Home

wind 11 - Auto

image

Contents

1. 11 2 E Solo do 2 uu u uuu uu aaa sssssssasssswswa qas panassasa 7 9 Instructions for Electricity Supply 7 9 Overseas Connection 7 10 Electronic Control System 9 35 Equipment Arrangement 9 27 9 34 G ET E E 7 4 Connection 7 8 Gas Safety Advice 7 8 Gas System 7 4 Internal Layout 9 26 L Levelling errena ua aaah sa ERE 5 1 Loading of Weight 3 1 Location of Facilities 9 29 M Marker Lights 4 1 MicrowAave 9 1 P Power Control System 7 12 13 1 R Refrigerator 9 17 Reversing Camera 9 25 Roof Rack Bars amp Ladder 3 1 S SAEI ere e E Sun aaa uysaasas 6 1 AIr B308 1 u u uuusnaasassasssshawaiua ES 6 1 Awnings AOE 6 1 Childr fii uuu 2 k SQ a EAE Qs 6 1 Fire Extinguishers 6 1 In c
2. trivet in high position Grilling Chops etc trivet in low position Slow Grilling trivet removed To turn off Turn the control knob anti clockwise to the vertical position Always make sure the control knob is in the off position when you have finished grilling Caution The grill must only be used with the door open A FITTED EQUIPMENT USING THE OVEN 1 Ensure gas cylinder supply is connected and turned on In the event of a gas smell turn off at gas cylinder mains and contact supplier To light Open door push in the control knob and turn anti clockwise to full rate gas mark 9 Hold a lighted match or taper to the burner and push the control knob in and hold The burner should ignite and the control knob should be held in for 10 15 seconds before release If the burner goes out repeat procedure holding control knob for slightly longer For models fitted with spark ignition the procedure is similar except that the burner can be ignited by depressing the ignition button which is located on the fascia Ignition must be carried out with the door open and if the burner has not lit within 15 seconds the control knob should be released and the oven left for at least 1 minute before a further attempt to ignite the burner Place the oven shelf in the required position and close the door Set control knob to approximately gas mark 5 and heat the oven door for about 30
3. Shellfish can take years to grow and fines can be imposed for not observing national regulations Do not pull up seaweed unnecessarily e Make your visit instructive not destructive Look at material don t remove it Take notes and photographs not specimens Observe bye laws and be considerate to others e National Trust property or Country Parks have regulations to protect the wildlife Follow these Fire Precautions You should also make yourself aware of the local fire regulations A PREPARING FOR THE ROAD YOUR MOTORHOME Weights explained Mass in Running Order MRO The weight of your motorhome as it leaves the factory as new with standard fixtures and fittings plus an allowance for driver and 90 fuel Maximum Technically Permissible Laden Mass MTPLM The maximum weight of the vehicle when fully laden for use on the road See specification section for actual figure User Payload The load margin payload this represents the difference between the Mass in Running Order MRO and the Maximum Technically Permissible Laden Mass MTPLM It shows the maximum weight which can be loaded into your motorhome covering items such as food crockery cutlery clothing bedding gas cylinders etc See Technical Specification for actual figure Please take care to ensure that you have allowed for the masses of all items you intend to carry in the motorhome e g passengers optiona
4. 4 4 2 System Levels Screen SYSTEM LEVELS Batteries Mater Tanke This screen shows from left to right e V Vehicle battery voltage gauge This gauge shows the voltage of the Vehicle battery in bar format with the precise reading shown at the top of the bar The actual bar changes colour according to the battery voltage Less than 10 9V red Poor 10 9V to 11 8V yellow Fair 11 9V to 14 4V green Good L Leisure battery voltage gauge This gauge shows the voltage of the Leisure battery in bar 7 24 A CONNECTION OF SERVICES aly format with the precise reading shown at the top of the bar The actual bar changes colour according to the battery voltage Less than 10 9V red Poor 10 9V to 11 8V yellow Fair 11 9V to 14 4V green Good F Fresh water level gauge This gauge shows the level of water in the Fresh water tank with the reading also shown at the top of the bar The actual bar changes colour according to the water level 25 red 50 yellow 75 and above green W Waste water level gauge This gauge shows the level of water in the Waste water tank with the reading also shown at the top of the bar The actual bar changes colour according to the water level 25 green 50 yellow 75 and above red 4 4 3 Active Battery Screen Gett Voites Capecitw X otive Battery Data LEISURE selected This screen is automatically selected when the battery select button is operat
5. Rotary switch is not at Operation Water pressure too high Rectification Switch the heater on If the temperature is below approximately 3 C the drain valve will open automatically If the heater is not in operation the drain valve can be reclosed only when the tempera ture is approximately 7 C or higher Use heating element for FrostControl Switch the heater on If the heater is not in operation the drain valve can be reclosed only when the temperature is approximately 7 C or higher Turn the drain valve s rotary switch to Operation then press the push button until it engages Check pump pressure max 2 8 bar If connected to a central water supply rural or urban connection a pressure reducer must be used which will prevent pressures higher than 2 8 bar entering the boiler If these measures do not remove the failure please contact the Truma Service Centre 9 16 A FITTED EQUIPMENT REFRIGERATOR B A Energy source selector switch Introduction Your vehicle is fitted with a Thetford DeLuxe absorption type refrigerator The control panel allows you to select your preferred energy source and cooling level Cold space Cooling fins are located on the inside of the refrigerator and the absorption system uses these to withdraw heat from the refrigerator Therefore never cover these fins with plastic or paper Air must be
6. Window etching of the chassis number is a cost effective deterrent Free crime prevention Advice about securing your motorhome protecting your valuables property marking either at home or whilst on site can be obtained from the Crime Prevention Officer through your local Police Station A CONNECTION OF SERVICES Please read and become familiar with operating instructions for equipment fitted in your motorhome Connection of services are dealt with under separate headings Water Electricity and Gas WATER SYSTEMS Fresh Waste Tanks The fresh and waste water tanks are located under the floor near the middle of the vehicle The drain taps for both tanks are clipped to the underside of the vehicle on the offside with the waste drain being nearer to the rear of the vehicle For capacities of both see the Technical Specification Section The fresh water tank is filled through the Whale socket on the side of the vehicle using the special hose supplied See next page for further details of the Watermaster System but note that the socket lid must be used to lock the plug securely into the socket All pipe work is manufactured to food grade material specification Breathers Both tanks are fitted with breathers which allow air displacement when filling When DUMP VALVE IF FITTED x PRESSURE SENSITIVE WATER PUMP DRAIN TAP Aly Ae filling the fresh water tank water may escape through th
7. e Coolants oil and water e 90 of automotive fuel Spare wheel e Crockery Washer fluid e Tools Driver at 75 kg 11st 12lb Fire extinguisher All other optional equipment whether on the base vehicle or part of the conversion is excluded from the mass in running order Mass of the User Payload The Mass of the User Payload is the difference between the MPTLM and the MRO It is the motor caravans carrying capacity for everything placed in or on the vehicle including the passengers Please note that a driver at 75kg 11st 12lb is included in the MRO Everything listed in italics below must be subtracted from the payload Mass of the Conventional Load The Conventional Load is the mass of the passengers carried and must be subtracted from the payload The EC standard person weighs 75kg 11st 12lb The user should adjust the figure according to the mass and number of passengers carried Motorhome Manufacturers designate passenger seats as being suitable for travelling and provide seat belts accordingly Multiplying the weight of the passengers by the number of passengers gives the Conventional Load Please note that a driver at 75kg 11st 12Ib is included in the MRO A TECHNICAL SPECIFICATION cf I Essential Habitation Equipment For the purpose of EN1646 2 the mass of the Essential Habitation Equipment includes the mass of the following e the LPG cylinders 90 full the freshwater
8. 5 Adjust dust cover over opening in container please note dust cover should not be secured to water container as air must be allowed to enter container to replace water being pumped out 6 Switch on 12 volt supply at main panel isolator switch 7 Water will flow from the open tap expelling any trapped air in a few seconds 8 Turn off tap the system is now ready for use When removing plug 1 Switch off 12 volt supply at main panel isolator switch 2 Whale socket Lift socket lid to release plug 3 Pull out plug from socket using hand grip 4 Shut lid Aly Ay The submersible pump can be run for quite long periods when in water but it is recommended that running periods should be restricted to a maximum of 15 minutes Do not run the pump without water Do not use the pump in water temperatures above 40 C 100 F It is best to stand the pump vertically Maintenance The pump is fitted with a strainer which should be inspected and cleaned at frequent intervals The pump is a completely sealed unit no maintenance is required Helpful Hints Before switching on place the pump in water and shake for a few seconds in a horizontal or inverted position to release trapped air This will ensure successful priming and should be repeated after refilling the water tank The plug for the Whale socket has a groove under the handgrip for clipping the water hose into when refilling the water container Fault
9. Engine running When the engine is started the system Message on screen on EC480 this power will be turned off will remain visible for 1 minute Step still out When the engine is started and the step Message on screen and rapid beeps has failed to retract automatically from the control panel The beeping will not stop until the fault is cleared Mains lead hook up When the engine is started and the Message on screen and repeated cable still connected mains cable is still plugged in and beeps from the control panel The plugged in switched on beeping will not stop until the fault is cleared 3 12 Event Timer Operation The event timer is designed to allow the motorhome user to turn the 12v power on or off in the same way as using the control panel power button without being in the vehicle This allows lights or other equipment to be turned on or off at a predetermined time Example to turn on one interior light at 11 00pm for 1 hour Ensure the clock is set to the correct time EC480 Scroll to the System Time Setting screen Follow the instructions in section 4 to set the ON time to 23 00 and the OFF time to 24 00 Set the Timer to ON A stopwatch symbol will appear in the header area to indicate the timer is set Turn all lights and 12v equipment off in the vehicle except the light that you want the event timer to automatically switch on Exit the vehicle At 11 00pm 23 00 the control panel will switch the 12v power on and there
10. If both the High Level LED and the Low Level LED are flashing the unit has detected both High and Low levels of carbon monoxide You should treat this as a High Level Alarm and act accordingly Low Battery Error Warning When your battery needs replacing the High LEvel LED will continue to flash once per minute and the detector will chirp once per T minute for up to 30 days Replace the battery immediately When there is no battery in place the red missing battery indicator will appear at the top of the unit to remind you to replace the battery If the unit continues to chirp even with a fresh battery then your detector is indicating that a fault has developed On discovering a fault please contact the FireAngel Technical Support Line between 10am 4pm Monday to Friday Tel 024 7623 6663 1 800 523171 in Eire E mail technicalsupport fireangel co uk Quick Reference Label A Quick Reference Label is located on the back of your detector and provides you with general instructions on the actions to take when your alarm sounds For full details read this owner s manual carefully What to do in the event of an alarm WARNING A loud alarm is a warning that high and potentially lethal levels of carbon monoxide are present Never ignire this alarm further exposure can be fatal Immediately check residents for symptoms of carbon monoxide poisoning and contact the proper authorities to resolve all CO problems
11. NEVER IGNORE A LOW LEVEL OR HIGH LEVEL ALARM Please carefully review these instructions to ensure that you know what actions to take in the event of both high and low level alarms What to do during a high level alarm e Open the doors and windows to ventilate Turn off the appliance where possible and stop using the appliance e Silence the alarm by pressing the Test Reset button e Evacuate the property leaving the doors and windows open Ring your gas or other fuel supplier on their emergency number keep the number in a prominent place e Do not re enter the property until the alarm has stopped Get medical help immediately for anyone A SAFETY amp SECURITY suffering the effects of carbon monoxide poisoning headache nausea and advise that carbon monoxide poisoning is suspected Do not use the appliance again until it has been checked by an expert In the case of gas appliances this must be a GAS SAFE registered installer What to do during a low level warning Open all doors and windows to ventilate Turn off all appliances that are potential sources of CO when possible and stop using the appliance These may include gas and wood burning fireplaces all gas appliances and barbecues Silence the alarm by pressing the Test Reset button Do not use the appliance again until it has been checked by a qualified service engineer In the case of gas appliances this must be a GAS SAFE r
12. gt 1 2 Full 75 gt 3 4 Full 100 Full A CONNECTION OF SERVICES 5 EC300 Control Panel continued Tank Heaters ON Battery Current 5 4 Amps Water Tank Fill Start 1 Min Clock Set 12 00 Alarm Set 12 00 Alarm OFF Shows the status of the Tank Heaters on off when fitted Press the select button l to switch between OFF and ON Current in Amps being drawn from or charged into the selected battery If a solar panel is fitted this display will include the current being provided by the solar panel Allows operation of the External pump for a period of one minute for filling the internal tank from the external tank Use the select button l to START or STOP Access to set the internal clock Press the select button l to select HOUR Use the up down A Y buttons to change Press the select button 8 to select MINUTE Use the up down A Y buttons to change Press the select button to exit Access to set the alarm clock Press the select button l to select hour Use the up down A Y buttons to change Press the select button to select MINUTE Use the up down A Y buttons to change Press the select button l to exit Shows the alarm clock status on off Press the select button 8 to switch between OFF or ON 1 29 The addition of a tank symbol in the top centre of the main EC325 display indicates that the tank heater are on Negati
13. h to the desired thermostat setting 1 5 the green LED k for operation is lit and simultaneously indicates the position of the selected room temperature The yellow LED p indicates the water s heat up phase The device automatically selects the required power setting in accordance with the temperature difference between the temperature selected on the control panel and the current room temperature When the room temperature selected on the control panel is reached the heater switches back to the smallest setting and heats the water to 60 C Once the water temperature is reached the heater switches off and the yellow LED p goes out The warm air fan can continue to run in order to cool the unit after run Heating without water temperature monitoring Select gas electrical or mixed operation using the power switch Illumination of the yellow LED g on the power selector switch indicates that the unit is operating with 230V Move rotary switch on control panel to operating position m Turn the rotary switch h to the desired thermostat setting 1 5 The green LED k for operation is lit and simultaneously indicates the position of the selected room temperature The yellow LED p water s heat up phase will be lit only when the water temperature is below 5 C The device automatically selects the requires power setting in accordance with the temperature difference between the B
14. output from PSU the site and Leisure Vehicle not connected RCD switched off Reset RCD as per 2 3D RCD not operating Check supply polarity if the RCD continues to fail contact your Dealer as there is probably an equipment or wiring fault MCB switched off Reset MCB by switching OFF down position then back ON up position if the MCB continues to fail contact your Dealer as there is propably an equipment or wiring fault No or deficient supply Contact site Warden for assistance from site Reverse Polarity Mains Supply reversed The reverse polarity light is designed to illuminate when the Live and light is Neutral supply has been reversed crossed over If the light illuminated illuminates there is a problem with the site supply or the cable connecting the supply to your vehicle The light is designed to work on UK electrical supplies where the neutral conductor is connected to earth at the sub station If you are using your vehicle outside the UK this light may illuminate when no fault exists In these cases consult the site warden for advice Generator being used The Reverse Polarity warning light is on when using my Generator This is a normal side effect when using some types of generator Instead of connecting the neutral conductor to earth some generators centre tap the earth connection making both neutral and live conductors 110V above earth This 110V difference causes the neon polarity indicator to illuminate In mo
15. s RCD MCB s operate in a similar way to traditional fuses and are provided to protect the wiring installation from overload or short circuit If an overload occurs the MCB will switch off the supply If this occurs you should investigate the cause of the fault before switching the MCB back on The following table shows the rating and circuit allocation for the three MCB s 10 Amps White Yellow for heater Extra 230v Sockets Space Heater 3 10 Amps Black Blue for water heater Fridge Water Heater 12v Charger internally connected A CONNECTION OF SERVICES aly 3 3 Battery Charger The EC500 system incorporates an intelligent three stage battery charger power converter During stage 1 the battery voltage is increased gradually while the current is limited to start the charging process and protect the battery At stage 2 the voltage rises to 14 4V to deliver the bulk charge to the battery When the battery is charged the voltage is decreased at stage 3 to 13 6V to deliver a float charge to maintain the battery in the fully charged state The charger can be left switched on continuously as required The battery charger power converter also provides power to the leisure equipment when the mains supply is connected This module supplies DC to the leisure equipment up to a maximum of 25 Amps 300 Watts therefore the available power is distributed between the leisure load and the battery with the leisure load taking pr
16. 12V socket Fuse 9 blown Find fault and replace fuse with outlet same rating 12V plug incorrectly Check plug connected wired 10 5 A CARE OF YOUR MOTORHOME 12V TROUBLESHOOTING CHART continued Symptom Cause Water Heater not Fuse 11 blown Find fault and replace fuse with operating cuts out Low battery charge Unit fault Cooker ignition not operating Fuse 11 blown Find fault and replace fuse with same rating Spark unit fault Refer to dealer Fault on cooker unit Refer to dealer Fridge gas ignition not Fuse 11 blown Find fault and replace fuse with operating same rating Ignition control switch fault Refer to dealer Fridge ignition switch flashes Fault on fridge unit Refer to dealer but gas does not ignite Ignition can be heard to be Faulty fridge ignition switch Refer to dealer sparking but no flashing on fridge switch 12V when engine is running same rating Fuse 7 in EM50 interface Find fault and replace fuse with box blown same rating Fault on fridge relay Refer to dealer Fault on fridge unit Refer to dealer 230V TROUBLESHOOTING CHART Symptom 230V system inoperative Check site supply RCD MCB switches tripped out Reset circuit breakers RCD MCB keeps tripping Fault on 230V supply Check supply including polarity out Faulty appliance Turn off all appliances reset circuit breakers turn on appliances until fault occurs Isolate faulty appliance Overload on current 10A maximum available do not
17. A PREPARING FOR THE ROAD I 14 by the roof rack should not exceed 75 kgs 165 Ibs with a maximum loading of 8 kg 17 Ibs per square foot Before Moving Off Whenever making a journey with your motorhome either setting off on holiday or returning home it is good practice to run through this simple checklist 1 10 Ti 12 13 Close and secure all cupboards and drawers and check any loose articles Do not store tins bottles etc in overhead lockers Close and secure all windows and roof lights Leave all curtains and blinds open to aid visibility Check that gas cylinders are securely fastened and turn off all gas appliances except those heating appliances designed to function while the vehicle is in motion Also ensure that the gas locker door is securely fastened Ensure that there is sufficient gas to meet your needs Switch off 230 volt supply at source disconnect mains cable from site supply before disconnecting from vehicle Beware of potential electric shock from wet cable Coil cable and store in a safe place Check your RCD s MCB s for operation Check and if necessary charge the conversion battery Check battery selection switch is in the OFF position Check that the battery is secure and that the battery box lid is fastened Ensure the fridge is on 12V operation and door lock is set Note the electrical relays will allow the fridge to be run on the vehicle batter
18. CONNECTION OF SERVICES aly EC500 POWER CONTROL SYSTEM 1 INTRODUCTION This section of the handbook will guide you through the operation of the electrical system Further technical details are contained in sections 3 to 6 or in the supporting technical manual available from www sargentltd co uk For the safe operation of all electrical equipment within your Leisure Vehicle it is important that you read and fully understand these instructions If you are unsure of any point please contact your dealer distributor for advice before use The system has a number of key components that you will need to be familiar with before attempting to use the system these are The EC500 series Power Supply Unit PSU a combined mains consumer unit and 12V controller The EC480 series Control Panel CP a remotely located user control panel used to turn circuits on and off and to display battery and water tank information e The PX 300 Battery Charger Power Supply A separate air cooled 300 Watt multi stage power converter unit that charges the batteries and provides 12V DC power The EM40 Interface Unit This small unit is located at floor level behind the drivers seat The unit houses fuses for the fridge vehicle battery radio and other systems It also provides connections for the optional tow bar harness 2 USING THE SYSTEM 2 1 EC500 Power Supply Unit Component Layout REVERSE SPACE POWER PUMP LIGHTS POLARITY HEATER BUTT
19. Finding 1 If the pump will not run Check contacts in plug and socket are clean and making contact Check wiring connections 2 Ifthe pump cycles on off with tap closed Check for air or water leaks in taps and piping Re adjust pressure switch 3 If pump motor runs steadily and will not stop Check that there is water in the container Battery voltage may be too low at or below 10 5 volts Adjust pressure switch and or recharge battery Check all connections in pipe work The Whale Tiptoe Pump can be fitted in line with the submersible pump and used as a manual back up Notes The socket lid must be used to lock the plug securely into the socket On the back of the filler socket on the inside of the vehicle is an adjusting screw for the pump solenoid This is set by the manufacturer and under no circumstances should it be tampered with by the owner A CONNECTION OF SERVICES WATER PRESSURE SWITCH Adjustment Your pressure switch is factory set and should not normally require adjustment In the event that your pump doesn t switch off when you close the taps or it pulses on and off when the taps are fully open follow these guidelines to readjust the setting Pressure switch adjustment may be required usually because the power supply voltage has varied from the previous setting Possible causes are a Battery drainage through normal use b Higher voltage supply when battery charger operating Pressu
20. LEDs will flash indicating that the horn is working and the battery is providing power to the unit This test for the horn battery and circuitry should be performed on a weekly basis WARNING Prolonged exposure to the horn in close proximmity will damage your hearing When there is no battery in place a red missing battery indicator will remind you to replace the battery Under normal operating conditions the battery should last one year The battery life in full alarm is 7 days The detector will not protect against the risk of CO poisoning when the battery has drained Caution Constant exposure to extreme high or low temperatures amy reduce battery life Maintaining Testing your detector Maintenance Your detector will alert you to potentially hazardous CO concentrations in your home when maintained properly To maintain your Fireangel detector in proper working order A SAFETY amp SECURITY and to ensure that your sensor will maintain its 5 year life it is recommended that you Test horn battery and circuitry at least once per week e Test sensor once per month e Keep the detector free of dust by gently vacuuming the case with a soft brush attachment once per month e Never use cleaning solutions on your detector Simply wipe with a slightly damp cloth Do not paint the detector Do not spray aerosols on or near the detector e Move the detector to a safe location and store in a plastic
