer used by Weather Message e Default Font Allows you to select the default font used to print text products e The Special Prefix option allows you to establish prefixes that can be used to alarm more than one product per alarm e The Product Specifications option allows you to establish and maintain short message formats by product e The User Products option allows you to create custom product identifiers e The WxWords option allows you to edit the word replacement file The Register menu allows you to register s Weather Message This button does not appear if the software is registered Note If the software is not registered after 30 days it will stop functioning The Help menu allows you to see this manual and display information about the program Weather Message Help About Weather Message on the Web E Mail Program Support 23 Main Window The main setup window allows you to configure the general program operation along with product alarms 2011 Weather Message Software Weather Message Server S
237. sage Software WxMap Client 161 Weather Message Map N Setup Ea Save Map Options Save Legend Options Server Settings Alarms Product Colors Other Colors Map Base Map Layers Product Color Description TSW Tsunami Waming TOW Tomado Waming EWW Extreme Wind W SVW Severe Thunders FFW Flash Flood Wam Waming Evacuation Imme The Product column contains a two letter VTEC phenomena followed by a one letter significance or the first three letters of the AWIPS identifier to be colored To add a new VTEC code or product identifier click the Add Product button see Product Setup he or scroll down to a blank cell and click in the cell If manually entering a product enter the product identifier and press enter Then right click in the color column to change the foreground text color or left click to change the background color Check the box in the Legend column to have this product displayed in the map legend The order of products in this list controls the priority Items at the top of the list have a higher priority than products at the bottom of the list To change the order select a product and use the up and down arrows to the right of the legend column or grid scroll bars To change or delete a product select the row and right click Select the Change or Delete option You can also manually change the items by selecting the row and t
238. speaking speed There are several commercial TTS text to speech engine providers Cepstral has good voices You can demo them at http www cepstral com demos Their voices are around 30 00 Nextup 2011 Weather Message Software 136 Weather Message Server has demos of the AT amp T voices at http Awww nextup com attnv html The AT amp T voices cost 35 00 2011 Weather Message Software 138 Weather Message Server 10 Image Viewer 10 1 Overview The Image Viewer allows you to view received weather graphics and locally processed radar images The Image Viewer is started by clicking on the Image Viewer menu option in Message Client and selecting one of the 10 viewers File SelectImage Browse Image Animate Image G08CIRUS 10 31 10 17 33 Each Image Viewer instance 1 to 10 remembers the last image you viewed along with the size of the viewer window and the last position of the scroll bars When you access that viewer again it will automatically display the last image viewed 10 2 Menu Options 2011 Weather Message Software Image Viewer 139 WxImage Viewer 1 Co E fe File SelectImage Browse Image Animate Help The File menu allows you to save the displayed image print the image setup this program retrieve previously viewed images and exit the program Save Image Print Full Image Print Displayed Image Setup
239. ssage Software 152 Weather Message Server Autauga AL Expires on 10 31 2010 at 03 11 PM Baldwin AL Expires on 10 31 2010 at 03 11 PM Barbour AL Expires on 10 31 2010 at 03 11 PM Bibb AL Expires on 10 31 2010 at 03 11 PM Blount AL Expires on 10 31 2010 at 03 11 PM Bullock AL Expires on 10 31 2010 at 03 11 PM Butler AL Expires on 10 31 2010 at 03 11 PM Calhoun AL Expires on 10 31 2010 at 03 11 PM Chambers AL Expires on 10 31 2010 at03 11 PM This window displays the county name and state along with the expiration date and time Click on a county name to read the weather text associated with the county 11 5 County Information Left clicking on a county displays a window showing the messages associated with the current alarms 2011 Weather Message Software WxMap Client 153 Go s Weather Message Text Van Buren MI WWUS43 KGRR 052105 WSWGRR URGENT WINTER WEATHER MESSAGE NATIONAL WEATHER SERVICE GRAND RAPIDS MI 405 PM EST SUN DEC 5 2010 MIZO56 060515 O CON KGRR LE W 0003 000000T0000Z 101206T2200Z OTTAWA INCLUDING THE CITY OF JENISON 405 PM EST SUN DEC 5 2010 Zoom to County ReadText E Mail Message Print Message Hint The text displayed is automatically copied to the windows clipboard The Zoom to County button will reposition the map to show the county associated with the text The button s text will chan