21. Replacement of Spare Wheel Follow the procedure as described in the base vehicle handbook Caravan Door Step Your vehicle is fitted with an electrically operated side step In the event of the step being left extended a buzzer positioned under the dashboard will sound when the ignition is switched on and the step will self retract Cycle Rack In the event of a cycle rack being fitted the cycle rack when folded will increase the vehicle length by 400mm Your Auto Sleeper dealer will give further advice or assistance if required Whilst Driving Whilst the vehicle is being driven ensure that e Both the passenger and driver wear seat belts this is a legal requirement e Heavy loads are not stored in top cupboards or in areas from which they may become detached Please ensure that heavy items are stored low down and take care not to overload individual wheels the axles or the MTPLM Table s are stowed in the correct position and table legs secured in their retaining clips Furniture lids are lowered cupboards and flaps are closed and secured e The refrigerator door is closed and secured by its travelling catch A ON THE ROAD e The retractable rear step if fitted is folded away or if a separate step is supplied it is safely stowed in the vehicle e Roof ventilators are closed and locked in the down position The bathroom is not used whilst the vehicle is in motion Note Refers only
22. bag before painting wall papering using or performing any other activities that use materials that emit strong fumes WARNING Your alarm will not detect CO when it is stored in this way Remember to remove it from the bag and replace the detector when these activities are finished Technical information Detector specifications Model CO 808 Sensor Type Electrochemical Sensor Life 5 years Sensor range 10ppm 999ppm Alarm Sound Level 85dB at 3 metres 1Oft Recommended Batteries Duracell 9V Ultra Duracell MN1604 Energizer 522 Energizer 9V Ultra Gold Peak 1604A Battery Life Exceeds 1 year replaceable T SECURITY Chassis number Record the chassis number and the factory job number of your motorhome and keep them in a safe place at home The chassis number is a 17 digit number beginning with the letters VF3 and is found stamped on a plate visible through a window in the bottom left hand corner of the windscreen and also on a plate under the bonnet attached to the bonnet closing crossmember The factory job number is an alphanumeric code consisting of a letter followed by four numbers and is found on a label inside the glove box Motorhome Theft The theft of a motorhome can occur in the most unlikely circumstances from a motorway service area even from an owner s driveway Secure all windows and doors when your motorhome is unoccupied even if only for a short length of time Vehi
23. beep will be heard and the LCD display will flash To cancel the warning press the select l button The warning will not be repeated unless the water pump power switch is turned off and on again This is to ensure the warning does not become a nuisance Water level in the waste water tank 5 measurement levels If the water pump power switch is turned ON and the waste water level rises to 100 a warning beep will be heard and the LCD display will flash To cancel the warning press the select af button The warning will not be repeated unless the water pump power switch is turned off and on again This is to ensure the warning does not become a nuisance External temperature in degrees centigrade as measured by the external temperature probe 1 28 Aly The addition of a asterisk in the top left of the display indicates that the alarm is set The addition of a hash in the top right of the display indicates that the event timer is set The addition of the letters AC in the centre of the display indicates that the AC Mains supply is switched on Less than 10 9 Poor 10 9 to 11 8 Fair 11 9 to 14 4 Good Less than 10 9 Poor 10 9 11 8 Fair 11 9 to 14 4 Good ON mains supply on OFF mains supply off 0 lt 1 4 Full Nearly empty 25 gt 1 4 Full 50 gt 1 2 Full 75 gt 3 4 Full 100 Full 0 lt 1 4 Full Nearly empty 25 gt 1 4 Full 50
24. charging process supply the refrigerator and monitor other system circuits When fitted designated 12v sockets en route reading lights and en route heating will remain operational while the engine is running If you hear a warning buzzer when the engine is started please see the control panel display for details and also refer to section 3 11 3 System Technical Information The following section provides further technical information relating to the electrical system 3 1 System Configuration There are a number of dealer configurable features within the system Your dealer will discuss these options with you and make the necessary adjustments as required Should you wish to review the possible options settings further information can be sourced from www sargentitd co uk 3 2 Residual Current Device amp Miniature Circuit Breakers The Residual Current Device RCD is RCD TEST I BUTTON basically provided to protect the user from lethal electric shock The RCD will turn off trip if the current flowing in the live conductor does not fully return down the neutral O 1 conductor i e some current is passing through a C a person down to earth or through a faulty appliance To ensure the RCD is working correctly the test button should be operated each time the vehicle is connected to the mains supply see RESIDUAL MINATURE CURRENT CIRCUIT section 2 3 DEVICE BREAKERS The Miniature Circuit Breakers MCB
25. consumption by appliance use appliance Water heater does not No power Switch on isolator switch operate on 230V check MCB is on Overtemperature trip activated Reset thermal cut out refer to operating instructions Battery charger does not Charger switched off Switch on at control box operate check MCB is on Refrigerator does not operate Switch on refrigerator Check position of thermostat on 230V thermostat dial not on dial Element fault Refer to dealer Cooker Hotplate not heating Check MCB is on up 10 6 A CARE OF YOUR MOTORHOME 2x LPG TROUBLESHOOTING CHART Symptom Appliance will not light No gas Check isolation valve is open Appliance lights but goes out Flame supervision device FSD Refer to dealer immediately the FSD override is not functioning correctly is released Gas leak Turn off the gas at the cylinder and do not use the gas system until the problem has been rectified In the event of a leaking cylinder if possible position the cylinder in an open area away from any sources of ignition Contact the site warden and or the local gas supplier Yellow flame Lack of primary air please note Refer to dealer yellow tipping to the flame is normal Orange flame Particles of dust or dirt in the Reduce the amount of dust in mixing tube being carried air through the burner ports Burner ports partically blocked Refer to dealer Floating flame Lack of secondary air Check all vents are c
26. control Touch control Separate operating instructions are supplied with this equipment BARBECUE GAS POINT An external gas point is located on the nearside of the van behind a lift up flap The connector has a tap to enable the gas supply to be cut off prior to connection or disconnection of an external gas appliance B SPINFLO TRIPLEX COMBINATION OVEN BURNER OPERATION The burners on this appliance have fixed aeration and no adjustment is required The burners should flame as follows Propane The flames should burn quietly with a blue green colour with no sign of yellow tips Butane Normally on initial lighting a small amount of yellow tipping will occur and then slightly increases as the burner heats up IMPORTANT The right hand control knob operates both the Grill and Oven burners To ensure safe operation it is not possible to operate both burners at the same time Cautions The two in line hob burners will support pans from 10 to 20cm The single hob burner will support pans from 10 to 22cm Care should be taken not to overload the appliance as reduced performance may result e When using small pans the flames should not spread beyond the base of the pan as this will reduce the efficiency of the burner In the event of the burner flame being accidentally extinguished turn off the burner control and do not attempt to re ignite the burner for at least one minute Avoid old or mis sha
27. ideal for use on dark colours Black Top Hand Glaze This is ideal for use on stains vinyls body mouldings and provides a long lasting high gloss finish It is resistant to car wash and abrasive solvents and is easy to apply Economical in use only a small amount is needed to give a very fine finish Finishing Cloths These are very fine grade cloths woven and thus easily washable that are recommended by Farecia for use with their materials The above can be purchased from our Service Centre Willerly 01386 853511 A CARE OF YOUR MOTORHOME UPHOLSTERY MAINTENANCE Cleaning Upholstery should be brushed or vacuumed regularly Fabrics should be wiped every six to eight weeks with a lint free cloth and fabric cleaning fluid Velour materials may be dry cleaned Fabric Care Fabric snags caused by sharp objects such as toys nails etc should be trimmed off immediately Never attempt to pull them off since this could cause the snag to run Whenever possible avoid exposing the upholstery to direct sunlight which might eventually cause the colour to fade Fabrics with a velour type pile finish will develop crush marks in use this is unavoidable and does not affect the quality of the product in any way Stain Removal A proprietary dry cleaning fluid will remove most household stains However stubborn stains such as coffee wine or ice cream may need pre treatment with a mild soap and distilled water Sm
28. is now monitoring continously for CO and may be tested using a known source of CO Step 3 Light a cigarette or an incense stick using a match or lighter Extinguish the lighter or put out the match and place it into a dish of water Step 4 Turn the alarm on its side so that the vents nearest the Test Reset button on the side of the alarm are pointing down ward see diagram below Hold the burning cigarette or incense stick 15 20cm 6 8 in below the detector so that the smoke moves towards the holes in the sides of the detector An increase in the carbon monoxide level to more than 100ppm will cause the horn to sound momentarily and the High Level LED to illuminate continuously for a short time and then flash rapiidly Note it make take up to 2 minutes of exposure to the smoke for the carbon monoxide levels to reach over 100 ppm Step 5 After step 4 put out the incense stick or cigarette by placing it into a dish of water Ensure that all flames have been extinguished As the level of CO falls the High Level LED will stop flashing and will again continuously illuminate for a short time The unit will then return to sensor test mode with the High LEvel LED flashing twice every 5 seconds Step 6 After four minutes the detector will A SAFETY amp SECURITY return to normal monitoring mode and the High Level LED will flash once per minute Note The reason we recommend using cigarettes or incense st
29. kept away from the refrigerator For selection of gas type see the information plate inside your refrigerator For the pressure regulator model see the information plate inside your refrigerator The type of gas container and its located must be in compliance with the most recent regulators Ensure that the unit is installed in a location with good ventilation and make sure that the ventilation openings in the gas container storage location remain open e The changing of the gas container must be done outside in the open air and out of reach of any possible sources of ignition Open the valve of the gas bottle and the gas taps Set the thermostat B to the highest level the biggest dot B 3 Set the energy source selector switch A to 4 Ignite the gas flame Electrical ignition e Press the thermostat B and keep it depressed e Ignition takes place automatically You will hear a ticking noise If ignition was successful the noise will stop and the flame meter will turn green Release the thermostat e Ifthe flame goes out ignition will be repeated automatically Set the desired refrigeration level by means of the thermostat B The bigger the dot the colder the setting Important Note It is prohibited to use gas to power the refrigerator while you are driving If a road accident results in a fire there is danger of an explosion It is prohibited to use gas to power the refrigerator
30. knob clockwise as far as possible Always make sure the control knob is in the off position when you have finished using the hotplate burners B WARNINGS Glass lids may shatter when heated Turn off all burners before shutting the lid Spillage on the surface of the lid should be removed before opening the lid A FITTED EQUIPMENT USING THE GRILL WARNINGS The grill MUST only be used with the door open The heat deflector below the facia should be pulled out prior to lighting the grill Never adjust the heat deflector position without using hand protection i e oven gloves Important The grill pan supplied is multi functional for use in grill or oven The handle design allows removal or insertion whilst the pan is in use Always remove the handle when the pan is in use e The grill MUST only be used with the door open 1 Ensure gas cylinder supply is connected and turned on In the event of a gas smell turn off at gas cylinder mains and contact supplier 2 To light Open door push in the control knob and turn clockwise as far as possible Hold a lighted match or taper to the burner and push the control knob in and hold The burner should ignite and the control Knob should be held in for 10 15 seconds before release If the burner goes out repeat procedure holding control knob for slightly longer 3 For models fitted with spark ignition the procedure is similar except that t
31. likely causes are that present voltage is significantly lower when last adjusted or water container is empty CURE Re adjust switch or refill container Pump does not run at all If not due to blown fuse or faulty connections then most likely cause is excessive continuous running see a above CURE Replace pump and readjust switch Pump runs intermittently ON OFF ON OFF etc Seen as pulsing flow from tap or as inability to set constant water temperature water goes hot cold hot cold instead of constant warm Most likely cause is that present voltage is significantly higher than when last adjusted CURE Readjust pressure switch if problem persists add a Whale Surge Damper Pump runs very noisily but does not pump water Likely to occur after water container has been refilled Pump is air locked and is fighting to get air out and water in CURE Unplug from the socket allowing pump to flood and reconnect by plugging in again The correct sequence when refilling the container is to unplug put pump into container then reconnect Pump continues to run for up to 30 seconds after tap is turned off This is not a problem This is a characteristic of pressure switch systems caused by the dampening effect of the hot water heater or surge damper on the cold side THREE GOLDEN RULES 1 NEVER allow the pump to run dry 2 NEVER allow the pump to run continuously for more than 15 minutes 3 The pump assemb
32. locker with a cooker hood mounted underneath An adjacent overhead unit houses the microwave oven with its isolation switch mounted on the panel above Another overhead locker in the lounge area houses the storage racks for the crockery which is supplied separately in its own storage bag Bathroom The bathroom is located on the offside of the vehicle behind a sliding door and consists of an electric flush toilet with a swivel bowl a sliding wash basin and a shower area A chrome mixer tap shower head and hose located in the front corner may be used to fill the basin or as a shower when clipped to the shower post The sliding basin may be moved from one end of the bathroom to the other in order to maximise the available space A mirror is fitted to the front wall and there is a high level storage rack for washbags bottles etc There is a motorised extractor fan in the ceiling adjacent to an LED light a blown warm air duct fitted near the floor and a plastic mat prevents damage to the shower tray when not in use The toilet is fed through its own integral water supply and is serviced via a door on the offside of the vehicle Wardrobe The wardrobe is located on the offside of the vehicle rear of the bathroom and comprises an upper and lower area each with its own I al A FITTED EQUIPMENT ARRANGEMENT OF EQUIPMENT speq yung ven mo es JU A jOOY JU A JOO woojujeg ye9S Buljjanes L
33. manufacturer and is unaffected by the Auto Sleeper conversion Please check your driving licence to ensure you are allowed to drive a vehicle combination at this weight Maximum Braked Trailer Mass MBTM This is the maximum allowable weight of the trailer together with its load provided the trailer has a braking system which complies with the local Construction and Use Regulations The MBTM is given by the base vehicle manufacturer and is unaffected by the Auto Sleeper conversion MTPLM of the Axles The individual axles also have MTPLM s The sum of the two axle MTPLM s usually exceeds the overall vehicle MTPLM but this does not mean you can load each axle to its maximum because doing so would exceed the overall MTPLM of the whole vehicle AY TECHNICAL SPECIFICATION 2 WEIGHT AND DIMENSION DATA WEIGHT DATA TABLE WINDRUSH Vehicle Designation MTPLM Mass in Running Order Mass of the User Payload Designated Passenger Seats excluding driver Conventional Load 75kg per person Essential Habitation Equipment Personal Effects standard minimum figure Remainder for Personal Effects Options Accessories Optional air conditioning roof mounted Gross Train Mass MBTM Axle Weights Front in Running Order Rear in Running Order MTPLM Front MTPLM Rear All weights in kg 2 2 HDi 335 L2 H2 3500 2998 502 3 225 103 100 74 42 6000 2500 1599 1399 1850 2000 A TECHNICAL SPEC
34. maximum permissible hose length is 400mm longer hoses should not be used The hose length is the length of the flexible portion of the hose assembly Do not use external cylinders and or extension hoses Check piping for condition damage and correct support Carry out an overall leak test Appliances In general the checking of gas appliances can be divided into the following 1 Cleaning 2 Operation of controls 3 Correct flame structure 4 Flues 5 Flame failure device 6 Security Cleaning Where apprpriate remove cover s to gain access to heat exchanger Clean away any fluff or foreign matter Reassemble and test Clean flame viewing window A SERVICE DETAILS Controls e Check that all Knobs etc work smoothly and are secure on their spindles If gas taps require greasing to ease stiffness use only approved LPG grease Check that appliances can be brought into service using the normal controls Correct Flame Structure e Check that all pilot flames burn quietly and clearly Refrigerator With the refrigerator gas control turned to maximum the colour of the flame should be predominantly blue Instantaneous Water Heating The main burner flame should be of even height and blue in colour A flame burning yellow will allow sooting to occur Ovens The oven flame should burn quietly and be of even height mainly blue green in colour If the gas is propane the flame will normally develo
35. problems you may have regarding 230 12V LPG and water This should be used as a guide only and in the case of an electrical fault where a fuse has blown or an MCB tripped out the fault must be located before replacing the fuse If a fault is suspected with the LPG system consult a GAS SAFE registered technician If in doubt consult a qualified technician or your local Auto Sleeper dealer 12V TROUBLESHOOTING CHART Symptom Cause Habitation 12V does not Main 20A fuse blown Check Replace operate Battery Discharged Switch on control panel in off Switch to on position Vehicle ignition on Habitation battery not Main 20A fuse blown Check Replace charging Relay fault Contacts dirty loose on Clean and check for tightness battery terminals se Poor earthing Battery does not hold its Failed battery Check cells with hydrometer Current being drawn Check all appliances are off Battery discharges over a Poor battery cell condition Check cells with hydrometer short time with appliances Failed battery operating Battery not fully charged No power to one or more Circuit fuse blown Find fault and replace fuse with 12V appliances same rating Lights dull only one tube Low battery charge Check battery illuminating Faulty light unit tube Replace Check Water pump not operating Switch on panel off Switch it on Pressure switch on pump not Refer to dealer operating Fuse 4 blown Find fault and replace fuse with same rating No power on
36. replacements parts for appliances must conform to the manufacturer s specification and should be fitted by them or an authorised agent Your Auto Sleeper conforms to the CEN Standard EN1646 1 2004 for habitation requirements relating to Health and Safety To deal with your queries efficiently always quote your vehicle s production number which can be found in the glove compartment Please read and complete the warranty registration card supplied with your vehicle and return to the address below without delay Auto Sleepers Limited Orchard Works Willersey Nr Broadway Worcestershire WR12 7QF Tele 01386 853338 Fax 01386 858343 E mail aftersales auto sleepers co uk A WARRANTY AUTO SLEEPERS WARRANTY Warranty Registration The supplying dealer s representative and the purchaser must sign the declaration in the Warranty Service book to verify that the dealer has explained the warranty terms and conditions and that the purchaser understands them The dealer must then register the sale on the Auto Sleepers warranty system to activate the cover Warranty Terms and Conditions For full details of the warranty terms and conditions please refer to the Warranty Service handbook supplied with your Auto Sleeper A BODY CONSTRUCTION BODY CONSTRUCTION Peugeot Boxer L3 H2 window van Body paint colours Golden White Azzura Blue White Metallic Silver Volcano Red Clipper Blue Horiz
37. side walls Check for satisfactory attachment to body and roof Check for splits or holes particularly at fold lines Check that the canvas stows satisfactorily when roof is lowered A waterproofing check will be done at the request of the customer Solid Side Wall Check sides and end panels fold up and down correctly that they seal against each other where appropriate and that retaining mechanisms are satisfactory Check all hinges for security and freedom from strain Locking of Roof It is important to ensure that when the roof is in the travelling position it is safely and positively locked down Any locking retaining mechanism should be carefully examined 12 4 SECTION 8 GAS SYSTEMS Cylinders Regulators and Feed Hoses Establish that the cylinder and feed hose is compatible Since the introduction of BS EN1949 the gas pressures for Butane blue cylinders and propane red cylinders have been harmonised across Europe The gas system pressure is now 30mbar for both gases The gas regulator is now fitted as standard equipment by Auto Sleepers Your supplying dealer will need to supply you with the correct hose compatible with the cylinder to be fitted Check cylinder compartment vents and gas drop hole in floor are free from obstruction Check seals on internal doors Hose and Piping Check any flexible hose is of an approved type Check its condition and any evidence of cracking The
38. supplied with the vehicle Insulation All body panels except the front doors and engine bulkhead are insulated using fibreglass insulation material giving protection against extremities of hot and cold and at the same time minimising condensation 9 34 B Stainless Steel Sink and Drainer The stainless steel sink and drainer should only be cleaned with light detergent Under no circumstances should bleach be used since this will react adversely with the stainless steel and may cause small holes in the metal Immediately beneath the sink is a slide out cutlery drawer The chrome mixer tap has a small rubber end cap to eliminate water droplets marking the work surface whilst in transit Habitation Battery This is located beneath the lower bunk on the offside of the vehicle The battery is a 110AH 12V low maintenance leisure battery which should only require attention at the annual habitation service If a replacement habitation battery should be required then it is important that the replacement be of the same type and specification as that originally fitted WARNING Switch off all appliances and lamps before connecting or disconnecting the habitation battery A FITTED EQUIPMENT Electronic Control System Battery Charger A Sargent EC500 Power Control System is fitted to your vehicle It features a built in battery charger a digital control panel to provide intelligent control of the vehicle systems
39. tank 90 full the water heater system full the waste water tank empty e the toilet system flushing tank full e the toilet system holding tank empty All of these must be subtracted from the user payload Auto Sleepers include the low voltage 230V connection cable and the second battery in the mass in running order Options Personal Effects and Accessories When options personal effects and accessories are fitted or carried the mass must be subtracted from the user payload All optional equipment whether on the base vehicle or part of the conversion is excluded from the mass in running order Personal effects are any items of any description carried by the vehicle To determine accurately if a vehicle is exceeding one of its maximum technically permissible laden masses the vehicle with all of its load that is passengers contents luggage and external load should be weighed on a weighbridge You may wish to allocate the user payload to suit your own use For example to increase the available payload the water system may be emptied If the vehicle is not being used for camping the gas bottles can be left at home to increase the mass available for other items Gross Train Mass GTM If you are towing a trailer with your Auto Sleeper the Gross Train Weight is the maximum allowable weight of the towing vehicle the trailer and the mass of every item carried The GTM is given by the base vehicle
40. temperature selected on the control panel and the current room temperature Once the room temperature selected on the control panel has been reached the heater switches off The warm air fan continues to run at slow speed until the out going air temperature on the unit has fallen to 40 C or less If the boiler is filled the water will automatically be heated at the same time The water temperature is then dependent on the heating output being given off and the duration of heating required to reach the desired room temperature Heating with drained water system Select gas or electrical operation using the power selector switch Illumination of the yellow LED g on the power selector switch indicates that the unit is operating with 230V Move rotary switch on control panel to operating position m Turn the rotary switch h to the desired thermostat setting 1 5 The green LEd k for operation is lit and simultaneously indicates the position of the selected room temperature the yellow LED p will be lit only when the temperature of the unit is below 5 C Depending on the operating mode the unit will automatically select the required power level according to the temperature difference between the setting on the control panel and the current room temperature Once the room temperature selected on the control panel has been reached the heater switches off The warm air fan continues to run at slow speed until the o