240. ssage Software Weather Message Server Setup 37 Program Options General Product Collectives FTP Ingest Protocols Purge Service FTP Use Passive Mode 7 Firewall Proxy FTP Timeout seconds 120 ae FTP Absolute Timeouts HTTP Timeout seconds 120 TCP Timeout seconds 0 X10 Port fis X10 Device cm gt Save Cancel The FTP Use Passive Mode option when checked will cause the ftp program to use the passive mode This option may be needed for firewalls that restrict incoming connections The FTP Timeout field allows you to specific the maximum amount of time the program will wait for responses from ftp servers The FTP Absolute Timeouts option when checked will cause the ftp program to use absolute timeouts An absolute timeout requires the ftp software to complete a ftp command within the timeout seconds specified When unchecked the ftp software will use normal timeouts Normal timeouts are based on communication activity between the ftp software and the ftp server The HTTP Timeout field allows you to specific the maximum amount of time the program will wait for responses from http servers The TCP Timeout field allows you to specific the maximum amount of time the program will wait for responses from clients connected to the Weather Message Server The default is 0 zero wait indefinitely Use caution when changing this value If a value is entered the Se
241. ssage are defective the led will change to red To monitor the received blocks click on the green or red led The following window will appear displaying the received blocks Serial Blocks z Received Blocks The Server field displays the address of the current Byte Blaster Server in use You can force the program to connect to the next available server by clicking on the Disconnect or Connect menu option The Total Blocks field shows the total number of blocks received for a one hour period the Bad Blocks field shows how many of the total blocks received were defective The bad blocks field is a total of the Packet Length Bad Header and Check Sum fields The Block Count field counts the number of messages that any blocks missing The Error Percent field shows the error percentage of the blocks received verses bad blocks You want this field as low as possible The background color of this field will change based on the quality of the received data If the background is white the received data has 10 or fewer errors If the background is yellow the received data has between 10 and 20 errors If the 2011 Weather Message Software 96 Weather Message Server background is red the received data has an error rate greater than 20 If the received message is text you will see the text associated with the packet being processed in the text box The ingest program will attempt to repair defective messag
242. st Refresh List Clear List The default option is to show all products in a single list If you only want to see text products in your list click the Text Only option To only want to see graphic products click the Graphic Only option The Wild Card option allows you filter the list using a wildcard Enter a wildcard expression in the menu text box then click on the Wild Card option The Split List option changes the standard product list into two lists The top list contains text products and the bottom list the graphic products 2011 Weather Message Software 126 Weather Message Server WZ Product List FWFSGX a SXMS50 RWRLA OSOTLH NOWYAK AFDMQT SFTJAN RWRMT RWREAX 7 IMGFNT12 IMGFNTO6 IMGFNTOO IMGSJUPR a MISWXMXZ MISWXMXY RAIMA RA AVY The Refresh List option sends a request to the server to refresh the text product received during the last two hours The graphic products are refreshed from the clients local cache The Clear List option clears the received products list Note When you shutdown Message Client the application will store the items in the product list The next time you start Message Client the product list will be populated with the items it contained the last time it was shutdown 9 5 Request Product The Request Product window allows you to request a product by identifier 2011 Weather Message Software Message Client 1
243. t Snow Avalanche Bulletin Speci Agri WX FCST Advisory Flying Farmer FCST Outlook Prelim Notice of Watch amp Cancellation MSG Storm Summary Supplementary Climatological Data ASOS Selected Cities Summary Special Dispersion Statement Severe Local Storm Watch and Watch Cancellation MSG SPC Watch Point Information Message State Forecast Discussion State Forecast Tabular State Forecast Surface Ship Report at Synoptic Time Satellite Interpretation Message Severe Local Storm Watch and Areal Outline Smoke Management Weather Forecast Special marine Warning Satellite Precipitation Estimates Storm Strike Probability Bulletin Special Weather Statement Shelter in Place Warning Surf Forecast SPC Tornado and Severe Thunderstorm Reports 2011 Weather Message Software 242 Weather Message Server 17 3 STD STO STP SUM SVR SVS SWO SWR SWS SYN TAF TAV TCA TCD TCE TCM TCP TCS TCU TCV TIB TID TMA TOE TOR TPT TSM TST TSU TVL TWD TWO TWS UVI VAA VOW WAR WAT WCN WCR WDA WEK WOU WRK WSW WVM WWA WWP ZFP AT SX AS WO WU WW AC AS AW NZ FT FP FK WT WT WT WT TX WT WT WE So SE WO WF SX SE NT WE FP AC AC AC AE FV WO WO WO WW AX CX FX WO NZ WW NW NW WW FP Satellite Tropical Disturbance Summary Road Condition Reports State Max Min Temperature and Precipitation Table Space Weather Message Summary Severe Thunderstorm Warning Sever
244. t f the Password for Setup Exit option has been enabled this program cannot be terminated with the X button without a password This feature insures that the user does not accidentally stop weather alerts Hint f the system tray icon is outlined with a red circle or a red led appears in the status 2011 Weather Message Software WxMap Client 147 barls the program is not communicating with the Weather Message Server Note f WxMap is stopped with the window minimized the next time it is started it will start minimized System Tray When WxMap is minimized you can restore the main screen by right clicking on the system tray icon E then select open Copyright 2011 Weather Message Software 11 2 Menu Options A Weather Message Map Co File Silence Map Views Savelmage Help Map Legend The menu buttons on this screen perform these functions The File menu allows you to setup this program show details view logfiles and exit the program Setup Printer h Map Landmarks Connect Refresh Map Print Exit The Setup option opens the Setup Window The Printer option selects the default printer and font size The Map Landmarks option opens the Landmarks Window The Connect option forces the application to attempt a connection to the server The Refresh Map option clears the map of any active alarms and sends a refresh request to Weather Message Server
245. t Weather Message software release Check the Weather Message website for updates to these lists State County Marine Zone Selection To select a specific state s or marine zone s select the state or marine zone from the state list To aid you with the state or marine zone abbreviations you can click on List States to view and select a state or marine zone Note When using state or county selections the weather text must contain the appropriate Universal Generic Code UGC lines If you select a specific state or county and the message does not contain a UGC line it will be not be alarmed The only exception is the SAW product Weather Message decodes the text in the SAW product so it can be alarmed by state Hint When you enter the product identifer for a product that does not contain a UGC line the state and county list box will have a light gray background color You can select any number of counties to be matched for the selected state s If no counties are selected the message will be alarmed if the state abbreviation is found in the message UGC lines Hint A warning message will be displayed if you attempt to enter state or county information for a message that does not normally contain UGC lines Hint Pressing F5 after selecting a state or county will resort the state or county list based on the selections Text Matching In addition to state and county preferences you can require a message to have a specified text
246. t the program The Silence menu option allows you to stop a sound that is playing The Text menu allows you to clear the main window and search for a word or phrase Clear Find Ctrl F The Request menu allows you to request a specific product or a list of products Request Product FS Request List F6 e See Request Product 126 e See Request Product Listh28 2011 Weather Message Software 122 Weather Message Server The Quick List menu allows you to quickly request predefined products Tornado Thunderstorm 4rea Forecast Discussion Zone Forecast Round Up Test 6 e See Quick Listl3 setup tab The Product List menu option opens the floating product list The Image Viewer menu allows you to select from 1 to 10 image viewers The menu shows the last image viewed with each viewer Viewer 1 RADBMXAL Viewer 2 RADMXXAL Viewer 3 SPC Day 1 Viewer 4 SPC Day 2 Viewer 5 Goes 3 IR Viewer 6 Viewer 7 Viewer 8 Viewer 9 Viewer 10 e See Image Viewerh3 Ctrl 1 Ctrl 2 Ctrl 3 Ctrl 4 Ctrl 5 Ctrl 6 Ctrl Ctrl 8 Ctrl 9 Ctrl 0 The Help menu allows you to see this manual and display information about the program Weather Message Help About E Mail Program Support Weather Message on the Web 2011 Weather Message Software Message Client 123 9 3 Main Window File Silence Text Request QuickList Product List
247. tains the name of the map layer The Line Size field specifies the size of the lines in the layer The Line Color button allows you to select the color for the layer lines The Transparency field allows you to control how the layer is painted over the county map layer One hundred 100 is a completely transparent background while zero 0 is no transparent background Hint The optional map layers must be located in the WxMesgNet Maps directory 11 8 8 Save Map Options Tab The Save Map Options Tab is used to set options for saving the map image to a local directory or website Weather Message Map Setup x Server Settings Alarms Product Colors Other Colors Map Base Map Layers Save Map Options Save Legend Options Save Map Image J Save To Local v when it changes B Server Address Map Save Interval 5 Port 21 Interval Always Active User Name Image Type gt Password Image Quality 100 Logo Position Bottom Left w Map Image Path c wxmesgnet wxdata archive The Save Map Image option will instruct the program to save an image of the map each time it changes This option can be used with the Map Save Interval to continuously save the map image when there are active watch warnings The Map Save Interval field sets the amount of time in minutes that the program will automatically save the map image when the Save Map Image option or Interval Always Active option