41. the cells within the battery To prevent over discharge the EC500 system incorporates a battery protect circuit that warns the users and then disconnects the batteries when they fall below set values If the power is turned on and the leisure battery level falls below 9V a warning beep will be heard and information will be shown on the screen To cancel the warning press the select button If the power is turned on and the vehicle battery level falls below 10 9V a warning beep will be heard and information will be shown on the screen If no action is taken the system will switch over from the vehicle battery to the leisure battery To cancel the warning press the select button These warnings will not be repeated unless the power switch is turned off and on again This is to ensure the warning does not become a nuisance Batty Action after cutoff Notes Battery selection is This cut off level is designed to protect the changed from vehicle battery from over discharge The Vehicle battery to 10 9V level ensures there is sufficient power Vehicle 10 9V Leisure battery If in the battery to run the vehicle electronics the leisure battery is and start the vehicle This cut off only applies below 9V thena to power drawn from the battery by the leisure further warning will equipment it will not protect the battery if you occur see below leave vehicle circuits switched on such as the road lights This is an emergency cut off leve
42. the emptying spout is pointing downwards P A FITTED EQUIPMENT 1 A FITTED EQUIPMENT 9 23 A FITTED EQUIPMENT Storage First empty the central water system Press the flush button until the remaining water has been pumped away Empty the waste tank To allow the tank to dry do not place the cap back on the emptying spout of the waste tank Cleaning and maintenance The waste tank seal the automatic pressure release vent seal and the cap seal must be cleaned regularly When the toilet is being used frequently monthly cleaning is generally sufficient We advise cleaning the seals and valve blade with Thetford Plastic Cleaner Note Never use household cleaners bleach solvents or other powerful cleaning agents These may cause permanent damage to the seals and other toilet components Toilet e Squirt Thetford Plastic Cleaner in the toilet e Flush the bowl with water and wipe down the rest of the toilet with a damp cloth e Thoroughly clean the seals and valve blade using Thetford Seal Lubricant and wipe them over with a cloth or a piece of toilet paper Repeat the above operation if the seal and blade are dirty or if Opening and closing the blade is getting more difficult 9 24 B Note Never use Vaseline or any vegetable oil These may cause leakage If the toilet will not be used for a long period it is advisable to clean the seals and coat them lightly with Thetford Seal Lubr
43. the unit automatically selects electrical operation The gas burner is not enabled A FITTED EQUIPMENT OPERATING INSTRUCTIONS Caution Always observe the operating instructions and Important operating notes prior to starting The vehicle owner is responsible for the correct operation of the appliance Note Before using for the first time it is essential to flush the entire water supply through with clean warm water If the heater is not being used always drain the water contents if there is a risk of frost There can be no claims under guarantee for damage caused by frost Power selector switch 230V a Power selection rotary switch b Electric operation 230V 1800W c Electric operation 230V 900W d Gas operation e Mixed operation gas and electricity 900W f Mixed operation gas and electricity 1800W g Yellow LED on Electrical operation Winter mode only In summer mode the unit automatically selects electric operation at the pre selected electrical power of 900W or 1800W Note Switching on the electric heating elements as well does not increase the maximum heating power 9 9 Control panel h Rotary switch for room temperature 1 5 k green LED lit Operation green LED blinking after running is active in order to reduce the unit s temperature I Summer operation water temperature 40 C or 60 C m Winter operation heating without water temper
44. this feature can also be operated from the PSU Battery Select By default the leisure battery is selected as the power source if no mains supply is present or as the battery to be charged when the mains supply is available To change the selected battery press the vehicle battery select button The selected or Active battery is shown on the screen and on EC300 panels is also indicated by the adjacent LED LED off Leisure battery LED on vehicle battery Awning Light Button With the power on press the awning light button to turn the awning light on or off The adjacent LED will illuminate when the light is on Frost Protect Button When the frost protection option has been installed with the power on press the frost protect button to turn on the water tank heating system The adjacent LED will illuminate to show that the tank heating system is on Note This feature is NOT enabled at the time of manufacture A CONNECTION OF SERVICES aly Button Description Ceiling Light Button This switch turns the ceiling lights on and off Scroll Up Use this button to scroll through the various menu screen items or to make setting adjustments Select Use this button to select options items or to cancel alarms warnings Note The screen illumination backlight will turn off after a period of time Press the select button to reactive the illumination Scroll Down Use this button to scroll through the various manu screen items o
45. thought is necessary for the positioning of the extinguisher which should be near the door but not too close to the cooking equipment where sudden flames could make it unreachable In the kitchen area a fire blanket is a worthwhile precaution Unless permission has been granted barbecues should not be used When permission has been given consideration should be given to the annoyance that can be caused to other users of the site Open fires are not allowed A MOTORHOME CODE Awnings and Tents Awnings and tents should only be used when permission has been obtained When on grass and staying for more than a few days the ground sheet and or side flaps of awnings should be periodically raised in order to avoid damage to the ground Departure e Leave the pitch clean and tidy On leaving check out with the reception paying the required dues Wild camping Camping away from licensed sites without the permission of the landowner or his agent is not allowed in the United Kingdom When permission has been granted all aspects of this Code should be adhered to On no accounts should Litter be disposed of other than in receptacles provided Water be allowed to escape from the vehicle e Chemical toilets be emptied except into the disposal places agreed with the landowner e Washing or similar be hung outside the vehicle Parking Motorhomes should only be parked in approved places When using t
46. u E u NOE Door Key if applicable uL uuu uuu uuu 2 ua aspaassanasaapaspasaushanpapaqpakashaspushawsansqhashapapasauqnanaqa Fuel Filler if applicable l a aasssassnssnassassasssanassanaansasaananasnaskanassnasassanssssanaakan VV er ri E A A V EN A TE VATNE E ENEA A A Gas Compartment Key u uuu uuu usasqa qhakhashhuyassapashabhahayaqakangapashaspapawpushanquyaspaspakakkapapasapa Toilet Compaliimmaent Key u u u uuu EESE rA N aiat Alarm Code iM uuu u u a ua EAA ONNE T AA RAC etc Membership Number c c2cec5 cc csccouccdacesdestecesonenasdancecdabeaadecevacedacesiataasiucatncvacseatetaandrceenanec Radio SG CUI G0g6 u uuu uuu u uu EE Ar Aa EEE aE ACEN Supplying Dealer Contact Number nnnnannnnnnnnnnennnnnennnnnnnrnnnnnrennnrrnnnnrrnnnrrrsnnrrennrrennrrerenrrenenrreen A USEFUL INFORMATION AUTO SLEEPER DEALERS To find your nearest Auto Sleepers dealer please go to www auto sleepers co uk and click on Find a Dealer 11 2 A SERVICE DETAILS RECOMMENDED ANNUAL SERVICE CHECK FOR MOTOR CARAVAN BODIES AND CONVERSIONS It is recommended that the annual service is carried out by an approved motorhome service centre Introduction This entire section offers guidelines for the checking of a motorhome s habitation area and to ensure continual compliance with EN1646 1 It does not cover any part of the base vehicle although there may be minor overlapping such as
47. vehicle fuse and replace if necessary see fuses Select higher room temperature at the control panel Close window Charge battery Please contact the Truma Service Centre Check gas supply and open valves Inspect openings for contamination slush ice leaves etc and remove contamination if necessary Check individual outlet apertures Remove blockage from recirculated air intake Use regulator heating EisEx Use propane at temperatures below 10 C in particular butane is unsuitable for heating purposes After running will switch off after a few minutes Only at that time will a failure reset be possible switch off and then back on No failure After running will switch off after approximately 5 min utes The heater can be switched back on at any time during the after running phase in winter operation in summer operation only after two minutes Check 230 V operating voltage Check 230 V fuse and replace if necessary Reset overheating protection Allow heater to cool remove connection cover and press reset button 9 15 A FITTED EQUIPMENT WATER SUPPLY After the heater is switched off the drain valve opens FrostControl The drain valve FrostControl can no longer be closed Water flows intermittently from the FrostControl drain muff Temperature at drain valve less than approx 3 C Temperature at drain valve is below approximately 7 C
48. will be shown on the screen To cancel the warning press the select button If the water pump power is turned on and the waste water level rises to full 100 a warning beep will be heard and information will be shown on the screen To cancel the warning press the select button These warnings will not be repeated unless the water pump power switch is turned off and on again This is to ensure the warning does not become a nuisance 3 8 Frost Protection On vehicles fitted with water tank frost protection the EC480 control panel frost protect switch can be used to turn the feature on or off Note This feature is NOT enabled at the time of manufacture 3 9 Awning Light Operation The awning light is control by the control panel awning aux button The awning light is also linked to the remote door locking If the doors are locked or unlocked the light will illuminate for a short period of time This is a dealer configurable item 3 10 Electric Step Operation On vehicles fitted with an electric step this is operated by a button near the entry door Press and release the button to move the step in or out One press of the button will move the step out a further press will move the step in again If the engine is started the step will move in automatically after a short warning buzzer If this operation fails due to an obstacle or mechanical failure a buzzer will sound continuously to warn that the step is still in the out position
49. A qa3u N3339 1 WALSAS Loaonad Wows 0334 318VO AOYVHO AZL LINN IOYLNO9 aJY NMO YE MOV1E NMONS AYALLVE 3s80SI31 3 n18 NAAO38 AONVYO SLIHM SAV14u SNIHOLIAS WALSAS 31IHAV3OV 18 ama aldand A1dund a17 SY3d3JIS OLNY dO NOISSIWY3d SSJYdX3 AHL HLIM LNO dAlYYY 38 AINO NVO SNOILYY3L1Y YO SNOILIQQV ANY NI XIM JHL dO ALIX31dNO9 JHL OL ANG AINO 30NJY34JY HOS NOILVLNISJYdIY ALVWIXOUddV NV SI OILVWAHOS SIHL ALON GALLIS 41 daLS LOVYLSY OLNV qa3 N3338 S Y3zzng d3LS 3LIHW NMO HOLIMS d3LS YOLOW d3alS 131lO1 NOTI3A 319313 alsog 1ay00 TWNOIS AL ALIHWMOTIAZA Sq azi SONVYO ALIHM ALIHM MOTISA dod AONVYO ALIHM SLIHM NMONG MOT1SA 034 SONVYO SLIHM N3338S MAOTI3A J9 NVYO IALIHM Y3LY3H J NYYO ALIHM sim N3J49 MOTIIA J9 NYY0 ILIHM N3349 MOTIIA 11H97 11H97 AYLNA SONINMYV qau alv1s AONVYO ALIHM ve dNNd a1dund SI31VA FONVYO AL NMOUd MOV1E qalt 4 YyOLOVELXSA LINDYID ANIa ALV1S ONILHON LINDUID SNILHOM AONVHO AL YNVL FONVYEO ALIHM 31SVM JANWd 1OH1NOO AV1TdSIG NOILONN 4 ILAAN ALVIS INSIYO 000 C 1 32 AY TECHNICAL SPECIFICATION A TECHNICAL DATA Base Vehicle Data For all matters relating to the base vehicle and particularly tyre pressures refer to the base vehicle instruction book or if in doubt consult your local base vehicle commercial dealer Weights Dimensions and Capacities Before using your Auto Sleep
50. A CONTENTS section Introduction Warranty Body Construction 1 Miotormnome Code uuu uuu EE 2 Preparing for the Road 3 Jm Nne RO 1 u E ESNE E EEE eee eee eee 4 Arva ON ersen EEE E AEE saikestmedsaaussacs cee 5 oye AY ge 60 Lh A A E eee eee A ET 6 Connection of Services T Technical Specification 8 FS Gl EGUINO ceran E E sss ss 9 Care of your Motorhome 10 MSO TUI MONTE OMA u u e dee ieee cet ynetadnecweeee awa qakun a aaa qha 1 Service Section a 12 DOO ua perder cig TE E TE 13 Copyright 2011 Auto Sleepers Ltd All rights reserved No part of this document may be reproduced or transmitted in any form or by any means electronic or mechanical for any purpose without the express written permission of Auto Sleepers Ltd A INTRODUCTION Welcome Congratulations on your purchase of an Auto Sleeper motorhome We are confident it will give you many years of pleasure This handbook has been compiled to enable you to obtain the maximum pleasure from your vehicle It contains the appliance instructions along with advice on safety matters Please read this Handbook thoroughly so that you a
51. Adjacent to this are the controls for the water and space heaters Storage Storage is provided by the cupboards lockers and within the seat bases Additional storage is available in the overcab shelving area and various small pockets around the vehicle Heavy items must not be stored in any overhead locker nor in any storage area from which they could come free and cause injury to the occupants of the vehicle Ensure 9 28 B all cupboards are securely fastened before moving off i e that the push buttons are in the locked position Ensure any articles stowed below the cab seats will not come loose when the vehicle is being driven B A FITTED EQUIPMENT One in rear overhead locker Water pressure adjustment valve 12V DC sockets One on panel above side door One on nearside front bulkhead One on offside front bulkhead One in rear overhead locker One above each bunk 230V AC sockets One on outer side panel of nearside seat One on inner side panel of offside seat Two on panel above worktop One above each bunk 9 29 A FITTED EQUIPMENT SLEEPING ARRANGEMENTS Transverse double bed On the nearside remove the small infill cushion from behind the seat Release the catch on the inside near the front of the seat and pull the seat forward to its full extent allowing the cushions to fall into place On the offside undo the studs holding the large infill cushion in place Release the catch on the ins
52. Dirt and frost can prevent the step from operating properly In this case the moving parts should be cleaned or defrosted All points of movement are layered in maintenance free bearings Consult manufacturers literature for further maintenance details REVERSING CAMERA A wide angle colour reversing camera is fitted to your vehicle adjacent to the high mounted rear stop lamp The monitor is clipped over the original interior mirror and is automatically activated when reverse gear is selected Take care to avoid hard objects from scratching the LCD surface of the screen A FITTED EQUIPMENT INTERNAL LAYOUT General The Windrush is designed as a four berth model with a front lounge and twin bunks across the back of the vehicle Cab Seats Both the reclining cab seats have full forward and rearward movement by releasing the catch on the front of the seat and sliding it to the required position Accommodation Seating The Windrush features two forward facing rear seats with seat belts that easily convert into longitudinal seats when required Each seat has access to an underseat storage area Please note that Auto Sleepers advise against the retrofitting of additional seat belts Security Passengers are reminded that it is a legal requirement to wear the seat belts provided whilst the vehicle is in motion Table Three tables are supplied with the Windrush A large table with folding legs can be posit
53. GEMENT Ventilation Your vehicle is fitted with Remis roof lights in the lounge and kitchen areas and a smaller MPK in the rear above the top bunk When the vehicle is being driven the roof ventilators should be fully closed Wind noise may be reduced by closing the night blind WARNING The roof ventilators are designed to flow a certain amount of air even when fully closed Do not obstruct them your safety depends on them Remis Roof Light The Remis roof light incorporates a separate sliding flyscreen and night blind which can operate even if the ventilator iis open To open the ventilator release the catch and push upwards until one of the holding positions is reached When closing ensure that the release catch clicks into place against the handle MPK Roof Light The MPK roof light is fitted with a hinged cover which incorporates a roller blind anda fixed flyscreen Opening the hinged cover gives access to the adjustment handles for the five way opening facility Grasp the handles and push upwards to fully open or tilt in the required direction Air Conditioning If specified your vehicle will be fitted with a Dometic FreshLight air conditioning unit in the roof of the habitation area This will supply fresh and dehumidified air in summer and warm air in winter The temperature is set by the user and the system may be operated by a remote control For full operating details please read carefully the instructions
54. IFICATION cf I WEIGHT AND DIMENSION DATA continued DIMENSIONAL DATA MODEL Base Vehicle Manufacturer Base Vehicle Model Wheelbase METRIC DIMENSIONS Overall Length Overall Width mirrors extended Overall Width mirrors folded Overall Height Internal Height maximum Internal Height minimum Double Bed transverse Single Bed nearside Single Bed offside Bunk Beds Fresh Water Tank Capacity litres Waste Water Tank Capacity litres Gas Refillable Tank LPG All dimensions in mm WINDRUSH Peugeot 335 L2 H2 4035 5998 2508 2260 2700 1890 1860 1800 x 1470 n a n a 1800 x 600 69 40 20 Litres A FITTED EQUIPMENT IMPORTANT To maximise the usage of fitted equipment in your motorhome it is essential that any accompanying manufacturers literature is read fully All recommended maintenance and preparation procedures should be followed The information provided in this manual is only intended as a guide If in any doubt consult your manufacturer appointed dealer particularly before attempting to install extra equipment In the interests of safety replacement parts for an appliance shall conform to the appliance manufacturer s specifications and should be fitted by him or his authorised agent MICROWAVE Model Daewoo KOR6L1B Microwave oven Features Oven volume in Litres 20 Ten power steps Maximum Wattage 700 e Turntable Electronic time
55. LPG Re fuelling LPG re fuelling is simple and efficient carried out in much the same way as petrol and diesel with a hose and nozzle designed to lock onto the filling connector on the vehicle The refulling point is located behind a black plastic cover on the nearside of the vehicle behind the side door Once the connection is made the customer simply presses and holds down a button on the dispenser until they have put the required amount of fuel into the vehicle or until the tank is full LPG tanks are fitted with a valve that stops the flow once the tank has reached its maximum safe filling level Once the meter stops the customer simply disconnects the nozzle and returns it to the dispenser GAS SYSTEM SCHEMATIC DIAGRAM FOR IDENTIFICATION PURPOSES ONLY ee SPACE HEATER IF FITTED Z N WATER HEATER IF FITTED REFRIGERATOR RY 2 NNN ISOLATING TAPS A CONNECTION OF SERVICES Safety Note e When pulling up to the Autogas dispenser ensure the vehicle is parked with the filling connector located nearest to the dispensing pump Apply the handbrake and switch off the engine e No smoking naked flames or mobile phones are allowed on the Service Station forecourt The use of an adaptor is not recommended e Refilling of portable LPG cylinders is not allowed e All dispensing nozzles should be fitted with a nozzle shield Please report to staff if missing 1 Gas Guard
56. NG EQUIPMENT 12 8 j BE A SERVICE DETAILS lt CHECK ITEM Manual OK Remarks Advice to Customers SECTION 7 LIFT UP ROOFS _ ee ee LIFTING MECHANISM es E CANVAS SIDE WALLS SOLID SIDE WALLS LOCKING SECTION 8 GAS SYSTEM HOSE amp PIPING APPLIANCES SECTION 9 WATER SYSTEM FRESH WATER TANK WASTE WATER TANK FILTER PUMP SYSTEM CHECK WASTE WATER SYSTEM COUPLINGS amp FLUIDS SECTION 10 ELECTRICS 12 VOLT SYSTEM BATTERIES oo pwRING o d S FUSES FUSE HOLDERS J o PAPPLIANCES MAINS 230voLrsysTeM J SECTION 11 VENTILATION J booo o e j jj o O o DEALER SIGNED DATE 12 9 INDEX A Air Suspension 1 2 9 36 Annual Service Checks 12 1 PAVING eere 9 25 PVM seere er e EE EE EE EEES 6 1 B Barbecue point 9 1 Bed Assembly 9 32 C Cleaning General 10 1 Stainless Steel 10 2 Upholstery 10 2 Codes of Conduct 2 1 Cooker Hood 9 7 CyGle RaCK u unun RRE 4 1 D Data PROC OCG pecs uu nenn ances 11 1 Dealer Addresses
57. OF SERVICES aly The names and addresses of Approved Contractors in any locality there are over 10 500 in the UK can be obtained from NICEIC Warwick House Houghton Hall Park Houghton Regis Dunstable LU5 5ZX Telephone 0870 013 0382 Email enquiries niceic com The names and addresses of members of the Electrical Contractors Associations can be obtained direct from ECA Esca House Palace Court London W2 4HY Telephone 020 7313 4800 WARNING Current consumption in the motorhome must not exceed 16 amps or the pitch permitted maximum if this is less than 16 amps It is dangerous to attempt modifications and additions yourself Never allow modification of electrical systems and appliances except by qualified persons Lampholder plugs bayonet cap adaptors should not in any circumstances be used CAUTION Electrical heaters have the potential to draw 8 amps at 2kW It is therefore advisable to check the supply rating before switching on two loads items greater than the supply as this may cause an overload and the circuit breaker to trip OVERSEAS CONNECTION Note Connection to a mains voltage supply OVERSEAS requires particular attention Care must be taken when connecting supplies abroad since the supplies can be of REVERSE POLARITY The significance of REVERSE POLARITY is that when equipment is switched off it may not be electrically isolated The only certain way of making equipment safe is to
58. ON BUTTON BUTTON INDICATOR SWITCH SHUTDOWN BATTERY CHARGER WATER SELECT SWITCH HEATER il 12 VOLT DC FUSES RCDTEST RESIDUAL MINATURE UNDER FLAP BUTTON CURRENT CIRCUIT DEVICE BREAKERS RCD MCB s A CONNECTION OF SERVICES 2 2 Activating the System The EC500 system has a shutdown feature that should be used when the vehicle is in storage or is not being used for long periods of time This allows the leisure electronics to be turned off when not required to save battery power When in the off state the alarm and tracking system supplies are still active most other supplies are turned off Before using the system please ensure the system shutdown switch is in the on position button in 2 3 Connecting to the Mains 230V supply and Safety checks For your safety it is IMPORTANT that you follow these connections instructions each time your Leisure Vehicle is connected to a mains supply This section assumes that the system is complete and that a Leisure battery has been installed see 3 5 A Ensure suitability of the Mains Supply Your Leisure Vehicle should only be connected to an approved supply that meets the requirements of BS7671 or relevant harmonised standards In most cases the site warden will hold information regarding suitability of supply If using a generator you also need to comply with the requirements instructions supplied with the generator Pleas
59. On and Off times 12 00 till 12 00 Press the select button lt q to switch You can switch over to the Leisure battery immediately and cancel the beep by using the battery selector switch This WARNING display indicates that the Vehicle battery voltage is low 10 9 volts or less The panel will beep for one minute and then switch over to the Leisure Battery to prevent draining the Vehicle battery Vehicle Battery Dangerously Low This WARNING display indicates that the See section 3 11 for further Leisure battery voltage is low 6 volts or less details The panel will beep for one minute and then switch the power off to prevent damage to the leisure battery Leisure Battery Dangerously Low This WARNING display indicates that the system has been disabled because the vehicle engine is running EMC Electro Magnetic Compatability directive 89 336 EEC requires that electrical accessories within the vehicle are disconnected while the vehicle is in motion System disabled Engine started 7 30 Aly CONNECTION OF SERVICES 6 TECHNICAL DATA amp APPROVALS 6 1 Outline specification EC500PSU amp EC300 EC480 Control Panel INPUT 230V OUTPUT 230V INPUT 12V SOLAR INPUT OUTPUT 12V CHARGER Signal INPUT Data IN OUT IP rating Operating temperature ECS00PSU EC300 EC480 Control Panel 230 Volts 0 to 16 Amps RCD protected 3 x MCB outputs fo 10A Separate switched channels for wat
60. Select the energy source that you want by means of the energy source selector switch A The switch has four settings mains supply 230V e direct current DC 12V gas switched off B The thermostat controls the refrigerator temperature when the refrigerator is powered from the mains 230V or gas The refrigeration level is indicated by the dots the bigger the dot the colder the setting C The flame meter shows whether the frame is alight The flame is alight when the red needle of the meter moves into the green area A FITTED EQUIPMENT Electrical operation The refrigerator can be powered by electricity in two ways e DC 12V Set the energy source selector switch A to A the refrigerator will now be powered by the battery of your car or camper Important Always use the gas connection or mains voltage to start up the refrigerator for the first time and to cool it Powering from the battery of your vehicle is suitable only for maintaining the temperature of the refrigerator and its contents once it has been refrigerated e When powered by a vehicle battery 12V the refrigerator works without temperature control i e constant operation e Mains voltage 230V set the power selector switch A to lt e Set the temperature by means of the thermostat rotary switch B The bigger the dot the colder the setting Powering with gas WARNING Flammable material must be