248. te by putting a ftp command in the Archive Path field on the alarm setup screen Here are the steps to ftp weather messages 1 Setup an alarm for the product to be sent to the website 2 Select the type of archive Selected or Full Full sends the complete weather message 3 On this alarm select the HTML Template option and enter your ftp server information To send a HTML file you will need to create a template file and place it in the WxMesgNet WxData Template directory In your html template enter the code MESSAGE where you want the weather text to be inserted You will change the HTML Template option to include the name of your template file Here is some additional information on creating a web page with Weather Message Server Side Includes The sample weather page on the Weather Message website was created by using server side includes SSI If your web server supports this capability it can help you make a nice page Feel free to use the html code on the WxMesg sample page http Awww wxmesg com weather currentweather shtm Basically SSI allows you to copy include text files into a web page Here is some of the html code used to show the state weather round up lt textarea rows 5 name SWRAL cols 74 gt lt include file swral gt lt textarea gt The lt include file Sswral gt statement actually copies the swral file into the web page when a user requests the page By including the file when t
249. the message must contain to be alarmed Entering zero for either value disables the check for that item Enter a Wind Speed ranging from 60 miles per hour to 100 miles per hour A value of zero disables the check for wind speed Enter a Hail Size ranging from 75 inches to 4 00 inches A value of zero disables the check for hail size Note f both values are entered the system will attempt to match at least one of the criteria 2011 Weather Message Software 60 Weather Message Server Note Caution should be used when enabling the Wind Speed and Hail Size option This option requires the weather text to contain a WIND HAIL information line Incorrect settings can cause your alarm to fall 2 6 3 Client Map X10 Tab The Client Map X10 tab is used to specify an alarm action for these categories g Edit Alarm 1 TORBMX List Products List Forecast Offices List States Aam Cient Map X10 Paging Email Fax Archive Html Exe Print Notes To Client Yi gt Alarm Type gt Alarm type is used Yes Aap er To Map Yes m J and or control printing X10 Settings House Code a lt Unit 7 UnitS Z Unit9 F Unit13 F c nd Unit 2 Unt6 Z Unit1O0 F Unit14 ommend ga Y Unit3 Unit 7 Unit11 Unit15 Duration 0 Unit4 Unt8 F Unit12 Unit 16 Message Client The To Client field is used to indicate whether you want this alarm sent to the Message
250. tware 252 Weather Message Server Note The first line of the Header should begin with lt html gt When a Header begins with lt html gt Weather Message will replace any HTML reserved characters found in the weather text with their appropriate HTML abbreviation This prevents html browsers from misinterpreting the weather text as html code 17 9 Sending Tweets using Twitter IL WILLSITM Weather Message supports sending tweets to dedicated Twitter service option in the paging setup This ability is possible by using the To setup Weather Message for Twitter you need to setup a Twitter service provider establish a Twitter paging group and associate this group with your alarms The following procedure outlines these steps Create a Twitter Service Provider Start Weather Message Server Setup Click Support Setup then Paging Groups Click Paging Services the Paging Services window will appear Click the New Button and fill out the screen as shown below g Paging Services Setup Service Ter o Service Type TAP SNPP PageGate WCTP HTTP Post HTTP Get TCP Twitter 9 Facebook User Name 20236215 HMfKg Password Maximum Page Size 140 Authorize Failure Retries 1 Retry Minutes 2 HTTP Post a Variables New Senice Dae Sme After selecting the Twitter Service Type click the Authorize button The following screen will appear 2011 Weather Message Software Supplement 253
251. ty Delete County Counties To Process ALC123 Most users will not enter any counties WxLoader will process all counties that are associated with the received message In some situations you may want to restrict the counties associated with a task In these situations you will entered the county designator s that you want processed The county designator is in the format XXYZZZ Where XxX is the two letter state abbreviation Y is C for a FIPS county code or Z for a zone county code and ZZZ is the three digit county code Enter a county identifier in the County Identifier field Click the Add County button to add this county to the list To delete a county highlight the county and click Delete County or press the Delete key 15 5 3 1 6 HTML Tab The HTML Tab allows you to enter HTML code to be included when processing this task Normally HTML code is used to encapsulate the message 2011 Weather Message Software 222 Weather Message Server File Separator Default Message Task Destination Products AWIPS Products VTEC Counties Html Use SMESSAGES to include weather text in your html code lt meta http equiv Content Type content text html charset windows 1252 gt lt title gt Sample Template File lt title gt lt p align center gt Test Weather Message lt p gt lt p align center gt 8nbsp lt p gt lt