61. T SHOULD BE SWITCHED OFF THE SUPPLY FLEXIBLE CABLE DISCONNECTED AND ANY COVER REPLACED ON THE SOCKET OUTLET AT THE SITE SUPPLY POINT BEFORE DISCONNECTING THE FLEXIBLE CABLE FROM THE MOTORHOME IT IS DANGEROUS TO LEAVE THE SUPPLY SOCKET OR SUPPLY FLEXIBLE CABLE LIVE Note Please check appliance manufacturers handbook to see if suitable for use with generator or charger A generator may only be connected via the mains socket If using a generator you also need to comply with the requirements instructions supplied with the generator Because motorhomes are sometimes left unused for long periods in the open it is strongly advised that the mains installation is inspected periodically to ensure that it is safe to use The IEE Wiring Regulations recommend that mains installations in motorhomes are re inspected every 3 years by a qualified person see list who should sign and issue a periodic inspection report The manufacturer recommends annual inspections Suitably qualified persons acceptable to the NCC to sign and issue inspection and completion certificates are e an approved contractor of the National Inspection Council for Electrical Installa tion Contracting or amember of the Electrical Contractors Association amember of the Electrical Contractors Association of Scotland a qualified person acting on behalf of the above in which event it should be stated for whom he is acting A CONNECTION
62. able to circulate freely through the refrigerator so that the heat can be extracted To limit frosting on the cooling fins Always cover liquid foods before placing them in the refrigerator Always let hot food cool before placing it in the refrigerator Do not keep refrigerator door open longer than necessary Freezer compartment The freezer compartment is not suitable for freezing foods although it will maintain the temperature of already frozen food Ice cubes are best made at night when the refrigerator has less work to do and has more reserves Automatic defrosting cycle All LCD refrigerators have an automatic defrosting cycle which is activated at the end of each 49 hours of operation The system switches itself off and on again when defrosted and resets the internal timer There is normally no need to manually defrost the refrigerator B Thermostat C Flame meter Door locking mechanism The refrigerator door has an automatic locking mechanism The door locks automatically when you press it firmly shut The mechanism keeps the door shut while driving OPERATION Before first use it is recommended that the inside of the refrigerator is cleaned and that it is allowed to operate for at least eight hours before putting any food into it Switching on Refer to page 9 16 for illustration of the control panel The refrigerator can be powered by the mains 230V direct current 12V or liquid gas
63. adjacent surfaces Check that surfaces adjacent to open flame cooking appliance have adequate protection Inspections e It is recommended that inspections are carried out by a qualified trained fitter trained to GAS SAFE standards SECTION 9 WATER SYSTEM Before operating the water system a visual check of the following items may show up an obvious leak source Fresh Water Tank Check condition fill tank and check for leaks Check the external filler and filler pipe to tank Check for satisfactory venting Check condition and presence of filler cap Waste Water Tank Check drain tap is clear and working Check condition and presence of drain hose The water tank will be drained flushed cleaned and charged with a measure of toilet fluid disinfectant at the prior request of the customer Pump Filter When applicable remove filter and replace Check the in line pump for security and condition Remove the submersible pump from tank check condition Check pump inlet and outlet are clear and not A SERVICE DETAILS obstructed Check delivery hose and electric cable are secure and satisfactory System Check Operate pump Check all piping for leaks Operate taps and shower If a hot water system is fitted it can be checked for leaks etc using cold water Note Aerated water from tap could be due to a leak on the suction side of the pump Waste Water System With water running through the dra
64. advice is followed bear in mind that the remote central locking will not function although it will still be possible to unlock and lock the doors manually using the key To maintain the vehicle battery in good condition it is recommended that it is fully charged prior to storage and then recharged every 3 months Windows Open all windows fully Check all window seals are intact and shut firmly Ensure locks and over centre catches are applied as appropriate Automotive Follow the advice laid down by the base vehicle manufacturer In particular Secure the vehicle using chocks Release the handbrake to prevent the brake linings from seizing on Increase the tyre pressure by approximately 2 bar above the standard pressure to prevent the tyres from becoming flat WARNING Do not exceed the maximum pressure noted on the sidewall of the tyre Alternatively jack up the vehicle to relieve the load on the tyres Cover the tyres to protect from sunlight as they will deteriorate rapidly in ultra violet light A light proof cover will help to prevent cracking of sidewalls and premature ageing e Check coolant for antifreeze protection correct as required Check windscreen and headlamp cleaning systems for antifreeze protection correct as required 10 4 A CARE OF YOUR MOTORHOME 2x TROUBLESHOOTING The following are a series of fault finding charts to which you should refer in the event of
65. alarm e Allow you to test the sensor by blowing smoke into the detector vents Testing the Horn Battery and Circuitry Test the horn battery and circuitry by pressing the Test Reset button to confirm that the detector is operating properly The horn A SAFETY amp SECURITY should sound as soon as the button is pressed and both the red LEDs will flash indicating that the horn is working and the battery is providing power to the unit This test for the horn battery and circuitry should be performed on a weekly basis vents test reset button Testing the Sensor CAUTION All sensor testing should only be performed by a responsible adult This test should only be performed once a month Excessive testing will cause the battery life to be shortened Note CO test kits may be used in order to avoid having to burn cigarettes incense sticks etc Please read all steps throughly before attempting to test your alarm N button Step 1 If alarm is wall mounted remove by unhooking unit from wall fixing screws Step 2 Place left thumb finger over the sounder vent Hold the Test Reset button down with right thumbfinger until the High Level LED stops flashing and only the Low Level LED flashes once per second this T should happen after around 5 seconds Upon releasing the Test Reset button the High Level LED will begin to flash twice in quick succession every 5 seconds This indicates that the detector
66. all marks in velour type fabrics can usually be removed by stroking along the pile using a small brush and warm water We strongly recommend that before commencing any treatment an inconspicuous piece of material is tested for colourfastness and shinkage If in doubt please contact a professional dry cleaning company Do not apply cleaning solvents to velour piping otherwise the flock will be removed Work Surfaces Laminated work surfaces are fitted to the tops of all furniture units Whilst these are hard wearing hot pans should not be placed directly on these surfaces since damage may result STAINLESS STEEL COMPONENTS External In the event of discolouration of the stainless steel ladder this should be removed with T Cut or any other mild abrasive and the surface protected with WD40 or a similar product Internal Do not clean stainless steel fittings i e splash plate and sinks with bleach since this reacts with the stainless steel and may lead to corrosion Furniture Furniture should be cleaned with a proprietary furniture polish periodically Any watermarks that may occur on the hardwood edging of the furniture units should be removed by use of fine grade wire wool and furniture wax Heavy stains may need to be sanded out and the edging re polished with a proprietary varnish Ronseal etc The high gloss finish is achieved by using wire wool and wax GAS INSTALLATION All gas vents and flue pip
67. and incorporates a smart charge feature This monitors both leisure and vehicle batteries and automatically adjusts and directs the charger power and solar power if a solar panel is installed to maintain the leisure and vehicle batteries at an optimal level For a full description of this unit including operating instructions and fault finding refer to the Connection of Services section Electrical General The 230V AC sockets fitted to your vehicle are suitable only for medium demand items such as televisions and hairdryers Safety overload protection is provided by the MCBs located under the cover on the front of the electrical control box An EM40 electrical interface adaptor box is located behind the driver s seat This contains fuses and relays for systems connected directly to the base vehicle electrical system and these are unlikely to require attention from the owner At least one 12 volt socket is provided in your vehicle For its position please refer to the Location of Key Facilities chart The mains hookup cable provided as standard with the vehicle is stored under one of the seats Retrofit Options Please consult either your local Auto Sleeper dealer or the Motorhome Service Centre Willersey for a comprehensive list of suitable options available for fitment to your vehicle 9 35 B A FITTED EQUIPMENT AIR SUSPENSION Your vehicle has been fitted with a supplementary air suspension system on t
68. and therefore requires your attention The electric step is also linked to the remote door locking If the doors are unlocked the step will move out if the doors are locked the step will move in This is a dealer configurable item and can be turned off if not required A CONNECTION OF SERVICES aly 3 11 System Warnings The system incorporates a number of warnings that are active at specific times These are summarised below and also covered by relevant sections of this manual Warning When type Fresh water level low With pump turned on and fresh water Message on screen and 1 minute level low less than 25 full audible beep Waste water level full With pump turned on and waste water Message on screen and 1 minute level full tank level 100 audible beep Vehicle battery voltage With control panel power on and vehicle Message on screen and 1 minute low battery selected as active battery and audible beep If no action taken after voltage level below 10 9V 1 minute then the system will switch to the leisure battery Leisure battery voltage With control panel power on and leisure Message on screen and 1 minute low battery selected as active battery and audible beep If no action taken after voltage level below 9V 1 minute then the system will switch the power of to prevent over discharge of the battery Alarm clock active When alarm has been turned on and Message on screen and 1 minute alarm time has been reached audible beep
69. ase of fire 6 1 Ventilation 6 1 Seat Swivel 4 2 Seating Arrangement 9 31 Site Regulations 5 1 Siting your Motorhome 5 1 Smoke Alarm 6 3 Step Electi uuu uuu ee een ence ere ee 9 25 T Technical Data a ssssssasaskanasasa 8 1 Television amp Aerial 9 25 Toilet Thetford C200 CS 9 21 Troubleshooting Chart 10 5 V Ventilation uuu un uu au aa aaa 6 1 7 7 W Warra ly uuuuu uuu u aanasiaseteassseatsinanelices 1 3 Water System 7 1 Weight amp Dimension Data 8 3 Weights a a 8 1 Wheel Changing 4 1 Whieel Spare isisisi ineine enseada iiiaae 4 1 Winterisation 10 3 Wiring Diagram 129 290V unn a uu unn 7 32 NOTES Designed and Printed by Preset Graphics Tel 01332 549278 HB1097MY 2011 Ref 21229
70. ature monitoring or with drained water system n Winter operation heating with water temperature monitoring o Rotary Off switch p Yellow LED lit Boiler heat up phase r Red LED lit red LED blinking Failure Note The LEDs are visible only when the unit is switched on Room thermostat The thermostat setting on the control panel 1 5 must be determined individually depending on the heating requirement and the type of vehicle For an average room temperature of about 23 C we recommend a thermostat setting of about 4 To measure the room temperature an external room temperature sensor is located in the vehicle The location of the sensor is determined individually by the vehicle manufactuer depending on the vehicle type consult the operation instructions for your vehicle for further details A FITTED EQUIPMENT FrostControl safety drain valve t Rotary switch position Operation u Push button position Closed w Push button position Drain x Drainage muff led outside through floor of vehicle FrostControl is a currentless safety drain valve When there is a danger of frost it automatically drains the contents of the boiler through a drainage muff If excessive pressure is present in the system pressure will be automatically intermittently equalised through the pressure relief valve Closing the drain valve Check if the rotary switch is set to Ope
71. both high and low level and for your safety should not be obstructed even partially Under each appliance is a fixed ventilation aperture of a size commensurate with the rating of the appliance itself It is either gauze covered or incorporates a fixed plastic vent This should be checked regularly to see that it has not become blocked High Level Ventilation provide additional ventilation such as opening High level ventilation is provided by the roof windows near grill cooker or oven vents The ventilation provided has been Roof mounted Flue installations carefully calculated and relates to the rating of the appliances in the vehicle Roof vents must not be covered with anything that may limit or affect the ventilation they provide All flue installations should be inspected once a year throughout their length for corrosion Flues should be replaced if any sign of perforation is found Ensure that the Maintenance replacement is of an approved type Under no circumstances should any fixed WARNING Never allow modification of ventilation aperture be blocked covered LPG systems and appliances except by either partially or fully or be modified in any qualified persons manner whatsoever They should be checked at least annually for damage or blockage Space amp Water heater gas drop Nee Travelling Seat Bathroom Up CL Roof Vent Roof Vent Bunk beds 15000mm2 7000mm Wardrobe i Trav
72. check that controls are in the off position when finished Do not allow children near the cooker when in use All outer surfaces will get hot when in use Do not allow fats or oils to build up in the oven trays or base Do not use abrasive cleaners or powders that will scratch the surfaces of the appliance Do not under any circumstances use the oven as a space heater Do not put heavy objects onto open grill and oven doors B Leaks If a smell of gas becomes apparent the supply should be turned off at the cylinder IMMEDIATELY Extinguish naked lights including cigarettes and pipes Do not operate electrical switches Open all doors and windows to disperse any gas escape Butane Propane gas is heavier than air any escaping gas will therefore collect at low level The strong unpleasant smell of gas will enable the general area of the leak to be detected Check that the gas is not escaping from an unlit appliance Never check for leaks with a naked flame leak investigation should be carried out using a leak detector spray B A FITTED EQUIPMENT Gasman Temperate TT dd 2 Hot Shortcrust pastry Bread scones 65 9 4 240 Very hot Quick browning Shelf Position Scones K asa 5 Wa Shelf Position N O A FITTED EQUIPMENT DOMETIC CK2000 AIR CIRCULATING COOKER HOOD With 50 m h capacity Circulair performs more efficiently than conventional cooker hoods while offering a low DC consum
73. ches If the leak is not obvious the vehicle should be evacuated and qualified personnel consulted b Avoid naked lights when re fuelling c LPG is more dense than air Consequently any vapour may flow along the ground and into drains sinking to the lowest level of the surroundings and be ignited at a considerable distance from the source of leakage In still air the vapour will disperse slowly MAINTENANCE The bulk tank installation requires no attention other than a check at the annual habitation service however it should be noted that the bulk tank itself must be pressure tested by an approved test house every 10 years A CONNECTION OF SERVICES aly VENTILATION Screens and or grilles should be kept clean and free from dust See diagram of upper lower ventilation All ventilation complies with BS EN 721 and vents should not be obstructed in any manner as this could lead to insufficient fresh air In this case the confined atmosphere becomes depleted of oxygen which leads to Low Level Ventilation the formation of the highly poisonous gas carbon monoxide Carbon Monoxide is odourless colourless and tasteless and will rapidly cause unconsciousness and death with little or no warning prior to collapse THERE IS NO DANGER WHEN ADEQUATE VENTILATION IS PROVIDED When you are cooking it is essential to General Fixed ventilation is a statutory requirement in all motorhomes These ventilation apertures are positioned at
74. cle location device Your vehicle has been fitted with a HAL 1000 satellite location device which has been installed in a concealed location This will automatically send a message to your mobile phone if the vehicle is moved and if it is being moved without your authority then it can be tracked wherever it may be taken If you discover or are informed by the Control Centre that your vehicle has been stolen you need to contact the police and obtain a crime reference number Then supply this number to the Control Centre detailed are on the HAL Locate registration card provided who will liaise directly with the police to locate and recover your vehicle Please read carefully the HAL 1000 user instructions supplied with your vehicle particularly with regard to the registration of your mobile phone s and understanding the various messages Note For effective operation of the system the leisure battery must be maintained ina A SAFETY amp SECURITY good state of charge at all times Please be aware that maintenance of the HAL Locate service is via an annual subscription payable after the first 2 years ownership from new If you sell your vehicle or change your contact details including mobile phone please contact the HAL Locate support team on 0844 3576269 with the details Additional security Consider fitting any device which might deter or prevent intrusion by thieves A wheel lock prevents removal of the wheel
75. d to 2 minutes Pressing the select button will reactivate the backlight If the large clock screen is selected see 4 4 4 below and the mains supply is on then the backlight will remain on continuously 4 2 Header Area The header area of the screen shows the following information At the left the external temperature in centigrade At the right the internal temperature in centigrade In the centre the current time 24 hour clock In addition to the above the following symbols when shown indicate Mains supply connected and charger switched on A Alarm clock set OS Event timer set 1 23 A CONNECTION OF SERVICES aly 4 3 Footer Area Susten TINE settings Press lt to edit The footer area of the screen shows details of the current information screen and may also show additional information during specific operations 4 4 Information Area The main information area can display a variety of system information screens These have been designed to present the information in a clear and concise form while retaining technical detail for the more advanced users The selected screen can be changed by using the down or up buttons and work on a continuous loop basis The selected screen may be changed automatically by the system depending on the action being performed 4 4 1 Splash Screen 18 8 EC480 Control Panel CP101 P5001 This screen shows the header and footer detail along with the Auto Sleepers logo
76. e note that some electronic generators may not be compatible with your leisure system Further generator operational information is contained elsewhere in this manual Switch the PSU internal Power Converter OFF Locate the green Charger power switch on the PSU and ensure the switch is in the off position button out before connection to the mains supply Connect the Hook up Lead Firstly connect the supplied hook up lead orange cable with blue connectors to the Leisure Vehicle and then connect to the mains supply Check Residual Current Device operation Locate the RCD within the PSU and ensure the RCD is switched on lever in up position Press the Test Aly Ae button and confirm that the RCD turns off lever in down position Switch the RCD back to the on position lever in up position If the test button failed to operate the RCD see section 3 14 Check Miniature Circuit Breakers Locate the MCB s within the PSU adjacent to the RCD and ensure they are all in the on up position If any MCB s fail to latch in the on position see section 3 14 Turn the PSU ON Locate the black Shutdown button and ensure it is in the on position press button to change button in on button out off Locate the green Charger switch on the PSU and turn to the on position press button to change button in on button out off The charger switch will illuminate when turned on Check co
77. eas and preferably not under or near trees Consider also how you will move your motorhome when leaving the site For example on sloping ground in wet conditions pitch facing downhill Levelling It is important to site your motorhome level to ensure correct operation of the refrigeration cooker etc by using purpose made ramps and NOT bricks or such items Awning Light The exterior awning light is controlled by a switch located on the side of the nearside rear seat accessed when the side door is opened A SAFETY amp SECURITY SAFETY Important Your attention is drawn to the notice affixed in the motorhome advising on fire prevention ventilation and what to do in case of fire Children Do not leave children alone in the motorhome in any event keep potentially dangerous items out of reach as at home e g matches drugs etc WARNING When upper bunks are used by children especially under six years of age care shall be taken against the risk of them falling out Fire Extinguishers It is recommended that a 1 kg 2Ib minimum capacity dry powder fire extinguisher be located by the main exit door at all times A pan fire should not have an extinguisher aimed at it but be smothered with a fire blanket which should be stored by the cooker In case of fire 1 Get everyone out of the motorhome as quickly as possible using whichever exit is the quickest including windows Do not stop to collect any
78. ed The battery symbol bottom left will contain a L if the leisure battery is selected and a V if the vehicle battery is selected From left to right e Lor V Active battery voltage gauge This gauge shows the voltage of the Active battery the currently selected battery in bar format with the precise reading shown at the top of the bar The actual bar changes colour according to the battery voltage Less than 10 9V red Poor 10 9V to 11 8V yellow Fair 11 9V to 14 4V green Good e AH Leisure battery calculated capacity percentage of Amp Hours When the leisure battery is active selected this gauge will be shown The gauge shows the predicted charge capacity of the battery As the battery is charged this gauge will increase as the battery is discharged used this gauge will reduce This can provide a useful indication of usable battery power SUN Solar panel ammeter This gauge shows the current in Amps that is being provided by the solar panel when fitted The system will decide which battery to direct the solar power to This is based on system logic see section 3 6 and is indicated by a L or V in the centre of the sun logo e A Battery ammeter This gauge shows the current in Amps going into or out of the Active selected battery Positive current indicates charging of the battery and is indicated by a green bar Negative current indicated discharging of the battery and is indicat
79. ed The residual heat in the heat exchanger will heat the water up to 70 C Fuses 12V The fuse is in the electronics beneath the connection cover Replace the unit s fuse only with an identical fuse Device fuse 10A slow T 10A Fuses 230V CAUTION The fuse and the power supply lines must only be replaced by an expert WARNING The unit must be disconnected from the mains all poles before opening the electronic housing lid The fuse in the power electronics 16 beneath the electronic housing lid This fine fuse must always be replaced with a fuse of the same type 10A slow interrupting capacity H A FITTED EQUIPMENT Overheating protection 230V The 230V heating facility has a mechanical overheating switch If the 12V power supply is interrupted during operation or during the after run period for example the temperatures within the unit could activate the overheating protection To reset the overheating protection allow heater to cool remove connection cover and press red reset button B A FITTED EQUIPMENT TROUBLESHOOTING LIST After switching on winter and summer operation none of the LEDs are lit The green LED comes on when the unit is switched on by means of the ZUCB time switch but the heater does not operate The green LED comes on when the unit is switched on by means of the ZUCB time switch but the heater does not operate After the heater is switc
80. ed by a yellow bar low discharge or red bar high discharge 7 25 A CONNECTION OF SERVICES aly 4 4 4 Large Clock Screen 2136 This screen shows a large display clock in 24 hour format 4 4 5 Time and Timer Event Settings Screen 9 0 O0 01 19 0 Tine on tiss Timer off Sime Tiner OO OO 00 OO OFF Syston TIME settings Prosa lt to edit This screen is used to adjust any of the system times and to set the alarm clock or event timer Press the select button to move through each setting Press the up down buttons to adjust the setting Set Clock Time First adjust the hour using the up down buttons then press select again to move to minutes and adjust with the up down buttons e Set Alarm Time Press the select button to move to alarm hour setting Press the up down buttons to adjust the setting then press select again to move to minutes and adjust with the up down buttons Press select again to move to alarm on off Press the up down buttons to adjust the setting If the alarm is turned on a bell symbol will be shown in the header area Set Timer event on Time Press the select button to move to timer hour setting Press the up down buttons to adjust the setting then press select again to move to minutes and adjust with the up down buttons Set Timer event off Time Press the select button to move to timer hour setting Press the up down buttons to adjust the setting then press se