252. ty Upton WFO Binghamton MCI SGF STL GWX JAN MEI BIL BLX BTM BYZ FCA GGW GTF HLN MSO RRM SHR TFX GID GRI OAX OFK OMA UEX FLO GSO HAT ILM MHX MYR RAH RAX BIS FAR FGF ISN MBX LBF LNX VTN ABQ CAO FDX EKO ELY LAS LKN LRX REV RNO VEF WMC ALB ALY AVP BDR BGM 2011 Weather Message Software Supplement NY NY NY NY NY NY NY NY NY NY OH OH OH OH OH OH OH OH OH OH OH OH OH OH OH OK OK OK OK OK OK OK OK OK OK OK OR OR OR OR OR OR OR OR OR OR OR OR OR OR OR PA PA PA PA PA PA WFO Buffalo WFO Albany WFO New York City Upton WFO New York City Upton WFO New York City Upton WFO New York City Upton WFO New York City Upton WFO New York City Upton WFO Buffalo WFO Binghamton WFO Cleveland WFO Cleveland WFO Cincinnati WFO Cincinnati WFO Cincinnati WFO Cleveland WFO Cincinnati Ohio RFC Wilmington WFO Cleveland WFO Cleveland Ohio RFC Wilmington Ohio RFC Wilmington Ohio RFC Wilmington WFO Cleveland WFO Cleveland WFO Oklahoma City WFO Tulsa Storm Prediction Center Norman WFO Oklahoma City WFO Oklahoma City WFO Tulsa WFO Tulsa Arkansas Red Basin RFC Tulsa WFO Tulsa Arkansas Red Basin RFC Tulsa NWS Storm Prediction Center Norman WFO Portland WFO Portland WFO Portland WFO Medford WFO Medford WFO Medford Astoria CG WFO Pendleton WFO Portland WFO Portland Northwest RF
253. ty for SWFOS Counties ifCounty County ifExpire until SAction SExpire MesgType F SHeadLine SBulletAT Bullet AIC hes len nd a T Wa E F A Slssued NWS has Issued a Tomado Waming for Jefferson County until 10 00 PM Slssued24S i S Expire SExpire24 SExpDayS z The Product field allows you to enter a product identifier This field is disabled for the Default product The description of the product entered is displayed to the right of the product field The format of the message is established by typing words and codes in the first text box To the 2011 Weather Message Software Weather Message Server Setup 45 right of the first text box you will see a list of codes that can be used in the message The text box at the bottom of the window shows a sample of the decoded format Hint Pressing the F2 function key will toggle between Issued and Expired Cancelled mode This will allow you to see how the message will be formated when it is expired cancelled The following is a list of the codes available and their meaning WFOS Weather Forecast Office from AWIPS ID 3 characters Action The word Issued or appropriate VTEC Action Amended The words Amended Corrected Delayed or nothing MesgType Description of the message HeadLine Paragraphs that start with and end with BulletAT Paragraph
254. ty selections After entering the information for your message click the Send button to send the message to Weather Message Server for processing The following screen will be displayed to confirm sending this message Are you sure you want to send this message Yes __No_ This message will disappear in 24 seconds 2011 Weather Message Software WxMesgText 177 The operator has 30 seconds to confirm the message If it is not confirmed the message will not be sent 12 5 Setup Enter topic text here 12 5 1 Settings Tab The Settings Tab is used to set operational information for the Message Creator 5 Setup Settings State Counties Server Expire Minutes 15 WFO KBMX Expert Mode Fi Use Local Time Agency Name National Weather Service States ALGA Comma Delimited Ingest Path c WxMesgnet wxdata ndiles The Expire Minutes field allows you to specify the default number of minutes for the message expiration These minutes are added to the current time to calculated the message expiration date time Enter your WFO designator in the WFO field The Expert Mode when checked puts the application in Expert 7 mode When it is unchecked the application operates in the Simple i75 mode Check the Use Local Time box to use local time When checked the program will automatically convert local time to universal time in the created message For simple messa
255. uences must match the text exactly In the example above the program will look for a line that begins with Discussion and is followed by any number of characters The character is used to indicate any number of characters It will stop capturing text from the message when a blank line is encountered Hint If you want to find text that is in the middle of a line use the character before and after the text that you what to find 2 4 9 User Products The User Product Definitions window is used to create user defined products and or override the information for existing products 2011 Weather Message Software 50 Weather Message Server user defined products layout 3 character product id 2 character wmo prefix 1 digit has ugc O no 1 yes 1 digit has vtec O no 1 yes bit mask for product specifics None 0 Has Both CZ 1 Has Lat Long 2 Has Time Mot Loc 4 Has Wind Hail 8 multiple characters for description evermmile The layout for the ProductUser dat file follows 3 character product id followed by a comma 2 character wmo prefix followed by a comma 1 digit has ugc O no l yes followed by a comma 1 b digit has vtec O no l yes followed by a comma it mask for product specifics followed by a comma None 0 Has Both CZ 1 Has Lat Long 2 Has Time Mot Loc 4 Has Wind Hail 8 product description example SVR WU 1 1 14 Severe Thunderstorm Warnin