81. egistered installer Get medical help immediately for anyone suffering the effects of carbon monoxide poisoning headache nausea and advise that carbon monoxide poisoning is suspected Battery installation replacement a If the detector is wall mounted then unhook it from the mounting screws Remove the battery cover located on the back of the detector Replace the battery with an approved 9 volt alkaline battery making sure the battery terminals align properly with the T detector terminals and push the battery into place Use of a battery other than the battery recommended by FireAngel Ltd can have a detrimental effect on the detector operation Replace the battery cover and return the detector to the origiinal position d When the battery is first inserted the detector will shortly emit a single beep and the LEDs will flash to indicate that the battery is properly connected e Your advanced FireAngel detector does not require a proplonged power up period If you have followed all of the above steps correctly your unit will begin monitoring for CO in 20 minutes After the 20 minute warm up period the High Level LED will flash once per minute to indicate that the detector is powered up and is monitoring for CO f Test the horn battery and circuitry by pressing the Test reset button to confirm that the detector is operating properly The horn should sound as soon as the button is pressed and the
82. elling Seat Fridge Cooker amp g i I Fridge gas drop ee Cooker gas drop Low level vent 2000mm2 Isolation taps gas drop Windrush Ventilation Diagram A CONNECTION OF SERVICES Connection Before turning on the gas supply ensure that all gas operated equipment in the motorhome is turned off All gas equipment is supplied through a central Gas Manifold System which has individual isolation taps for each appliance denoted by a symbol see below WARNINGS 1 Interior outlet sockets must only be used with original appliances supplied by manufacturer 2 No appliance must be used outside when connected to an internal socket 3 No additional appliance must be used inside the motorhome Never use portable cooking or heating equipment other than electric heaters that are not of the radiant type as they are a fire and asphyxiation hazard GAS ISOLATION VALVE FRIDGE COOKER Gas isolation valve Note Amount and order of taps may vary from that which is shown Aly Ay Safe Usage To avoid accidents the following fundamental advice should be carefully read before using gas appliances Always read and follow the use and maintenance instructions provided by the manufacturers of gas equipment Should any soot accumulate on pans fire radiants etc or any smell be produced consult a competent installer on the correct maintenance and adjustment of burners e Never check for gas
83. equired e These items will be checked as part of your motorhome annual habitation check Refer to section 12 of the handbook Maintenance checklist e Your refrigerator will give years of trouble free use if you run through this check list regularly e Keep the refrigerator clean e Check that the refrigerator is defrosting itself regularly e Check the door closing mechanism regularly as previously described e Make sure that the ventilation grills are not blocked Regularly clean the ventilation grills j A FITTED EQUIPMENT Vent screen Storage The vent has a screen to prevent bugs from If you do not expect to use your refrigerator entering the combustion area of the for a lengthy period carry out the following refrigerator These vents need to be cleaned actions regularly to ensure a good airflow When the Remove all food refrigerator performs poorly due to high external temperatures the vents can be removed to improve the airflow and hence Clean the refrigerator as described cooling performance earlier Shut off the gas tap to the refrigerator Switch off the refrigerator e Leave the door ajar using the special closure hook storage position e Place the winter cover on the ventilation grill Troubleshooting If your refrigerator does not refrigerate properly or will not start run through the following checklist e Check that you have followed the instructions in Switching on
84. er heater space heater and charger 2 x 20A battery inputs via 2 x 4 way connectors 1 x Dedicated solar panel input 20 to 100W panel via a 4 way connector 25A total output via multiple switched channels protected by 14 fused outputs Input 220 240 Volts AC 10 Frequency 50 Hz 6 Current 3A max DC Output 13 6 to 14 4 Volts nominal Current 25 Amps max 300 Watts Overall size HxWxD 50 x 250 x 135mm 4 x Fresh water level 4 x Waste water level 1 x Engine running plus multiple vehicle connections CANBUS Data communication and power to Control Panel via 6 way connector IP31 Ambient 0 to 35 Centigrade PSU case temperature with full load 65 C Max Overall size HxWxD 315 x 195 x 150mm Clearances 75mm above 50mm left and right Overall size HxWxD 80 x 194 x 25mm Cut out size HxW 60 x 165mm 7 31 Fixing centres 128 128mm 1 2kg Fresh water negative sensed Waste water negative sensed Automatic shutdown and restart if overheated overloaded Weight 2 9kg Fixing centres 178mm Weight 140g CONNECTION OF SERVICES 12V 230V WIRING DIAGRAM 39qIY4 010YY AlddNs LNANVWYAd monawnmosa nwu saws LNAWNIVLYALNA YAlsI dN AL SLIAOOS AZL aummwmona ow sawaj amp AYLLY ATOIHSA AlddNs AQEZ VIA LANdNI SNIV w po z O a m m z og AV 133 YAOYVHO LMds dIWV0Z 1N3NA313 31V1d1OH YSOYVHO IN3W313 OV ov E S LIMOOS AY3LLY9 3904 YSLVSH YaIy009 OV AOE 131LVA
85. er to be checked here at the Service Centre by a qualified Dometic engineer In this instance we call upon Leisure Appliances and Repairs of Hereford who come by appointment to carry out the necessary work The only component that is changed during the course of the annual check is the flexible gas hose the hose that leads from the bulkhead fitting in the gas compartment to the gas regulator A further aspect of the test is a gas pressure test You will see also that we check that key components are serviceable fire extinguishers etc and furthermore that where appropriate items are lubricated and checked for serviceability bas A SERVICE DETAILS MOTOR CARAVAN ANNUAL HABITATION SERVICE CHECK CHECK SHEET CUSTOMER COPY Vehicle Reg Mark A Class Make amp Model Coachbuilt Year of Manufacture High top conversion Recorded Mileage Elevating Roof Dismountable CHECK ITEM Manual OK Remarks Advice to Customers SECTION 1 BODY MOUNTING BODY TO CHASSIS BODY TO CAB BODY RETENTION SECTION 2 WINDOWS WINDOWS SECTION 3 DOORS EXTERNAL INTERNAL SECTION 4 CHASSIS CORNER STEADIES FOLDING STEP WATER TANK MOUNTS SPARE WHEEL WHEEL BOXES SECTION 5 BODY EXTERIOR ROOF LIGHTS ROOF RACK AND LADDER MOULDINGS AND TRIM FLUE TERMINALS AIR VENTS SECTION 6 INTERNAL SEEPAGE CHECK FURNITURE DINETTE SEATS BEDS CURTAINS BLINDS NETS CAB SEATS FIRE EXTINGUISHER FIRE BLANKET WARNING NOTICE HEATI
86. er you should be fully conversant with all matters relating to weights The following definitions should be fully understood and then related to the tabulated base vehicle weight data Weights Details of vehicle weights are found below and are presented in the manner prescribed in the European Standard EN1646 2 for Payloads All weights are in kilograms kg Take care to ensure that heavy loads are stored low down in bed boxes and low cupboards and distribute weight evenly side to side as far as possible Note 1 Please take care to ensure that you have allowed for the masses of all items you intend to carry in the motor caravan e g passengers optional equipment essential habitation equipment and personal effects such as clothing food pets bicycles sailboards sports equipment etc Note 2 Warning Under no circumstances should the maximum technically permissible laden mass of this motor caravan or its individual axles be exceeded DEFINITIONS Maximum Technically Permissible Laden Mass MTPLM The Maximum Technically Permissible Laden Mass is a figure given by the manufacturer of the base vehicle It is the combined maximum permitted weight of the vehicle and all of its contents both inside and out The MTPLM is unaffected by the Auto Sleeper conversion Mass in Running Order MRO The Mass in Running Order is defined as the mass of the standard converted vehicle with bodywork including the following
87. es should be periodically checked for damage and should be kept free from dirt Blocking of vents or flues is extremely hazardous and should be avoided at all times Gas Appliance Igniters It is advisable periodically to check visually the igniters on hobs grills and ovens are sparking correctly Annual Inspection The gas installations should be inspected annually by qualified personnel If in doubt contact your supplying Auto Sleeper dealer Modifications to the gas systems should not take place unless carried out by qualified technicians A CARE OF YOUR MOTORHOME SEAT RESTRAINTS WARNING In the event of any impact of 25 mph or over in which seat belts have been worn they must be replaced before the vehicle is used again WATER SYSTEM Fresh Water Tank At regular intervals and at least every three months the fresh water system should be flushed through with fresh water Furthermore it is advisable that prior to using your Auto Sleeper the fresh water system is thoroughly flushed with fresh water Waste Water Tank Since the waste water tank can hold foreign matter it should be regularly flushed with fresh water To prevent odours working back through the shower and sink outlets flush the waste tank through with a small amount of mild disinfectant Depending on the use of the waste tank it is possible that this will collect solid waste matter which in some instances may build up and block the was
88. ese breathers this should give no cause for concern Frost Precaution If the vehicle is not being used during freezing conditions the water must be drained Whilst the vehicle is being used in such conditions and the water heater is at risk of freezing it should be drained by opening the drain valve FRESH WATER PUMP A Whale submersible water pump is fitted in the freshwater tank of your vehicle This is a compact self venting high flow pump which is quiet in operation and has a maximum flow rate of 15 8 litres per minute Maintenance The pump is a sealed unit so no maintenance is required other than a check as part of the annual habitation service Ensuring the water supply is free of debris when filling the tank will reduce the likelihood of pump clog Winterising To protect against damage as a result of freezing drain the entire water system WATER SYSTEM SCHEMATIC DIAGRAM FOR x IDENTIFICATION PURPOSES ONLY SHOWER HEAD NTT IF FITTED VANITY TAPS A CONNECTION OF SERVICES FRESHWATER FILLER The Whale Watermaster system is used on your vehicle to make easier the connection of an outside water supply to the water system Operation Priming 1 Open one cold tap e g kitchen sink 2 Place pump into water container 3 Insert plug into wall socket 4 Whale socket Locate plug tab into lid slot and close lid to lock in position in the socket Close lid to lock locks into slot
89. fore any equipment that was left switched on will be turned on The 12v power will be switched off at Midnight 24 00 7 20 A CONNECTION OF SERVICES aly 3 13 12 Volt DC Fuses WARNING When replacing fuses always replace a fuse with the correct value NEVER replace with a higher value rating as this could damage the wiring harness If a replacement fuse blows do not keep replacing the fuse as you could damage the wiring harness Please investigate the fault and contact your dealer The following table shows the fuse allocation for the 15 fuses fitted to the PSU Please note that fuses are dependant on PSU versions so not all fuses may be present Red Fans SSCS Red Power Girouts S S Red tiorro croa Rea Toho croi O Rea Enoc C Rea TankHeaters C Rea Future Supply The following table shows details of the fuse s located at the Leisure battery Battery 1 20 Amps Fuse remotely located near battery Battery 2 20 Amps Yellow Fuse remotely located near battery 2 where fitted The following table shows details of the fuse s located at the EM40 Interface Unit 4 20 Amps Yellow Vehicle Battery 5 Spare location 6 20 Amps Yellow Fridge T 20 Amps Yellow Tow Bar D 8 20 Amps Yellow Fridge D 7 21 CONNECTION OF SERVICES fl X 3 14 Common Fault Table Faut Possible Cause Proposed Fix No 230 volt Connecting lead between Check and connect lead as per 2 3C
90. h with rubbing compound Slightly deeper scratches should be lightly wet sanded first using very fine 1200 grit or finer abrasive paper Rubbing compound will then remove the flatting marks created by the abrasive paper For deep gouge type scratches where the paint or gel may have been penetrated you should first seek the advice of your supplying Auto Sleeper dealer Removing Scratches from Acrylic Windows All windows except the chassis cab and Luton are manufactured in acrylic Over time these become scratched and their clarity impaired An Acrylic Window Polish removes unwanted scratches and blemishes leaving a clear haze free finish Minor scratches can be polished out directly Cleaning Interior Plastics Interior plastic parts such as the shower and wash basin should only be cleaned with warm soapy water or non abrasive cleaners specified as being suitable for use on plastic items Recommended Materials G3 Paste Compound This is a cutting compound and polish recommended for use on painted surfaces and GRP It is ideal for removing the traffic film that builds up on glassfibre coachwork and not only restores it to its former glory but adds a high level of polish as well G10 Extra Fine Grade Liquid This is again ideal for polishing surfaces and removes swirl marks and very fine scratches It is less abrasive than G3 yet has the same polish properties and cleans and restores discoloured surfaces It is
91. harging voltage is present at battery Fuse blown Check all fuses are intact and the correct value fuse is installed as per fuse table Equipment switched off Check equipment is switched on and connected to the 12V supply unplugged PSU overheated auto Reduce load on system Allow PSU to cool down PSU will shutdown operated automatically restart when cool Other fault Contact your Dealer Pump not Fuse blown blown Fuse blown Replace fuse with correct value as per fuse table working Pump turned off Turn pump on by pressing the pump button at the control panel Setting incorrect Both the internal and external pump feeds are controlledd from the control panel To alter the setting of the pump switch see your dealer Ensure the setting matches your desired requirement 3 15 Contact details Sargent Electrical Services Limited provide a technical help line during office hours Please contact 01482 678981 if you require technical help For out of hour support please refer to the tech support section of the Sargent web site www sargentltd co uk 4 EC480 Control Panel In addition to the information contained in section 2 5 Control Panel Operation the following section provides further detail information 4 1 Backlight Operation The screen backlight illumination is turned on and off automatically When operating on battery power only the backlight time is 30 seconds When operating on mains power the backlight time is increase
92. he burner can be ignited by depressing the ignition button which is located on the fascia Ignition must be carried out with the door open and if the burner has not lit within 15 seconds the control knob should be released and the grill left for at least 1 minute before a further attempt to ignite the burner 4 On first use of the grill it should be heated for about 20 minutes to eliminate any residual factory lubricants that might impart unpleasant smells to the food being cooked A non toxic smoke may occur when using for the first time so open any windows and turn on B mechanical ventilators to help remove the smoke Although the grill does heat up quickly it is recommended that a few minutes preheat be allowed Flame Failure Device FFD the grill burner is fitted with a flame sensing probe which will automatically cut off the gas supply in the event of the flame going out In the event of the burner flames being accidentally extinguished turn off the burner control and do not attempt to re ignite the burner for at least one minute It is normal for the flames on this burner to develop yellow tips as it heats up particularly on butane A reversible grill pan trivet enables the correct grilling height to be achieved Grilling should be carried out on the middle shelf position Fast Toasting trivet in high position Grilling Sausages trivet in high position Grilling Steak Bacon
93. he inside Switch on again Important Do not use force or sharp objects to remove frost Do not try to accelerate defrosting by using for example a hairdryer Door locking mechanism Frost will form in the refrigerator if the door is not closed properly To check this close the door with a piece of paper between the door and the refrigerator Pull at the piece of paper If you feel resistance the door closes properly If you feel no resistance the door does not close properly Perform this test regularly on all sides of the door If you find that the door does not close properly check whether the door locking mechanism keeps the door properly shut Winter operation If you use the refrigerator when the outdoor temperature is below 8 C install the Thetford vent winter storage cover see fig A on the ventilation grills The cover which is available from your dealer protects your refrigerator from excessively cold air It is also advisable to fit the cover if you are not going to use the vehicle for a long period Maintenance of gas equipment e A qualified engineer must inspect and maintain gas and electrical equipment Important Laws covering gas appliances make it the user s responsibility to observe the following rules e Appliances that run on LPG must be inspected every year e The gas burner must be cleaned at least once a year e Gas hoses must be checked annually and replaced regularly as r
94. he rear axle This is called Air Top is manufactured by AL KO and uses additional air springs to improve the quality of the vehicle ride The operating pressure may be adjusted by the vehicle user to suit their requirements The system does not increase the carrying capacity of the rear axle or the vehicle as a whole Use The pressure is adjusted by attaching a garage airline or footpump to the car tyre type valves located in the passenger door stepwell Adjust the pressure on the gauge to any value in the range stated for the optimum working pressure in order to obtain the ride characteristics you require If you choose to have different pressures side to side ensure that the difference between them is not greater than 0 7 bar 10 psi Do not inflate to more than the maximum pressure Maintenance No maintenance is required although the system will be checked at the annual habitation service Washing with water is permitted to remove any salt which may collect during road use If there are any problems with the system contact your dealer or an AL KO approved service centre Specification Optimum working pressure 1 8 bar 26 psi to 2 5 bar 36 psi Minimum working pressure 1 5 bar 22 psi Maximum working pressure 3 0 bar 44 psi 9 36 B A CARE OF YOUR MOTORHOME GENERAL In order to keep your Auto Sleeper in first class condition periodic maintenance will be required to both the bod
95. he clutch smoothly Avoid wear and tear on clutch and transmission by taking extra care Change gears smoothly Try not to jerk the clutch MOTORWAY DRIVING Speed Limits UK If a speed limit is not in force your motorhome can be driven up to 7Omph on motorways and dual carriageways 1 Reduce Speed i In high or cross winds il iii In poor visibility Downhill 2 High sided vehicles cause air buffeting so extra care must be taken when passing or being passed As much space as possible should be given Motorway Handling Do not bump the kerb with the wheels When passing other vehicles allow more than the normal clearance Allow longer to get up speed to pass Do not swing out suddenly Carry out all manoeuvres as smoothly as possible Use nearside wing mirror to check motorhome has cleared when overtaking Changing a Wheel Refer to the vehicle handbook WARNING Ensure the wheel is of the same construction and size as the one that has been removed Jacking Front and Rear use the standard jacking points as per the base vehicle handbook Removing the Spare Wheel CAUTION Exercise care when lowering the wheel frame due to its weight Removal a The spare is located in front of the rear step b Tools The jack handle and wheel brace are stored under the nearside rear seat c Follow the procedure for changing a wheel as described and illustrated in the base vehicle handbook
96. he cowl is unobstructed Be sure to remove any covers that may be present Turn on the gas cylinder and open quick acting valve in the gas supply line Check whether the power supply fuse protection on the camp site is adequate for the 900W 3 9A or 1800W 7 8A that have been selected using the power selector switch The cable drum must be fully unwound in order to prevent the power cable from overheating Summer operation boiler operation only Select gas or electrical operation using the power selector switch Illumination of the yellow LED g on the power selector switch indicates that the unit is operating with 230V Note Mixed operation gas and electrical is not possible in summer mode With this setting the unit automatically selects electrical operation with a pre selected power setting of 900W or 1800W Move the rotary switch on the control panel to position l summer operation 40 C or 60 C The green k and yellow p LEDs light up When the selected water temperature is reached 40 C or 60 C the heater shuts off and the yellow LEd p goes off A FITTED EQUIPMENT Winter operation Heating with water temperature monitoring Select gas electrical or mixed operation using the power switch Illumination of the yellow LED g on the power selector switch indicates that the unit is operating with 230V Move rotary switch on control panel to operating position n Set the rotary switch
97. he facilities of a motorhome at such times care and consideration should be given to those around them Driving When using a motorhome on either the public highway or private road the Highway Code should be complied with and full consideration given to other road users In the event of a motorhome travelling slowly and there being a queue of traffic behind the driver of the motorhome should where possible pull over in order to let the other traffic pass When the vehicle is in motion it is compulsory that all passengers are seated and seat restraint straps worn Before moving off elevating roofs MUST be lowered and correctly secured and top hinged windows closed Likewise all doors and access lockers for gas containers and chemical toilets must be properly closed Exterior steps should be properly retracted and secured When the vehicle is being refuelled or ona ferry all gas systems must be turned off Gas appliances should only be used when the vehicle is in motion when the manufacturer of the appliance permits such use Handbook Before using a motorhome all aspects of the handbooks produced by the chassis manufacturer and the converter must be read and adhered to Environment Care and consideration should be taken to protect the environment Observe the Country and Coastal Codes shown below The Country Code Enjoy the countryside but respect its life and work More people than ever befo
98. hed on the green LED is lit and the red LED blinks Approximately 30 seconds after the heater is switched on the red LED is lit After operating for a longer period of time the heater switches to failure Green and red LEDs blink after heater is switched off Green LED blinks after heater is switched off When the device is switched on in electrical operation the red LED on the control panel flashes the yellow LED on the power se lector switch does not illuminate and the heater does not heat up No operating voltage Device fuse or vehicle fuse defective The temperature setting on the control panel is lower than the room temperature Open window above cowl window switch Battery voltage is too low lt 10 5V Electronics are defective Gas cylinder or quick closure valve in the gas line is closed Combustion air infeed or exhaust outlet is sealed Hot air outlets blocked Recirculated air intake Gas pressure regulator iced up Butane content in the gas cylinder too high Unit was switched off during failure After running is active in order to reduce the unit s temperature After running is active in order to reduce the unit s temperature No 230 V operating voltage 230 V fuse defective Overheating protection has activated ea Rectification Check battery voltage 12V Check all electrical plug connections Check the unit or
99. hicle is fitted with an Avtex TV DVD then please note the following points e For detailed operating instructions and specification please refer to the literature supplied with the vehicle e Avtex operate a helpline for users experiencing problems with any of their products Whether it is difficulty with tuning setting up the equipment or a physical malfunction then contact their Service Department on 02920 020279 normal business hours They will be able to talk to you through many issues but if there is still a problem they will arrange for a courier to collect your set from any UK postcode including campsites for return to their factory overnight The repaired equipment will normally be despatched the following day for return to the customer This service is free during the warranty period After the warranty has expired the service is still available but there will be a charge e Warning If for any reason the support 9 25 B bracket is unscrewed from the back of the TV ensure that when it is re fitted that only the original screws or ones of the same length are used If longer screws are used they may damage the internal components of the equipment ELECTRIC STEP Your vehicle is fitted with an electrically operated side step In the event of the step being left extended a buzzer positioned under the dashboard will sound when the ignition is switched on and the step will self retract Maintenance
100. icant This will ensure that they remains in good condition supple N B The valve blade seal is a part of the toilet that is subject to wear Depending on the extent and manner of serivcing after a certain period the seal will lose quality and must be replaced Winter use You can continue to use your Thetford cassette toilet in cold weather as long as the toilet is situated in a heated location If not there is a risk of freezing In this case we advice that the toilet is drained A FITTED EQUIPMENT TELEVISION amp AERIAL You vehicle is fitted with an Avtex TV as standard This is connected to a Teleco aerial via a signal booster located in an overhead locker and a TV connection point located adjacent to the TV In addition the vehicle is pre wired to enable a Satellite receiver to be fitted at a later date To facilitate this there is a DVD AV socket adjacent to the TV point connected to a similar one in the overhead locker above the cooker ready for a de coder to be connected There is also an external cable input socket on the offside of the vehicle with two input sockets One is for connection of a satellite dish and is wired to the de coder connection point in the overhead locker The other is for connection of a digital TV external aerial and is wired directly to the TV point Note that the SAT connection on the TV points must be used to connect the TV when this input is used Notes If your ve
101. icks to test your alarm s sensor is that carbon monoxide is contained within the smoke given off by them as they burn inefficiently Candles matches etc will not provide a source of CO as they do not burn inefficiently Your CO detector cannot detect smoke Understanding different alarms High Level Alarm If a high level of CO above 70ppm has been detected for a specified period of time a loud continuous 85dB at 3 metres alarm will sound and the High Level LED will flash once very 5 seconds Press the Test Reset button to silence the alarm for 6 minutes If the CO level remains above 70ppm during this 6 minutes the alarm will again sound Low Level Alarm The detector will sound a loud continuous 85dB at 3 metres alarm and the Low Level LED will flash once every 5 seconds when a low level of CO 35ppm 70ppm has been continuously detected for 4 hours To silence the alarm press the Test Reset button If the CO level remains above 35ppm for the next 4 hours the alarm will again sound Continued low level alarms are an indication that the potential of a high level alarm exists You should treat this alarm very seriously Prolonged low levels of CO are believed to cause brain damage and heart disease particularly in children and pregnant women Call a qualified service engineer and have the problem investigated and rectified immediately In the case of gas appliances this must be a GAS SAFE registered installer WARNING
102. ide near the front of the seat and pull the seat forward to its full extent Insert the smaller infill cushion to fill the gap adjacent to the bathroom Locate the cross slides in the offside seat frame and pull them towards the nearside seat Adjust the leg feet if necessary Place the large infill cushion across these supports ensuring that the join in the cushion is nearest to the front of the vehicle 9 30 B j A FITTED EQUIPMENT NORMAL SEATING ASSEMBLY RRR RRR S QO 0 OOO PP RRR RGSS NK SORRELL CC Co POOL eo OOP PP Q RS QL LLL LLS OY QL LLLI 4 RSS 0102072200 2027229 SSR RRR HON LO co NN SS C gt K gt lt gt gt lt gt N GQ 9 31 j A FITTED EQUIPMENT DOUBLE BED ASSEMBLY V N NZ NZ Z N IV FV J VA FV Z NZ FV 4 0 J JV JV J JVJ J A NZ MSNM OCO 0002222092 20202 2202022220 2022220 229290 KY OK XXX 25252 S825 ORR RRR OX oS RRR KK KK KK RRA KANY IN UU C ee 9 32 A FITTED EQUIPMENT PARTS LIST Item 1 2 3 4 5 6 7 8 9 10 Part No CS0161 2 C CS0161 2 C CS0359 C CS0359 C CS0359 C CS0359 C CS0359 C CS0359 C CS0359 C CS0359 C Description Cushion type CABSEAT RH CABSEAT LH OFFSIDE BENCH CUSHION OFFSIDE BACKREST CUSHION LARGE INFILL CUSHION NEARSIDE SEAT CUSHION NEARSIDE BACKREST CUSHION INFILL CUSHION INFILL CUSHION BUNK MATTRESS 9 33 A FITTED EQUIPMENT EQUIPMENT ARRAN
103. in pipes check for leaks and satisfactory draining of water from sinks etc Couplings and Fluids Check that the appropriate markings are used blue for fresh water grey for waste water Ensure a sealing off cover is supplied for each coupling Check that filler positions are designated petrol diesel or water as appropriate Toilet Waste Tank Check that any fixed tank intended to receive discharge from a toilet is fitted with either a level or full indicator SECTION 10 ELECTRICAL SYSTEMS Extra Low Voltage 12 Volts excluding vehicle Battery ies e Check battery ies for condition Check connections wires fuses and relays appertaining to the habitation electrics Wiring e Examine all visible wiring Check all connections and joints are sound and satisfactory Fuses Fuse Holders Ensure that fuses and fuse holders used to protect the habitation electrics are satisfactory and that fuse ratings are compatible with the circuit appliances being protected Appliances e Inspect all appliances for damage signs of overheating and secure fixing Function test all appliances Mains 230 Volt System It is recommended that the inspection and certification of the 230 volt system be carried out by a qualified electrician who is an approved contractor of the NICEIC National Inspection Council for Electrical Installation Contracting or a member of the Electrical Contractor
104. in the vicinity of petrol stations If it will take longer than 15 minutes to refuel your vehicle you should switch the refrigerator off using the main switch A Switching off the refrigerator Set the energy source selector switch A to e The refrigerator is now completely switched off Use the special storage latch on the door locking mechanism to stop the door from closing This prevents unpleasant odours and mould in the refrigerator Important If you are not going to use the refrigerator for a prolonged period close the valve of the gas bottle and the gas taps Maintenance Regular maintenance is necessary to ensure the correct functioning of your refrigerator Cleaning Clean the refrigerator with a soft cloth and mild detergent A FITTED EQUIPMENT e Dust the refrigerator with a soft moistened cloth e Do not use soap or aggressive detergents that are abrasive or soda based Note the removable interior components of the refrigerator are not dishwasher proof Defrosting e The refrigerator should defrost itself automatically However should it be necessary to manually defrost the refrigerator observe the following Act once the frost layer reaches about 3mm thick Remove contents of refrigerator and switch off e Leave the door open e Place dry towels inside to absorb the water e Place trays of hot water in the freezer compartment e After defrosting use a cloth to dry t
105. ioned along the vehicle to form a large dinette with the rear seats lowered to the bed position to provide seating When not required this table should be securely stowed in the front overcab shelf area Two smaller pedestal tables may be used instead by positioning the table legs in the holes provided in the floor at the front of the vehicle When not in use the bungs should be fitted to the hole in the floor and the table tops stored behind the offside side panel with the legs stored in the clips in the overcab shelf area Caution Ensure that the folding legs are locked in place before using the table The table must be stored when the vehicle is in motion Kitchen Area The kitchen area is located towards the rear of the vehicle and features a Spinflo Triplex 9 26 B combination oven grill and hob with three gas burners Adjacent to this is a stainless steel sink with cutlery rack and drainer concealed by a Chincjilla glass lid which may also be used as a chopping board The sink is fed by a chrome mixer tap mounted to the left of the sink Below the sink is a drawer containing a cutlery tray and a large storage cupboard An adjacent cupboard below the oven houses the Sargent main electrical control box Below the work surface is an additional slide out worktop and a Thetford absorption refrigerator with selectable gas or electric energy source and automatic ignition Above the cooker is an overhead storage
106. iority as per the following example Leisure load Available power for battery charging WARNING Under heavy loads the charger case may become hot ALWAYS ensure any ventilation slots have a clear flow of air Do not place combustible materials against adjacent to the charger 3 4 Smart Charging The EC500 system incorporates a smart charge feature which monitors both leisure and vehicle batteries and automatically adjusts and directs the charger power and solar power if a solar panel is installed to maintain the leisure and vehicle batteries at an optimal level 3 5 Leisure Battery 3 5 1 Type Selection For optimum performance and safety it is essential that only a proprietary brand LEISURE battery is used with a typical capacity of 75 to 120 Ah Ampere hours A normal vehicle battery is NOT suitable This battery should always be connected when the system is in use The PSU is configured to work with standard lead acid leisure batteries and in most cases is also compatible with the latest range of Absorbed Glass Matt AGM batteries Before fitting non standard batteries please check that the charging profile described in 3 3 is suitable for the type of battery by referring to the battery documentation or battery manufacturer Some vehicle installations can cater for two leisure batteries connected in parallel In these cases it is recommended that two identical batteries are used The battery feed is fitted with an inline fu
107. ith four seats designated for use whilst the vehicle is in motion Vehicle has a large transverse double bed and two permanent bunk beds across the rear of the vehicle Climatic Conditions The motorhome is designed for use in temperate climates and is certified Grade 1 in accordance with EN 1646 1 2004 indicating an effective heating system is fitted but has not been tested for thermal performance Handbook Any queries should be addressed to your Auto Sleeper dealer Appliance Instructions The appliance instructions included have been extracted from those supplied from the appliance manufacturers Automotive Peugeot For all automotive matters you should refer to the Peugeot vehicle instructions manual This includes tyre pressures referring to the type of tyres fitted The Auto Sleeper conversion does not affect the tyre pressures in any way as it is built within the design envelope of the base vehicle A INTRODUCTION Air Suspension Your vehicle has been fitted with a supplementary air Suspension system on the rear axle This is called Air Top is manufactured by AL KO and uses additional air springs to improve the quality of the vehicle ride The operating pressure may be adjusted by the vehicle user to suit their requirements The system does not increase the carrying capacity of the rear axle or the vehicle as a whole See Section 9 for further details IMPORTANT In the interests of safety
108. l equipment essential habitation equipment and personal effects such as clothing food pets bicycles etc Although there are additional seat belts within the motorhome please refer to the stated number of passengers that are allowed due to the MRO and MTPLM LOADING AND DISTRIBUTION OF WEIGHT IN THE MOTORHOME SENSIBLE LOADING HOW TO APPORTION WEIGHT Z HEAVY ITEMS MEDIUM ITEMS LIGHT ITEMS Loading Correct weight distribution is a major factor in making your motorhome a balanced and pleasant vehicle to drive without compromising road holding Care should therefore be taken to ensure that heavy items are well spaced and are in as low a position as possible for example low cupboards and bed boxes DO NOT EXCEED THE STATED MAXIMUM LOAD ITEMS FITTED OTHER THAN STANDARD EQUIPMENT WILL DEPLETE THE PAYLOAD STATED IN THIS HANDBOOK WARNING Under no circumstances should the maximum permissible laden mass of the motorhome be exceeded Roof Loading DO NOT ALLOW CHILDREN TO CLIMB ONTO THE ROOF Roof Rack Bars and Ladder optional When using the optional roof rack care should be taken to see that all the items are securely anchored Apart from general cleaning and polishing the roof rack and ladder require no special maintenance WARNING Take special care when on the roof in wet or frosty weather conditions which cause it to be particularly slippery Maximum load within the area encompassed
109. l to protect the battery from severe damage You should not rely on this cut off level during normal operation but manage your power consumption to a discharge level of 10V Leisure ae Power is turned off This cut off only applies to power drawn from the battery by the leisure equipment that is controlled by the control panel power switch it will not protect the battery from discharge by permanently connected equipment A CONNECTION OF SERVICES aly 3 6 Solar Charge Management The EC500 PSU incorporates a built in solar charge management feature which will control the input from a solar panel when fitted maximum rating 120W Depending on the charge state of the batteries the solar power will be directed to the required battery and continuously monitored to ensure optimum operation For this system to operate intelligently the shutdown button should be left switched on If the shutdown button is turned off then the solar panel will charge the leisure battery only 3 7 Water System Operation The control panel pump button operates the internal onboard water pump This pump will draw water from the internal onboard water tank The water tanks fresh amp waste incorporate a level warning feature to warn the user when the fresh water level drops below 25 or when the waste water level reaches 100 If the water pump power is turned on and the fresh water level drops to below 25 a warning beep will be heard information
110. leaks with a naked flame Never use gas appliances without adequate ventilation All gas appliances require a plentiful supply of fresh air for correct operation Fixed ventilators or air inlets should not be stopped up Where practicable turn off all appliances before retiring to bed preferably at the cylinder or inlet to the motorhome or other dwelling e Unless the appliance incorporates automatic ignition when lighting an appliance always make sure you apply a lighted match or taper to the burner before turning on the gas e If any appliance is disconnected for repair maintenance etc ensure that the gas line is capped off lf taps are stiff to operate or appear to be a source of leakage call in a competent installer to rectify LPG taps require a special grease e Always seek advice when in doubt Input Ratings Input rating for the gas appliances are as follows Refrigerator 0 1kW Heater uu ua sassa sawa uawan 2 4kW luu u uum mihayaypimaapususiuykussa 1 5kW Water heater 1 5kW OVET sennen a 1 5kW A CONNECTION OF SERVICES ELECTRICITY As with electricity in the home care must be exercised when handling mains electricity Your attention is drawn to the following notice as laid down by the Institute of Electrical Engineers INSTRUCTIONS FOR ELECTRICITY SUPPLY On arrival at caravan site The motorhome main
111. lear air inlet to vehicle Blocked retention ports Check retention ports are clear 10 7 A CARE OF YOUR MOTORHOME WATER TROUBLESHOOTING CHART Note For more help with water pump issues please refer to page 7 3 of this handbook Symptom Remedy Continuous running of No water 1 Fill tank water pump 2 Major leak 2 Switch off immediately and Intermittent operation of water Minor leak in water system Check push fit joints Water pump pressure release No action part of pump design valve reasserting itself M Water pump does not operate Fuse 4 blown same rating Water gauge does not Probe fault Refer to dealer check probe operate connections No hot water mains system Water heater tripped No hot water gas system Gas module not lighting Igniter not working Check 12V switched on Slow drainage from Blocked breathers in waste tank sink shower tray Tip up handbasin slow to Blocked drain hole drain Unsatisfactory operation of Filter blocked Clean filter water pump 10 8 O A USEFUL INFORMATION L DATA RECORD We suggest that you record key details in the spaces below should you accidentally mislay your keys or other vital documentation V Mole DDO u uuu a s smasmiasssastasususpaypasssssssasassmaqassnassssemawpashusasasasqasaqsasaspassasuss Vehicle Model a a neacdnenseoadeledaiecaewinenchoxeandatacatetand ved xacunidannias III K ee u
112. lect again to move to minutes and adjust with the up down buttons Press select again to move to timer on off Press the up down buttons to adjust the setting If the timer is turned on a stopwatch symbol will be shown in the header area Press select again to exit the settings 7 26 A CONNECTION OF SERVICES aly 4 4 6 System Warnings Screens Fresh Tank Level LOW Fresh Mater Tank 25x Full The system can display a number of warnings The control panel will beep and display the appropriate message Press the select button to cancel the warning See sections 3 4B and 3 8 for an explanation of typical system warnings 1 27 A CONNECTION OF SERVICES 5 EC300 Control Panel Display Options Notes EC300 v2 20 J2 00 23 00 C Leisure Battery 12 5v Good Vehicle Battery 13 3v Good Mains Supply ON Fresh Water 25 Full Waste Water 0 Full External Temp 20 5 C Main Control Panel display showing model number EC300 software version number current time 12 00 and Internal temperature 23 9 C in centrigrade Voltage reading and battery condition description for the on board leisure battery See also 3 5 3 Voltage reading and battery condition description for the vehicle battery See also 3 5 3 Indication of the 230V mains supply Water level in the fresh water tank 5 measurement levels If the water pump power switch is turned ON and the water level drops below 25 a warning
113. ly MUST be unplugged BEFORE putting the pump back into the refilled water container A CONNECTION OF SERVICES GAS GENERAL INFORMATION The gas appliances in this vehicle are powered by Liquified Petroleum Gas LPG which is stored under pressure in a tank located under the floor in the centre of the vehicle This tank is refilled when required at a re fuelling station using a nozzle and hose in a similar way to refilling the engine fuel tank Make sure that heating and cooking appliances are switched off before you move the motorhome The regulator Your motorhome is fitted with a regulator as standard equipment The gas regulator has a working pressure of 30mbar and is suitable for use with all commercially available brands of LPG It is fitted adjacent to the tank installation under the vehicle and requires no attention from the owner whilst using the vehicle Availability LPG is becoming more widely available as more vehicle engines are converted to run on it Many garages now have an LPG pump and other outlets are available in more rural areas often near farming communities for Aly Ay instance Look for signs advertising Autogas If you have internet access search for LPG filling stations and there are many sites where input of your postcode will locate the nearest filling station to your location There are many companies producing LPG but all brands are suitable for use in your vehicle
114. me Preparing for use Open the access door on the outside of your motorhome 1 Remove the waste tank by pulling the safety catch upwards 2 Pull the waste tank outward to the stop Tip it slightly and take the tank fully out 3 Place the tank upright and turn the emptying spout upwards 4 Remove the cap with the measuring cup inside from the emptying spout and pour the stated quantity of toilet fluid into the waste tank This avoids unpleasant smells in the waste tank and keeps the inside of the waste tank clean Next add approximately 2 litres of water enough to ensure that the bottom of the waste tank is covered Screw the cap back onto the emptying spout Turn the emptying spout back to its original position WARNING Never add toilet fluid via the valve blade or via the toilet bowl 5 Slide the waste tank back into its original position via the access door Note Never use force if you cannot get the tank back into place easily This may cause serious damage 6 Make sure that the waste tank is secured with the safety catch Shut the access door and lock it 7 Turn the toilet bowl to the desired position 8 Run some water into the bowl by pressing the flush button once 9 The toilet may be used with the blade open or closed To open the valve pull the valve handle under the toilet bowl B towards you Your toilet is now ready to use 10 After use open the valve blade if it is still clo
115. me fresh air circulation into the awning space when such appliances are in use A SAFETY amp SECURITY ELECTRICAL SYSTEMS Batteries Battery terminals and connectors should be firmly attached Battery surfaces should be free of moisture and dirt Where removable cell taps are fitted these must be screwed firmly home When removing a battery always remove the negative cable first On re connection the negative cable should be connected last Switch off all lamps and appliances before disconnecting the battery Do not smoke while working on or near to the battery Fuses Always replace blown fuses with one of a correct rating Overload Never overload any electrical circuit especially the 12 volt socket outlet The rating of appliances should be checked before connection Shower Compartment Light Ensure that water does not ingress into the light unit Charger Unit Keep the charger unit well ventilated and never allow material or bags to be in contact with the unit casing which gets hot when the unit is operating 230 Volt Mains Operation Before connecting to the supply ensure that the contacts in both the plug and the socket are clean and dry and that the hook up plug is firmly located and locked into the socket The RCD must be easily accessible at all times GENERAL Before using your Auto Sleeper you should be fully conversant with the following safety precautions if you are in any doubt as to
116. minutes to eliminate any residual factory lubricants that might impart unpleasant smells to the meals being cooked A non toxic smoke may occur when using for the first time so open any windows and turn on mechanical ventilators to help remove the smoke Although the oven does heat up quickly it is recommended that a 10 minute preheat be allowed The oven should be up to full temperature in about 15 20 minutes To turn off Turn the control knob clockwise until the line on the control knob is aligned with the dot on the control panel Shelf The shelf has been designed to allow a good circulation at the rear of the oven and is fitted with a raised bar to prevent trays or dishes making contact with the back of the oven To remove a shelf pull forward until it stops raise at front and remove B Oven temperature control The temperature in the oven is controlled by a thermostatic gas tap and is variable over the range 130 C to 240 C Approximate temperatures for the settings on the control knob are shown in the following table The temperatures indicated refer to the centre of the oven and at any particular setting the oven will be hotter at the top and cooler towards the base The variation between top and centre and centre to bottom is approximately equivalent to one gas mark Good use can be made of the temperature variation in several dishes requiring different temperatures may be cooked at the same time In this way ma
117. n order to check the water that is flowing out place an appropriate container capacity 10 litres beneath the drain valve FrostControl drainage muff x Turn the rotary switch on the drain valve by 180 until it engages whereby the push button moves out and the drain valve opens Check whether all of the water in the boiler 10 litres has been drained into the container via the drain valve There shall be no claims under guarantee for damage caused by frost Maintenance Only original Truma parts may be used for maintenance and repair work The materials in the device that come into A FITTED EQUIPMENT contact with water are drinking water safe Bio film deposits and limescale must be removed using chemicals to protect the unit from infestation by micro organisms Only Chloride free products must be used in order to prevent damage to the unit The effectiveness of the use of chemicals to combat micro organisms in the unit can be increased by heating the water in the boiler to 70 C at regular intervals Move power selector switch to gas operation d to do this Move the rotary switch on the control panel to position l summer operation 60 C the green k and yellow p LEDs light up Note Once the water in the boiler has reached a temperature of 60 C the burner will switch off and the yellow LEd p will go out The unit must stay switched on for at least 30 minutes and no warm water may be remov
118. ncertina blinds are manufactured from a paper type material and thus cleaning solvents and aerosols should be kept well clear from them Unlike Seitz roller blinds they will not need to be re tensioned any problems that should arise should be addressed to your Auto Sleeper dealer or the Motorhome Service Centre at Willersey A FITTED EQUIPMENT WARM AIR amp HOT WATER HEATING A Truma liquid gas Combi 4E warm air heater with integrated hot water boiler is fitted under the lower bunk on the offside of the vehicle It operates on LPG and or 230V electricity depending on the chosen mode of operation Warning This heater is intended for stationary use only and must not be in operation whilst the vehicle is in motion In winter operation the heater can be used to heat the room and simultaneously warm water If only warm water is required select summer operation At a temperature of approximately 3 deg C the automatic frost control safety drain valve will open and drain the boiler Three different options are available for operating the unit Gas operation only Propane butane for autonomous use Electrical operation only 230V for stationary use on camp sites Mixed operation Gas and electrical operation only possible in winter mode Winter operation In winter operation the unit automatically selects the required power setting according to the temperature difference between the temperature set on the c
119. nd during operation the heater will subsequently resume as normal Filling the water heater Check if the rotary switch for the drain valve FrostControl is set to Operation meaning that it is parallel to the water connection and engaged Close the drain valve by pushing the push button until it engages B Note When the temperature at FrostControl is below about 7 C first switch on the heater to warm the installation compartment and FrostControl After several minutes when the temperature at FrostControl is above 7 C the drain valve can be closed Switch on power for water pump main or pump switch Open hot water taps in kitchen and bathroom set pre selecting mixing taps or single lever fittings to hot Leave the fittings open for as long as it takes for the boiler to displace the air and fill up and the water to flow without interruption Note If just the cold water system is being operated without using the water heater the heater tank also fills up with water To avoid frost damage the boiler must be drained through the drain valve even if it was not operated WARNING When connecting to a central water supply rural or city mains a pressure reduction valve must always be installed to prevent pressures above 2 8 bar from developing in the water heater Draining the water heater Switch off power to water pump main or pump switch Open hot water taps in kitchen and bathroom I