256. uld be the time that you want paging emailing started in this example 07 00 The Time End field should be the time that you want paging emailing or faxing stopped in this example 22 00 Check all of the days of the week to receive that you want the message sent From 22 00 through 07 00 messages will not be paged or emailed To delay a message until a later time set the Time Restrict field to Hold Using the above example you want all messages received from 22 00 through 07 00 to be delayed until 07 00 The Time Begin field should be the time that you want paging emailing started in this example 07 00 The Time Begin time is also the time that any held messages would be sent The Time End field should be the time that you want paging emailing or faxing stopped in this example 22 00 From 22 00 through 07 00 messages will be held until 07 00 At 07 00 any held messages will be sent Any messages that arrive from 07 00 through 22 00 it will be paged emailed or faxed as soon as they arrive To delay a message and only send the last one received for a group set the Time Restrict field to Hold Last Using the above example you want all messages received from 22 00 through 07 00 to be delayed until 07 00 and only the last message received to be sent The Time Begin field should be the time that you want paging emailing started in this example 07 00 The Time Begin time is also the time that any held messages would be sent The Time End field should
257. up In order for WxLoader to have products to process the desired products must be alarmed in Weather Message Server This is accomplished by setting up an alarm in Weather Message and sending the product to the map client 2011 Weather Message Software WxLoader List Products List Forecast Offices 225 If you only want to alarm a product to WxLoader select the client identifier in the To Map box This is the same client identifier selected on the Server Tabliz8 2011 Weather Message Software 228 Weather Message Server 16 WxWire Weather Wire Utility 16 1 Overview WxWire is a support application that can be used to send messages to a serial port in weather wire format P w Weather Message Weather Wire o 6 Settings Ingest Path c WxMesgNet WxWire Comm Port 5s Baud Rate 19200 N 8 1 gt Add Header PiL Format Remove Return WMO Format Activity Processing Start Last File Sent Communications Port Open 0 The Ingest Path is the directory path where WxWire should pickup the files archived by Weather Message Server This path is initially empty You will need to decide on a common directory path that will be used by WxWire to receive files and Weather Message Server to store files The suggested path C Program Files WxMesgNet WxWire can be used for this purpose Set the Comm Port and Baud Rate as required by your external equipment or so
258. ups After the groups have been established select one or more of the groups from the list E mail alarms work just like the pager and have the same format options Upon receiving a valid alarm for an e mail group s Weather Message will send a message to the e mail group s based on the style you selected for the group Hint Graphic products can be alarm to an Email group The graphic is attached to the Email as an in line file Fax To fax a message you first have to establish your fax groups See the section on setting up fax groups After the groups have been established select one or more of the group s from the list Fax alarms work just like the pager and have the same format options Upon receiving a valid alarm for a fax group Weather Message will send a message to the fax group based on the style you selected for the group Time Resirict or Delaying Paging E Mail Fax The Time Restrict Time Begin Time End and Days of Week fields are used to limit or delay the times and days that a page e mail or fax can be sent for a particular alarm To restrict a message to a defined time period set the Time Restrict field to Yes Enter the begging time you want to send the page e mail or fax Enter the time to stop sending the page email or fax Select the days of the week that you want the page e mail or fax sent For example you may not want an alarm paged or emailed from 22 00 hours through 07 00 hours The Time Begin field sho
259. used for the Password for Setup Exit option The Auto Startup option allows you to specify whether WxMap is automatically started when Windows starts The options are No Yes for the current user and Everyone for any user Note The options available for Auto Startup are based on your user permissions Administrator and Power users will have all of the options Other users may only have the Yes option The Single Instance option when checked will only allow one copy of the Map to start The Show in Task Bar option when checked will move the program from the system tray to the task bar 11 8 3 Alarms Tab The Alarms Tab is used to set sounds colors print and popup options for 40 alarm types Weather Message Map Setup Save Map Options Save Legend Options Server Settings Alarms Product Colors Other Colors Map Base Map Layers Alarm Type B E Wave Option Play Wave Print Sound Duration Once Pop Up Map Map On Top The Weather Message Server Setup program allows you to associate an Alarm Type for each alarm that is sent to the Message Client This Alarm Type causes WxMap to play a wave file and pop up a minimized screen based on your settings Note The Message Client and WxMap use the same alarm type 2011 Weather Message Software 160 Weather Message Server WxMap supports up to 40 different alarm types To select a specific alarm type