120. nozzle filling instructions Filling Nozzles When connecting the nozzle to the filler valve on your vehicle always check that the locking pins are aligned There are two main types of filling nozzles used in the UK Gas Guard and De Visser Gas Guard uses a rotating barrel to lock on to the filler valve wherease De Visser uses a lever Ensure Gas Guard nozzles are fitted with protective nozzle shields Report to site staff if missing Nozzle shields have been removed from picture for clarity Connecting 1 Push nozzle over the lugs on the filler valve and turn barrel a quarter turn clockwise to lock Do not squeeze lever before nozzle is connected Caution From this moment onwards ensure hands are away from the nozzle barrel 2 Pull back lever and latch into place Ensure lever is latched securely Follow instructions on dispenser to commence dispensing Disconnect 3 Ensure hands are away from the nozzle barrel Caution When dispensing has ended squeeze back lever and release latch Release lever fully A small release of gas will occur as you release the lever This is normal Do not place hands on barrel until after the gas has been released 4 Turn barrel anti clockwise a quarter turn to release nozzle from vehicle Replace nozzle in holder on dispenser A CONNECTION OF SERVICES 1 De Visser nozzle filling instructions Ensure De Visser noz
121. on Yellow Silverstone Green Floor Vinyl Dark Wood Block Furniture Amati Furniture fittings Chrome Work Surfaces and Table finish Minstrel Carpet Mocha Curtains Cushions Upholstery Crystal various colours Exterior Graphics BS1820 A MOTORHOME CODE THE COUNTRY amp COASTAL CODES Upon arrival at your destination you should be aware of the Country Code relating to motorhome owners This is entitled the Motor Caravanners Code Code of Conduct Camp Sites Arrivals e Report to reception immediately on arrival Vehicle Movement Keep to roadways unless otherwise directed Adhere to speed limits Note that these are generally 10 mph Remember that the stopping distance on grass is considerably greater than on tarmac Only a person in possession of a current driving licence may drive on the site Park correctly as advised on your pitch Where possible leave 20ft of free space around your vehicle Use of Site Use the electrical mains hook up in the correct manner and with caution Ensure that all fresh water taps connections are turned off after use e Have care and consideration when using all facilities toilets and showers etc and leave them clean and tidy Young children should be escorted To avoid possible damage to sewage purification works only approved chemical fluids must be used Under no circumstances may coal tar phenol or caustic based fluid
122. ontrol panel and the current room temperature When the boiler is filled the water is automatically heated as well The water temperature depends on the selected operation mode and the heater output All three energy selection options can be used for winter deployment With gas operation the unit automatically selects the output level that is required Depending on the fuse protection at the camping site power of 9OOW 3 9A or 1800W 7 8A can be manually selected for electrical operation If more output is required e g heating up or low outside temperatures gas or mixed B operation should be selected so that enough heating power is always available With mixed operation 230V electrical operation is preferred if the power requirement is low e g for maintaining the room temperature The gas burner is not enabled until the power requirement is higher and is the first to switch off during heat up operations Summer operation boiler operation only Gas operation or 230V electrical operation is used for hot water preparation The water temperature can be set to 40 deg C or 60 C With gas operation the water is heated at the lowest burner setting Once the water temperature is reached the burner switches off Depending on the fuse protection at the camping site power of 900W 3 9A or 1800w 7 8A can be manually selected for electrical operation Note Mixed operation is not possible With this setting
123. p yellow tips as the burner heats up If the gas is butane a small amount of yellow tipping will be seen immediately after lighting increasing as the burner heats up Grill Burners It is normal for the flames on this type of burner to develop yellow tips as it heats up particularly on butane General A flame lifting away from the burners is an indication of too high a pressure although it may happen with grill burners whilst the frets are heating up A yellow flame will cause sooting and is an indication of too low a pressure Providing the regulator and piping have been checked and found satisfactory the above faults should not appear Flues Flues should be examined for security of fixing and for correct attachment to appliances and flue terminals They should be free from damage and corrosion Check for leakage of flue gases into the vehicle Flame Failure Device FFD e Where fitted FFD should be checked to ensure satisfactory operation After the appliance has been successfully checked allow time for the thermocouple to cool Attempt to relight the appliance by turning it on wihtout pushing in the gas control knob Do not override the FFD If appliance does not light FFD is satisfactory Security e Check appliance is securely fixed to the vehicle furniture and will be free from rattles Where applicable check that water pipes are satisfactorily attached with no sign of leakage Protection of
124. particularly detachable upper bed mattresses and scatter cushions Curtains Blinds To prevent uneven bleaching and possible excess sunlight onto the furniture and fabrics we recommend that either the curtains or blinds are left drawn Refrigerator Leave the refrigerator door open on its intermediate lock position this will allow the refrigerator to breathe and prevent any unpleasant odours in the storage department Ventilation There is fixed upper and lower ventilation in your Auto Sleeper which is built in in the interests of safety There is therefore no need A CARE OF YOUR MOTORHOME to leave any windows or roof ventilators ajar indeed the roof ventilators have sufficient fixed ventilation to allow the interior of the vehicle to breathe satisfactorily Exterior Fit where appropriate the Electrolux winter covers to the fridge ventilators Give your Auto Sleeper a good wash and polish before laying up and apply a small film of protective oil to the stainless steel roof rack ladder and any other external polished metal components Electrical Turn the electrical system off at the control panel Peugeot recommend that if the vehicle is to be parked up for a period of more than one month then it is advisable to disconnect the main vehicle battery For full instructions on the correct procedure refer to the Peugeot handbook supplied with the vehicle and look for the section covering the battery If this
125. pen pans as these may cause instability The lid must be opened fully prior to using the hotplate burners Using the hotplate gas burners 1 Ensure gas cylinder supply is connected and turned on In the event of a gas smell turn off at gas cylinder mains and contact supplier 2 Flame supervision Each burner is controlled individually and is monitored by a thermocouple probe A FITTED EQUIPMENT 3 To light Push in the control knob and turn anti clockwise until the large flame symbol is in the vertical position adjacent to the circle mark Hold a lit match or taper to the burner and push the control knob in and hold It is necessary to hold the knob depressedafter the burner has ignited for approximately 10 15 seconds to allow the thermocouple probe to reach temperature before releasing the knob Should the flame go out when the knob is released the procedure should be repeated holding the knob depressed for slightly longer 4 For models fitted with spark ignition the procedure is similar except that the burner can be ignited by depressing the ignition button which is located on the fascia If the burner has not lit within 15 seconds the control knob should be released and the burner left for at least one minute before a further attempt to ignite the burner is made 5 For simmering turn the knob further anti clockwise so that the small flame symbol is adjacent to the mark 6 To turn off Turn the control
126. personal items 2 Raise the alarm Call the fire brigade 3 Turn off gas container valve if safe to do SO Ventilation and Condensation The ventilation points on your motorhome are fixed points of ventilation which are stated by the European Standards Under no circumstances must these vents be blocked or obstructed It is advised that fixed ventilation points and any protective screens are checked and cleaned if necessary on a regular basis Fresh air circulation should be allowed below the motorhome when appliances are in use and when flues terminate below the floor to allow free evacuation of the products of combustion At least three sides of the underfloor space should always be kept open and unobstructed especially by snow Do not T make any additional openings in the floor Under no circumstances must these vents be blocked or obstructed Additional night time ventilation is obtained by releasing the window catches and placing them in the second groove on the frame catch Awnings There is no danger of pollution of an enclosed awning space by the LPG exhaust from the refrigerator venting into it WARNING Space heaters may produce sufficient exhaust gases to pollute the awning space if it is totally enclosed from a general comfort smell and hygiene point of view In the extreme case there could be a build up of carbon dioxide to a dangerous level Note Motorhome owners are advised to allow so
127. ption of only 5 watts A roof mounted ventilator is no longer necessary as the cleaned air is returned downwards while the suction is concentrated along the edges This creates an air dome which stops fumes escaping Features e Lateral air suction ensures efficient performance with 50 m h e Easy installation as no roof mounted ventilator is necessary e With 2 fan speed regulation and integrated halogen lights e Washable grease filter and exchangeable carbon filter Snap on releases for easy access to filters and lamps Technical data WV CIONIL EPE TEE ET AT 2 2 kg LELE a E NEEE 55 mm WVIGUIA EE EEE qa has s 400 mm DOD uuu Gu mas qhimunuamisussqaqasukaqa 280 mm Halogen lamps 2 x 10W Lamps V nanisensnremn 12 B SEITZ CONCERTINA BLINDS The windows of the habitation area are fitted with concertina blinds and flyscreens The flyscreens pull down from the top the concertina blinds up from the base and a combination of both may be achieved by clipping both units together in the centre to adopt the required position It should be remembered that both the flyscreens and concertina blinds are relatively delicate and those in the living area should be treated with care They should be kept in a dry and dust free state it is advised that the mechanisms are only lightly lubricated when they become a little stiff and inoperative otherwise no maintenance is needed The co
128. qoJpIe M 9 27 A FITTED EQUIPMENT hanging rail If required the floor of the upper wardrobe may be removed to make a taller hanging area for long clothes Rear Bunk Beds Twin bunks are arranged across the full width of the rear of the vehicle The lower bunk has a lift up base to give access to the heater battery and a large storage area On the nearside wall are mounted the red isolation taps for the gas appliances For explanation of the symbols on each tap please refer to page 7 7 The upper bunk accessible via a detachable ladder has a lift up centre section to facilitate access to the storage area under the lower bunk Each bunk has its own storage locker LED reading light and power sockets Lounge Area The lounge area is at the front of the vehicle and consists of the two travelling seats which can be extended forward to form inward facing bench seats At the front of the nearside seat is a dropdown door which reveals a bottle storage area with four bottle clips On the outside of this seat and accessible when the side door is open is the switch for the retractable step the exterior awning light and the interior step lights On a panel above the side door is located the electrical control panel with scrolling menu display and programmable control of all the vehicle s electrical services It incorporates a fresh water level indicator and master switches for the water pump and 12 volt circuits
129. r to make setting adjustments 2 6 Remote Control Systems fitted with the EC480 Control Panel also have an infrared remote control This control can be used to control some of the control panel functions as follows The power button works in the same manner as the control panel power button Point the remote towards the control panel and press the button to turn the power on or off G The B button works the same as the control panel lights button Press the button to turn the lights on or off The A button is used to turn on or off the dimmer circuit lights Press the button to turn the lights on or off The left hand side up and down buttons are used to control the dimmer circuit lights With the lights turned on press the up button to increase the brightness and press the down button to decrease the brightness Please note the right hand side up down buttons and the C button are for future use and have no function De Q20 A CONNECTION OF SERVICES AN 2 7 Operation while driving The EC500 system is designed to shutdown parts of the system whilst the engine is running This is to meet Electro Magnetic Compatibility EMC regulations and to ensure the safe operation of your motorhome Please ensure the system shutdown switch on the PSU is in the on button in position before driving see 2 2 This will ensure the electronic system is active and will therefore be able to control the
130. ration position t meaning that it is parallel to the water connection and engaged Close the drain valve by activating the push button The push button must engage in position u closed It can be manually closed with the push button position u and then the boiler filled only when the temperature at the drain valve is above approximately 7 C Truma can provide a heating element part no 70070 01 as an accessory it is inserted into FrostControl and warms it up to about 10 C when Combi is switched on This means that the boiler can be filled after a shorter time irrespective of the temperature in the installation compartment Automatic opening of the drain valve When the temperature is below approximately 3 C at the drain valve the drain valve will open automatically the push button moves out position w and the water in the boiler drains out through the drainage muff x B Manual opening of the drain valve Turn the rotary switch by 180 until it engages whereby the push button moves out position w The water in the boiler drains out through the drainage muff x The FrostControl drainage muff x must be free of contamination slush ice leaves etc at all times so the water can drain out easily No warranty given for frost damage Taking into operation Note Heating is possible without restrictions with gas electrical and mixed operation with or without water Check to make sure t
131. re Switch Setting 1 Ensure the system including the heater is full of water and all taps are closed Refer to your user manual Be sure to set the switch at low battery condition 2 If present remove the pressure switch locknut in an anti clockwise direction then tighten the adjusting screw clockwise until the pump comes on 3 Open any tap until you have a smooth flow of water then close the tap You should hear the pump running and the pump running light if fitted will be on 4 Return to the pressure switch and turn the screw slowly anti clockwise until the pump has stopped Turn the screw a further half turn 180 degrees anti clockwise 5 Check for correct operation by opening and closing all taps individually The pump should turn on when the cold tap is opened and switch off immediately when the cold tap is closed NB At low flows there may be some pulsation 6 The hot side may take about 10 seconds to react both on and off due to cushioning from the water heater 7 Carefully replace the lockout until it is tight keeping the adjustment screw in position Remember You may also have to adjust the pressure switch to cope with changes in voltage from either battery or mains Do so using the above instructions Aly Ae If setting of pressure switch is still not correct you may experience Pump running continuously even with tap closed If undiscovered could result in pump failure and flat battery Most
132. re are exploring the countryside interested in farming plant life bird watching or just observing the general wildlife Whatever your interest there is a lot to learn but please observe the following code Guard against all risk of fires Hay and heath land catch alight easily and once ablaze are very hard to put out Remember Fire Spreads Quickly e Keep to public paths across farmland Use gates and stiles to cross fences hedges and walls e Leave livestock crops and machinery alone View from a distance Take your litter home it is unsightly and harmful to wildlife A MOTORHOME CODE e Help to keep all water clean e Take special care of country roads e Make no unnecessary noise Most animals are very timid noises can disturb them unnecessarily If you want to get the best out of the country go quietly The Coastal Code As our coastlines are increasingly used for recreation and education the following suggestions are made to enable us to enjoy our inheritance and preserve it for posterity Do not trample about or move rocks unnecessarily e Do not frighten seals or seabirds Do not spear fish Do not spill detergents solvents or fuel from boats as these can kill marine life e When sailing moderate your speed the wash from a fast boat can destroy banks and nests e Live mollusks and crustaceans need not be collected as souvenirs dead shells can usually be found
133. re conversant with all the motorhome systems operating instructions and precautions Failure to observe these recommendations or precautions may result in incorrect operation of equipment and subsequent risk to occupants Information leaflets and literature on safe operation of appliances and equipment fitted to your motorhome are included in the Auto Sleeper Customer Pack Please read these carefully prior to use Should you experience any difficulties contact your dealer who will be pleased to offer advise It is the policy of Peugeot and Auto Sleeper to continually improve their vehicles so whilst the details contained in this Handbook are correct at the time of going to press they reserve the right to alter the specifications at any time without notice Auto Sleeper motorhomes offer a variety of customer uses and whilst each vehicle features the optimum storage fluid seating and sleeping capabilities it is the customer s responsibility to select the proper combinations of loads without exceeding weight capacities Your Auto Sleeper motorhome conforms to the European standard of EN 1646 Model This Handbook covers the Peugeot Windrush based on Peugeot Boxer 335 L3 H2 long wheelbase high roof window van Gas System The gas system is designed to operate on LPG stored in a re fillable tank fitted under the vehicle The regulator has a working pressure of 30 mbar Conversion Type Panel van conversion w
134. rrect Polarity Locate the Reverse polarity indicator on the PSU and ensure that the indicator is NOT illuminated If the indicator is illuminated see section 3 10 Check operation of equipment It is now safe to operate the 12v and 230v equipment A CONNECTION OF SERVICES aly 2 4 EC480 Digital Control Panel Colour graphic display O O FEl cts z 2 5 Control Panel Operation EC480 Button Description Power Button Press the power button to turn the leisure power on Press the button again to turn the power off The adjacent LED will illuminate when the power is on and also the voltage of the selected battery will be displayed on the screen This button is also present on the PSU unit so this feature can also be operated from the PSU Pump Button With the power on press the pump button to turn the water pump on Press the button again to turn the pump off The adjacent LED will illuminate when the pump is on and also the level of the water tank will be displayed on the screen This button is also present on the PSU unit so this feature can also be operated from the PSU Light Button With the power on press the light button to turn the main internal lighting on Press the button again to turn the lights off The adjacent LED will illuminate when the lights are on The lights will be turned on and off automatically each time the power button is operated This button is also present on the PSU unit so
135. s be used Disposable napkins and similar bulky items must not be put into chemical closet emptying points but should be wrapped in a polythene bag and placed in the container provided Put all litter in containers marked for the purpose Noise e Do not make excessive noise e Children should be restrained from making excessive noise Flying kites and model aircraft and the use of items like catapults or air guns as well as ball games should not be permitted among or close to motorhomes e Musical instruments record players radios and televisions should not be used to the inconvenience of other people on site Open and close doors quietly e Power generators must be adequately silenced and used with consideration Dogs and Pets e All dogs and other pets should be kept under control Unless permission has been granted no animal should be allowed loose on the site and leads must not exceed 1 Oft No animal should be allowed in the shower toilet blocks Do not let dogs foul the site Fire Precautions Adhere to and make note of all fire precautions concerning the whereabouts of the fire points Although not compulsory it is recommended that a 1 kg 2lb dry powder fire extinguisher is carried It should comply with BS 5423 and be marked BSI or FOC approved It is important to check at regular intervals that the extinguisher is working as is required by types meeting BS 5423 Careful
136. s Assocation SECTION 11 VENTILATION High Level Check all high level ventilators including roof lights are free from obstruction and allow a free flow of air Low Level Check all low level ventilators are free from obstructions and allow a free flow of air If the ventilator is manually adjustable then ensure the mechanism is free and operating correctly A SERVICE DETAILS AUTO SLEEPERS SERVICE CENTRE ANNUAL HABITATION CHECK Introduction It is recommended that every 12 months the habitation side of your motorhome is inspected by qualified technicians Attached to this brief is a list of all the points that are checked A few customers are of the belief that this check includes rectification of faults It is stressed that this is not the case the annual service is a check only of the habitation aspect of the motorhome If faults are found the technician will advise you the customer of the fault and the recommended course of action to resolve this Servicing is not included in this check All facilities are run and tested through their operational envelope For example the flame propagation on the refrigerator and other main gas appliances where visible is checked If the flame is burning a wrong colour or burning too far from the jet we again advise you the customer as to how this should be rectified We also recommend and are only too happy to arrange for the refrigerator of your Auto Sleep
137. s inlet flexible supply cable and its limits are shown on page 7 12 1 Before connecting the motorhome installation to the mains supply check that the mains supply is suitable for your installation and appliances i e whether it is a c or d c and whether it is at the correct voltage and frequency a b your installation will be properly earthed Never accept a supply from a socket outlet or plug having only two pins or from a lighting outlet and any residual current device earth leakage circuit breaker in the mains supply to the motorhome has been tested within the last month c In case of doubt consult the site owner or his agent 2 MAKE SURE THAT THE SWITCHAT THE SITE SUPPLY POINT IS OFF 3 Lift the cover of the electricity inlet provided on the motorhome and insert the connector of the supply flexible cable 4 Remove any cover from the socket outlet provided at the site supply point and connect the plug at the other end of the supply flexible cable to this Switch on the main switch at the site supply point Note Use mains cable fully uncoiled and protect from traffic Caution Be aware that the 12V appliances except the refrigerator will not operate whilst the ignition is switched on and the vehicle engine running The master switch on the electrical control panel controls the 12 volt supply Aly Ae IT IS IMPORTANT THAT THE MAIN SWITCH AT THE SITE SUPPLY POIN
138. s steadily on or off i e does not flash approximately once every 45 seconds when the unit it not in alarm Try the following 1 Inspect for obvious damage 2 Visually check that unit contains recommended battery type 3 Check that battery is properly connected 4 Gently vacuum as recommended above 5 Replace battery If these procedures do not correct the problem do NOT attempt repairs Contact the manufacturer T A Fire Angel CO 808 battery operated alarm is fitted near the ceiling on the wardrobe side panel Carbon Monoxide Alarm Features e An advanced electrochemical sensor designed to accurately measure low levels of carbon monixide CO providing an early warning of toxic CO levels in your motorhome e Detects carbon monoxide continuously e Resistant to false alarms caused by normal household contaminants Sounds a loud 85dB alarm at 3 metres 10 feet to alert you in case of an emergency Test Reset button e Simple to mount portable ideal for travelling e Conforms to the British Standards Institute CSI Carbon Monoxide Standard BS7860 1996 Five year limited warranty batteries excluded Operating Features Your FireAngel detector offers many features which set it apart from other CO detectors on the market today Test Reset Button Feature This button will e Test your horn battery and circuitry Silence the loud 85dB at 3 metres 1 Oft horn during an
139. se between the battery and the electrical harness and is usually located immediately outside the battery compartment or within 500mm of the battery The maximum rating of this fuse is 20A per battery If a single battery is fitted to a motorhome this fuse may be increased to 30A however if two batteries are fitted each battery should be fused at a maximum of 20A 3 5 2 Installation amp Removal Always disconnect the 230v mains supply and turn the PSU green charger switch to the off position button out before removing or installing the battery 7 17 A CONNECTION OF SERVICES AN When connecting the battery ensure that the correct polarity is observed black is negative and red is positive and that the terminals are securely fastened Crocodile clips must not be used WARNING Explosive gases may be present at the battery Take care to prevent flames and sparks in the vicinity of the battery and do not smoke 3 5 3 Operation Servicing Under normal circumstances it should not be necessary to remove the battery other than for routine inspection of the terminals and topping up of the battery fluid where applicable Please see instructions supplied with the battery Note Do not over discharge the battery One of the most common causes of battery failure is when the battery is discharged below the recommended level of approximately 10v Discharging a battery below this figure can cause permanent damage to one or more of
140. section Check that the refrigerator is on a level surface e Check that there is an available energy source Possible cause Action you can take Refrigerator will not work on gas Gas bottle is empty Replace the gas bottle Valve of the gas bottle or one of Open the valves a on Refrigerator will not work on 12V DC Refrigerator will not refrigerate Insufficient ventilation Check whether the ventilation sufficiently grills are covered Thermostat set too low Increase the setting of the meme tem Too much ice on the condenser Check that the door shuts k aW s Too much food stored Let the food cool off first sma Technical data DOC GS tres uu p aa a Saa Sua a aS hassan hassan aus A Gross volume incl freezer a a 81 litres Freezer compartment capacity gieanmacenes 10 litres Electricity consumption 24 hr 2 5kW average at 25 C ambient Gas consumption 24 hr 0 30 kg average at 25 C ambient 9 20 A FITTED EQUIPMENT THETFORD CASSETTE C200CS TOILET Introduction The toilet is made up of two parts a permanently fixed toilet and a waste tank that is accessible from the outside The removable waste tank is located under the toilet and can be removed via an access door on the outside of the motorho
141. sed and flush the toilet by pressing the flush button Close the toilet valve after flushing Note Do not leave water in the bowl if the toilet is not being used This does not help to reduce unpleasant smells and only leads to flooding WARNING Do not travel with water in the flush tank of your toilet Failure to adhere to this notice may result in water damage to your motorhome Emptying The waste tank has a capacity of 17 litres and must be emptied at the latest when the warning lamp is lit It is advisable to empty the waste tank earlier The warning lamp illuminates when the waste tank contains in excess of 15 litres This indicates that a capacity of 2 litres is left which will allow approximately five uses Note Do not allow the waste tank to become too full 11 Make sure that the valve blade is closed Open the access door located outside the vehicle Pull the safety catch upwards and remove the waste tank 12 Carry the tank by the handles to a normal toilet or to a legal waste disposal site Place the waste tank upright on the ground and turn the emptying spout upwards 13 Remove the emptying spout cap Hold the waste tank by the upper handle nearest to the emptying spout Hold the rear handle with your other hand so that you can operate the vent plunger with your thumb Keep the vent plunger pressed in to ensure the tank is emptied without splashing Note The vent plunger should only be pressed once
142. sides to open the door in an emergency SECTION 4 ATTACHMENTS TO CHASSIS OR UNDERBODY Corner Steadies Check that attachments to chassis are secure Ensure steadies work freely and satisfactorily Lubricate screw to ensure correct operation Folding Retractable Steps Check that step pivots are satisfactory and not worn Check that when closed the retaining mechanism holds the step securely If fitted check device is working Underfloor Water Tank Mountings Check mounting frames are secure to body Any fastenings that require releasing to remove the tank should be free of rust and operate freely Removal flushing cleaning and replacing of tanks will be carried out at the prior request of the customer or will be done subsequently with other work Spare Wheel Remove spare wheel Check for damage Check typre pressure Check mounting frame for security to body and for secure retention of spare wheel Wheel Boxes Check for damage corrosion water seepage signs of tyre scrubbing SECTION 5 ATTACHMENTS TO BODY EXTERIOR Roof Lights Check security general condition and that sealing has not deteriorated Roof Racks and Ladders Check security to body and general condition Check roof for damage adjacent to rack Mouldings Trims Check security Check sealing has not deteriorated Flue Terminals Air Vents Check security Check sealing has not deteriorated Check that these are no
143. st cases it is still safe to use the generator but please consult the generator handbook for further information Control Panel Control Panel has no Backlight illumination may have switched off Press the select problems display button to reactivate the backlight Check batteries and fuses turn PSU shutdown switch and charger switch on and ensure mains supply is connected Check control panel connecting lead at PSU and behind Control Panel Contact your Dealer 12V power turns off Battery protect feature has operated to protect the Vehicle battery and or the Leisure battery See 3 5 3 Engine has been started all equipment has been disconnected to meet EMC requirements See 2 7 Control Panel locked Observe control panel handling instructions erratic function Control panel software may have crashed Reboot control panel by turning off the PSU isolate switch Wait 30 seconds then turn the switch back on No 12 volt output No 230V supply Check all above from PSU Charger not switched on Turn charger switch on switch will illuminate Battery not connected Install charged battery as per 3 5 and or charged Continued next page 1 22 CONNECTION OF SERVICES fl X 3 14 Common Fault Table continued Fat Possible Cause Proposed Fix No 12 volt output Power button on control Turn power on at control panel from PSU panel not switched to on continued Battery flat Battery fuse Recharge battery check fuses check c
144. t blocked SECTION 6 INTERNAL Body Seepage Check Examine for moisture water staining of areas under windows at side of roof and at corners which could indicate water seepage problems A moisture meter should be used where appropriate Furniture Check furniture is securely fixed Check door hinges catches and stays for satisfactory operation Dinette Seats Beds Check seat bases for security of fixings and for damage Make up beds according to manufacturer s instructions and check for rigidity and safety A SERVICE DETAILS Upper Bunks Check there is a secure means of access to upper bunks and that where applicable protection against falling out and entrapment is provided Curtains Blinds Nets Check track is secure and curtains draw freely without snagging Check blinds and or nets for correct operation Check flyscreens in roof lights and air vents Cab Seats Where cab seats form part of the living area and or bed layout they should be checked for security of attachment smooth and easy operation of seat slides swivels and seat back operation Fire Extinguisher Check condition and expiry date If an extinguisher is not fitted inform the customer of the advisability of such equipment Fire Blanket Check position Should be near cooker If one is not present inform the customer of the advisability of such equipment Advice to Occupiers Warning Notice Check presence and condition and ad
145. te tank outlet tap In this case it will be necessary to drop the tank for cleaning Access is through a large diameter fitting in the tank top Once removed this will allow the tank to be flushed out in an inverted position and all solids removed 10 3 WINTERISATION General This section contains information on the winterisation of your Auto Sleeper particularly when you may wish to lay up your vehicle for the winter months Water System The water system should be fully emptied by opening the drain valve located adjacent to the water heater see heater section for more details and the drain taps on both the fresh water tank and waste water tank left in the open position Likewise all internal taps should be left open and the water pump run until the last traces of water have come out of the taps Purely as a precaution against very severe freezing conditions the water filter that is attached to the water pump on the outlet side should be removed and cleared of all water In doing so it will give you the opportunity of cleaning it if necessary ready for the coming season Remove all sink plugs to allow the water system to breathe Flush fully the waste water tank to remove any excess debris and waste material Flush through again with disinfectant as part of the final drain Leave drain tap open Upholstery We advise that any detachable upholstery is removed and taken indoors during prolonged winter storage
146. the meaning of any of them you should contact your supplying Auto Sleeper dealer Please read the following carefully In the interests of safety replacement parts for appliances should conform to the appliance manufacturer s specification and should be fitted by them or their authorised agent WARNINGS 1 Never use portable cooking or heating equipment other than electric heaters that are not of the direct radiant type as it is a fire and asphyxiation hazard 2 Do not use cookers as heaters or dry clothes etc on the cooker or space heater 3 Make sure that combustible materials can not come into contact with hot surfaces or burners 4 Surfaces of appliances may become hot in use and the guard provided does not give full protection to the young and elderly 5 Do not use additional independent gas appliances inside the vehicle 6 Never allow modifications of electrical or LPG systems or appliances except by qualified technicians The water heater fitted to this vehicle is of the room sealed type any replacement should be the same i e room sealed Turn off all gas equipment and cylinders tanks and any other heating appliances before travelling Ventilation openings are located below all the gas appliances and in the base of the gas locker In winter conditions make sure the vents are clear of snow and mud These openings should be regularly checked and any mesh covering them cleaned with a s
147. tiff brush to prevent any risk of them becoming blocked The openings are provided for your safety please do not obstruct them Air Bags Do not fit rear facing children s seats to front facing seat protected by air bags It is recommended that small children do not sit in the front passenger seat whilst the vehicle is in motion Follow the advice given in your base vehicle instruction book A SAFETY amp SECURITY Smoke Alarm Features e Battery operated Operating light LED flashes approximately every 45 seconds confirming unit is powered Low battery warning Unit beeps approximately every 45 seconds for up to 30 days when the battery needs replacing Sensitivity test button Tests sensitivity circuitry battery horn and emergency light model 350 only e Loud 85 decibel Piezo electric alarm Automatically resets when hazardous condition has passed WARNING Test smoke alarm operation after vehicle has been in storage before each trip and at least once per week during use Your alarm requires one 9 volt battery Under normal use the battery should last approximately one year Simple maintenance Vacuum every six months to help keep the unit working efficiently Open cover and gently vacuum interior of detector Keep vacuum nozzle from touching the unit Problems are indicated by two events 1 The alarm does not sound upon pressing the test button 2 The operating light remain
148. to models fitted with shower or toilet compartment e Top hinged windows are closed and securely fastened e Children do not roam around the vehicle they may fall and injure themselves Front Seat Swivel where fitted Your vehicle may be fitted with a swivel base to either or both of the front seats so that they may be turned to face the rear of the vehicle The release lever coloured red is located at the front of the seat and is pushed downwards to unlock the swivel mechanism Note It may be necessary to lower the handbrake in order to swivel the driver s seat In this case ensure that first gear or PARK on automatic is engaged and the road wheels are chocked first WARNING It is important that while the vehicle is in motion any seat swivels are locked in the forward facing position Map Storage In the rear of each cab seat there is a map pocket for storage of maps periodicals and light items A ARRIVAL AT SITE CHECK SITE REGULATIONS Siting your Motorhome When siting your motorhome keep to the roadways unless otherwise directed Obey the speed limit which in general is 10 mph Only a person in possession of a current driving licence is permitted to drive on the site Stopping distances on grass are considerably greater than on tarmac Selecting a Pitch Carefully select where you wish to park your motorhome The site should be as level as possible well drained and away from boggy ar
149. tyre pressures cab seats internal lights battery and windows in a van conversion The base vehicle must be serviced in accordance with the chassis manufacturer s instructions Reference should also be made to e Any owner s manual or equivalent supplied with the vehicle by the motorhome converter Appliance manufacturer s instructions e Driver s handbook or equivalent supplied by the chassis manufacturer e Avehicle is accepted for service at the dealer s discretion Any defects repairs adjustments cleaning or lubrication required will be noted on the checklist The customer s approval will be obtained before any work is done Not all of the equipment mentioned in this manual is fitted as standard to every motorhome This guide is published as an aide de memoire for dealers Any work carried out following the check and the sufficiency of the work in the check itself is subject to the contract between the customer and the dealer SECTION 1 BODY MOUNTING Body to Chassis Examine all fixings retaining the body to the chassis this may be direct or through a sub frame Where practical all fittings should be checked to ensure they are all present and correctly secured Body to Cab Examine joint between body and cab for signs of movement and soundness of sealing media Body Retention dismountables Check serviceability and tightness of body retaining gear Check ser
150. unplug it If electrical polarity indication is not included in your motorhome electrical equipment it is useful to have a means of checking polarity of the mains supply especially when touring overseas There are available several proprietary makes of equipment for testing polarity If it can be achieved it is preferable to connect live to live and neutral to neutral to maintain full electrical protection CONNECTION OF SERVICES LA INI SNIVIN ANOHYOLOW ANY 318V9 ONILOANNOD dO ONIYIM Y 31dNOD 318V9 LA INI SNIVIN ANOHYOLOW MOTISA 8 N3399 MOTIJA 8 N3389 HLYV4 HLYW4 oN TA JAN IWHLNIN a TWHLNIN Imig T Cunan T D 3n3g STVNIIYSL saan 1a LAXIOS STVNIINYAL dO M3lA dO MIA dO MIA dO MJA MOTHA 2 N3389 Hiuv3 7 y0v18 1vulnaN TEB qatu IM YAY ONIYIM G3XI4 MOTISA 9 N3349 HLuv3 3018 aw aa WULNIN o S TVNIINH31 SNId MONJA 8 NID nHiuuv3 anig TvuLnan IEE nmoug aan Gy ONIYIM 3191X314 MOT134 9 N3345 UA EN A WHLNAN fo ex i Wenn yO saan as T3008 T STWNIWUaL dO MJA dO MalA JO A3IA JO MIIA LATLNO AlddNS HO1LId 91 1 WOJ payajoO1d pue pajiooun Ajiny q snw J sn Ul U YM S91 ui Z GZ SI qe2 J lui suieuu u JO u Bu l jeba u L UP1911 29 p jijenb e NSUOD qnop u J p 1ouBi q jsnw Aay weibelp y YIM Suepio52eB UI OU aie SHulysew jeur Ji uAous se 52ex pew Je suono5 uuo5 yeu jeljuassa S 31 ONINYVM 7 11 A
151. utgoing air temperature on the unit has fallen to 40 C or less A FITTED EQUIPMENT Switching off Switch off heater at control panel using rotary switch position o The green LED k goes off Note If the green LED k blinks after switching off then the unit s after running is active in order to reduce the unit s temperature This will end after a few minutes and the green LED k will go off CAUTION Always drain water contents if there is risk of frost If the appliance is not to be used for a prolonged period close the quick acting valve in the gas supply line and turn off the gas cylinder Gas operation fault If a fault occurs during gas operation the red LED r on the control panel illuminates Please consult the troubleshooting list for possible causes A reset fault reset is carried out by switching off waiting until all LED s on the control panel have stopped flashing and then switching the heater on again Note If a window to which a window switch has been fitted is opened the heater stops operating and the red LED r flashes The heater continues operating when the window is closed Electrical operation fault If a fault occurs during electrical operation the yellow indicator lamp g on the power selector switch goes off Possible causes can be found in the troubleshooting list Note If the 230V power supply is interrupted for just a brief period of approximately one seco
152. ve figure current being drawn from the selected battery Positive figure current being used to charge the selected battery Will have no effect if the External pump is already switched on see above Will not operate if the Internal Fresh water tank is showing 100 Full Please note the clock uses a 24 hour cycle Please note the alarm uses a 24 hour cycle The addition of a asterisk 0 in the top left of the main EC325 display indicates that the alarm is set A CONNECTION OF SERVICES 5 EC300 Control Panel continued Display Options Notes Set Event Timer Access to set the event timer Press the select button e to select HOUR ON Use the up down Y buttons to change Press the select button e to select MINUTE ON AA Ay Please note the event timer uses a 24 hour cycle The event timer is used to switch the control panel power on and off in the absence of the user occupier See section 3 12 for further details Use the up down Y buttons to change Press the select button a to select HOUR OFF Use the up down Y buttons to change Press the select button e to select MINUTE OFF Use the up down Y buttons to change Press the select button s8 to exit The addition of a hash in the top right of the main EC300 display indicates that the event timer is set Event Timer Off Shows the event timer status OFF ON and the current
153. viceability of body support struts and mountings Note whether it will be necessary to demount the body to check the body supports must be agreed between dealer and customer SECTION 2 WINDOWS Windows Check window glazing rubber or sealing for cracks and general condition Check for satisfactory operation and closing Check fixing of top hinge rail on top hung windows Check for good weather seal when window is closed and latched Check catches and stays for satisfactory operation SECTION 3 DOORS EXTERNAL DOORS Not including base vehicle doors Security e Check that hinges and catches are satisfactory and that when latched doors are held securely shut e Check that the keys or internal latches lock the doors correctly e Check that any device fitted to hold a door in the open position is satisfactory A SERVICE DETAILS Sealing e Check all door seals for cracking and general condition Check correct closing to give a weather tight seal Childproof Lock Where a door is fitted with a childproof lock check that an appropriate warning notice is fixed adjacent to the door Appropriate warning notices are available from motorhome manufacturers INTERNAL DOORS Security e Check that hinges and catches are satisfactory and that when latched the door is held securely shut Safety e Check that any device fitted to hold a door in the closed position can be operated from both
154. vise customers accordingly The wording and layout of the notice should be set out as follows ADVICE TO USERS VENTILATION Do not obstruct the ventilators which are fitted your safety depends on them IN CASE OF FIRE 1 Get everyone out 2 Turn off outside gas valve and or oil valve if fitted 3 Disconnect the mains electricity supply 4 Raise the alarm and call the fire brigade 5 Tackle fire if safe to do so FIRE PRECAUTIONS Children Do not leave them alone Means of Escape Make sure you know the location and operation of the emergency exits keep all escape routes clear Combustible Materials Keep them clear of all heating and cooking appliances Fire Fighting Provide at least a 1kg power fire extinguisher that complies with BS5423 by the main exit door and a fire blanket next to the cooker Make yourself familiar with the instructions on your fire extinguisher and the fire precaution arrangements on the caravan park Portable or Open Flame Heating Equipment Check for its presence The customer must be advised against its use 12 3 A SERVICE DETAILS SECTION 7 ELEVATING ROOFS Lifting Mechanism Gas struts or spring struts should be checked for corrosion particularly on the piston rods of gas struts smooth operation when operating roof up and down and to ensure that they support the roof when fully up Check attachment points of struts to body and roof Canvas
155. ximum benefit can be obtained from the gas used to heat the oven Care should be taken not to overload the oven adequate spacing being used to allow free circulation for heat Cooking guidelines Best results will be obtained by the shelf positions in this guide please see chart on next page It is not necessary to preheat the oven but advisable for a range of dishes The oven is capable of full temperature in 15 20 minutes Most cookery books give details of the shelf positions and gas mark settings for each recipe If in doubt about a recipe you intend to use study the recipe carefully then find a similar dish in our guide and use our shelf position and gas mark setting recommendation Shelf positions are from the top down When roasting with aluminium foil care must be taken that the foil does not impair circulation or block the oven flue outlet Important Always ensure food is properly cooked prior to serving Do s and Don ts Do read the user instructions carefully before using the appliance for the first time allow the oven to heat before using for the first time in order to expel any smells before the introduction of food clean the appliance regularly Do Do A FITTED EQUIPMENT Do remove spills as soon as they occur Do turn handles away from the front of the cooker so that they cannot be caught accidentally Do always use oven gloves when removing food shelves and trays from the oven Do
156. y when the engine is running Remove any external fresh water connections etc Make sure any heavy articles are stored in accordance with the loading procedure Tables should also be made secure 16 17 18 18 20 21 22 23 24 Lock the motorhome exterior door remember to take out your keys Check your external rear view mirrors and adjust if necessary Check that all corner steadies are wound up and that if a step is used it is put away before moving off Check wheel nuts are secure and tyre pressures are correct Ensure if required that your fresh water tank is full and your waste tank is empty Referring to your base vehicle manual check all fluid levels including automotive fuel and tyre pressures Remember to check that your spare tyre is of the recommended pressure Ensure that on models fitted with an elevating roof the roof is securely locked down with the exterior catches applied The fridge vent covers should be fitted when the vehicle is to be driven in order to comply with European Type Approval regulations for vehicle external projections Ensure that the toilet flush tank only contains a small amount of water 1 2 litres in order to minimise the risk of leaks or spillage whilst the vehicle is in motion Check underneath the vehicle for stray items Safely store levelling blocks away in an appropate place A ON THE ROAD Pulling Off Engage t
157. ywork windows upholstery and other parts of the conversion This maintenance should be carried out as follows Servicing Servicing of the conversion is the responsibility of your local franchised Auto Sleeper dealer to whom all queries should be referred Your local base vehicle commercial dealer should carry out servicing of the base vehicle GLASSFIBRE BODYWORK AND ACRYLIC WINDOWS General Cleaning At regular intervals you should wash the fibreglass bodywork with a recognised cleaner for use on fibreglass gel coats Should marks remain use a cleaner with chemical and abrasion agents formulated for use on gel coats Discolouration Fading or discolouration of the gel coat is a natural ageing process caused by ultraviolet light To overcome this use a mild abrasive which removes a thin layer of the discoloured surface This will restore the bodywork to its original colour and surface lustre Since discolouration develops gradually it should not be necessary to carry out this procedure more than every three years Frequent use of abrasive materials can reduce the thickness of the gel coat to a potentially harmful extent Removing Scratches from Bodywork Scratches can be removed from both gel and painted surfaces The method depends upon the depth of the scratch as care has to be taken to avoid penetrating the paint or gel coat Very fine hairline scratches can be removed by rubbing across the line of the scratc
158. zles are fitted with protective nozzle shields Report to site staff if missing Nozzle shields have been removed from picture for clarity Connecting 1 Hold the hose behind the nozzle and the guard keeping lever pushed forward with the handle at 12 o clock position Locate the nozzle over the lugs on the filler valve and turn the lever a quarter turn clockwise to lock Caution From this moment onwards ensure hands are away from the nozzle barrel GAS SAFETY ADVICE Facts about LPG 2 Pull back lever towards hose and latch into place Ensure lever is latched securely Follow instructions on dispenser to commence dispensing e LPG is not poisonous e LPG has been given a smell by manufacturers in order to identify leaks Bi products of combustion are harmless There is danger if all air and oxygen are excluded therefore ventilation holes must be kept clear at all times PRECAUTIONS Disconnect 3 Ensure hands are away from the nozzle barrel Hold hose behind guard and release lever by pushing forward A small release of gas will occur as you release the lever This is normal 4 Turn lever anti clockwise a quarter turn to release nozzle from vehicle Replace nozzle in holder on dispenser a Never look for a leak with a match Always use a soap solution or its equivalent when testing connections Do not operate any electrical apparatus whatsoever especially light swit

Download Pdf Manuals

image

Related Search

Related Contents

  Manual Porteiro Eletrônico F10/F12  JVC VN-V25U VN-V26U User's Manual  User Manual - MPI Distribution AG  Human HSP60 ELISA Kit  録画・再生について  Consignes relatives au mode d`emploi  Funk-Wetterstation „WS-8035IT“ Radio-Controlled  OS X support essentials 10.9 : [supporting and troubleshooting OS X  ユニバーサルデザインの まちづくりの考え方 第 章  

Copyright © All rights reserved.
Failed to retrieve file