260. weather message then both will appear The format of this short message format can be changed from the Support Setup menu Note It is possible for you to select counties that may be in different groups in the alarmed message Some weather products contain multiple groups that each contains counties In the event that you select multiple counties and they are in different groups you will get one message for each group that contains a matching county If you use the Any County code for example ALC000 the short message will contain a list of every county appearing in the weather message This can make the short message longer than what will fit on a pager s display Note t is not recommended to use the all county code when you are sending Selected or 2011 Weather Message Software Weather Message Server Setup 63 Full message text Doing so will result in an email page being generated for each UGC line in the weather message The file Product dat in the WxMesgNet directory contains the descriptions of all weather products This description appears in the short message and on the Message Client screen To change a product description copy the line from Product dat to ProductUser dat and make your modifications The Product dat file should not be modified It is replaced during software updates E Mail To Email a message you first have to establish your e mail groups See the section on setting up email gro
261. will be played and window popup options are setup in each Weather Message Client Leaving the Alarm Type blank will cause the Message Client to show the message in it s text box however if the screen is minimized it will not popup the window to display the message For types 1 through 20 the Message Client will popup it s window based on the client settings if the program is minimized See the Message Client and Map Client sections for additional information on Alarm Types X10 Settings The X10 Settings along with the associated X10 hardware can be used to activate electrical devices when an alarm occurs Select a House Code Command Duration and appropriate Units to activate The software supports the commands On Off All On All Off and Blink Hint The Blink option is implemented in software and works best with the CM1 1a controller The Duration field allows you to specify the number of minutes that a device should remain activated Enter 0 zero for it to remain active until turned off Hint With VTEC coded messages it is possible to turn on a device when a watch is issued and off when the watch expires Note You should set the X10 Port and X10 Device in Support Setup Options before entering alarms for X10 devices See the Weather Message website for additional X10 information and sources for X10 hardware 2 6 4 Paging Email Fax Tab The Paging Email Fax tab is used to specify an alarm action for these categories
262. will include a paragraph of text starting at the point where a user definable string is found See the Options tab to setup the user definable string The Lines x y code will include a fixed number of lines from a specified starting line in the message X is the starting line in the message and Y is the number of lines to include Note The Start Start24 vEventStart and vEventStart24 variables will contain the word now if the incoming message is coded with a blank event start time A blank event start time generally indicates that the event has already started Note The HVTEC variables are only populated when the alarmed message contains HVTEC encoding Note When the message contains the words TORNADO EMERGENCY the MesgType variable will contain the words Tornado Warning Tornado Emergency 2011 Weather Message Software 48 Weather Message Server 2 4 8 2 VTEC Message Tab The VTEC Tab allows you specify a format for the description associated with VTEC coded messages Product Specification Product DEFAULT Default Specifications Short Message VTEC Message Options SMesgType Variable Construction for Vtec Available Variables vPhenomena vSignificance vProduct Sv Actions vPhenomenaS vSignificance vEvent SvEventStart Tomado Waming SvEventStat24s The format of the MesgType code is established by typing words and codes in the first text box To
263. with Save Map Options les to save the map legend to a directory or website The Save Map Options must be enabled before the Save Legend Options will be honored The Save Legend option when checked will instruct the program to save the map legend The Legend Style option selects the legend style Option 1 draws solid legend markers Option 2 draws outlined legend markers for polygon products The Background Color selection specifies the color for the map legend background The Foreground Color selection specifies the color for the text printed in the map legend The Border Color selection specifies the color for the border drawn around the individual legend items and the map legend The Font button allows you to select different fonts and font sizes for the legend text The Map Image Path for a locally saved image is the local directory where the map image should be stored The application will automatically add the name MapLegend xxx when it saves the image For FTP and HTTP the Map Image Path should be the full path including the name of the map legend image The Minimum Width specifies the minimum width in pixels of the map legend The Maximum Width specifies the maximum width in pixels of the map legend A maximum width of 0 zero indicates no width limit The Minimum Height specifies the minimum height in pixels of the map legend The Maximum Height specifies the maximum height in pixels of the map legend A maximum h
264. wws 17 13 What is NOAAPort The National Oceanic and Atmospheric Administration s NOAAPORT broadcast system provides a one way broadcast of NOAA environmental data and information in near real time to NOAA and external users This broadcast service is implemented by communications utilizing C band The NOAAPORT data stream is located on Satellite AMC 4 transponder 13C It is broadcast using DBV formatting allowing inexpensive equipment to be used to demodulate the data This transponder presently has 4 logical channels NCEP NWSTG GOES NCEP NWSTG2 and Non GOES Imagery DCP Data The NCEP NWSTG GOES and NCEP NWSTG2 channels have a data rate of 1 536 Mbps while the Non GOES Imagery DCP Data channel has a data rate of 768 Kbps For more information on NOAAPort see NOAA s website at http Awww nws noaa gov noaaport html noaaport shtml Weather Message s WxPort ingest engine processes one of the 4 data streams for use by Weather Message and other software applications 2011 Weather Message Software 262 Weather Message Server 18 Software License LICENSE AGREEMENT LICENSE GRANT Danny Lloyd hereafter referred to as Author grants you a non exclusive license to use the software known as WxMesg or Weather Message hereafter referred to as Software DISCLAIMER OF WARRANTY Software is provided on an AS IS basis without warranty of any kind including without limitation the warranties of merchant
265. y until we find a blank line If wsData wiCopylndex Length 0 OrElse wsData wiCopylndex Substring 0 1 2011 Weather Message Software 196 Weather Message Server Then Exit For End If wsResults Append wsData wiCopylndex amp vbCrLf Next Exit For End If Next if we have data add a header If wsResults Length gt 0 Then wsResults Insert 0 wsData 0 amp voCrLf amp vbCrLf End If Return wsResults ToString Explaination of this script is beyond the scope of this manual If you want to write scripts we suggest that you review programming manuals written for Visual Basic Net 2005 2008 and 2010 2011 Weather Message Software 198 Weather Message Server 14 14 1 WxRadar Overview WxRadar is a support application that can be used to automatically retrieve radar images It can retrieve a specific radar site for viewing on the screen or schedule single or multiple radar sites for ingesting by Weather Message or other programs WxRadar requires Internet access If you plan to use WxRadar to retrieve images on a schedule it should be placed in the startup box in Windows This will insure that the program is automatically started each time the computer is booted Fat u WxRadar fo e File Schedule Retrieve Now Help State aL RadarSite KBMX BIRMINGHAM Alabaster gt Image Reflectivity 124 miles gt View Layers
266. ype buttons to see a list of active warnings or watches for that weather type You can also identify a county s name and current alarms by moving the mouse pointer over the county and pausing After a short pause the county name and state will appear along with a list of active alarms Left Click once on a county and a window will be displayed showing the actual weather text 152 that caused the alarm If more than one alarm is active you will see each message associated with the active alarms Note Received warnings and watches color the map based on the map legend priority The first item in the legend Tornado Warning has the highest priority To change the priority see the Setup section Note n order for weather products to be displayed on the map they must be setup in Weather Message server WxMap recognizes these products TOR FFW SVR WSW WOU and FFA Other products can be sent to WxMap and associated with a color see the setup section for more information To assist you with identifying counties that have been recently placed under a watch or warning the application will draw a highlighted line around the county This line will remain for 5 minutes When there are many counties under watches or warnings you will be able to easily see which 2011 Weather Message Software WxMap Client 151 ones were just placed under a watch or warning The application will also draw a dark blue line around counties
267. yping directly in the grid The Reset Colors button will delete all of the existing product colors and load default colors based on the NWS web based warning map 11 8 4 1 Product Setup The Product Setup window allows you to easily add or change a product 2011 Weather Message Software 162 Weather Message Server Significance Hazardous Seas Small Craft for Winds Small Craft for Hazardous Seas L Tl Inland Topica Stom Wind Select the Phenomena and Significance associated with the product Wamin Watch Advisory Statement Forecast Synopsis To change a background color left click on the Color button To change the text color right click on the Color button Check the Show in Legend box to display this product in the map legend 11 8 5 Other Colors Tab The Other Colors Tab is used to set miscellaneous colors Save Map Options Save Legend Options Default Product Color New Alarm Outline Color Expiring Alarm Outline Color Server Settings Aas Product Colors Other Colors Map Base Map Layers Products sent to WxMap with no associated color will be colored in the Default Product Color To change the background color of the default product left click on the Color button To change the text color right click on the Color button 2011 Weather Message Software WxMap Client 163 The
Download Pdf Manuals
Related Search
Related Contents
KTI Networks SFP-GLS-W5340-A network transceiver module "user manual" IT英語の語彙習得とプライミング効果に関する一考察 ―語 CnMemory 61120 external hard drive KND 9950 X KND 9952 X KND 9952 KND 9950 NX504E FX504E Copyright © All rights reserved.
Failed to retrieve file