Home

Graybox™ - Trade-UA

1. Connections External Links Graybox Quotes Backup Quotes GB Router Pinay zc zeien EE Secorday pen MA L ronnt Logon Use Logon Server Primary Logon Server EEE TEES Secondary Logon Server PAMPA Logon Server Port 36100 Primary Entitlement Database Secondary Entitlement Database Access Port Layout Curent Layout REES ESEEEEEDEEER Browse e Figure 52 System Configuration Window 3 Configure the server and router settings The Graybox Quotes box must be selected to activate the Graybox quote display For correct settings contact the support group 9 15 Links To link charts from the Graybox in MM windows and in ECN HOLD BROTHERS Success is how fast you get there Graybox User Manual_v3 63 56 e Open charts from the main GrayBox and then open two MM windows with different stocks subsequently eSignal is a charting software which can be linked with Graybox Perform the following steps to link eSignal 1 Right click the Graybox icon and then Click Properties The Graybox Properties window is displayed 2 Click the Compatibility tab and select Run this program as an administrator 3 Click Apply and then click OK 4 Right click the eSignal icon and then Click Properties The eSignal Properties window is displayed Click the Compatibility tab and select Run this program as an administrator Click Apply and then click OK Click the Graybox icon to Lo
2. User Manual_v3 63 72 E D d LH d Zeck dei Jelelebumde TER lag SARE 124 8150 124 8000 1244 7 700 Aug 26 10 15 50 10 16 00 10 16 22 Figure 74 Chart View of a Stock 6 4 1 Interval An interval is a gap between prints to be plotted You can set an interval to Bar and Day charts An Interval can vary from 1 minute to one day based on the type of Chart An Interval cannot be set for Tick Chart Note To set the interval Right Click on chart and Select Interval or use the drop down box option to set interval as shown below in Figure 75 FEE International Business Machine 1 minute Bar Chart ES 5 A d Bees EEE _ Eemi il Z 4 4 5 Days lk Minute 125 6000 125 2000 124 4000 Aug 25 16 03 00 Aug 26 09 39 00 Figure 75 Interval Setting Window HOLD BROTHERS Success is how fast you get there Graybox User Manual v3 63 73 6 4 2 Show Last Along with the interval you can also set the Show Last duration for the chart display To set Show Last Right Click on chart and Select Show Last or use the drop down box option to set Show last option as shown below in Figure 76 e Business Mach 1 minute Bar Char enim x ei LS Sg il FE Eala s 5 Days lk 1 Minute 1 Minute d Minutes 5 Minute 10 Minutes 30 Minutes 1 Hour 4 Hours 125 2000 Today Full Day I 8 me A P Da PLP Pi Aug 25 16 03 00 Figure 76 Show Last Setting Window 6
3. 8 2 2 Supported Internet Connections Cable modem DSL ISDN T1 and T3 Dial up connections are just not fast enough to Support Graybox software Using a Wireless connection is not advised because there might be a latency delay between the wireless router and your PC which will slow the data flow 8 2 3 Graybox Installation amp Configuration Graybox Installer software is available at http support hold com Download the file and double click to install Follow on screen instructions to complete installation Installer will configure the software automatically If you need information on configuration please check Server Configuration link in http support hold com 8 3 Graybox Exchange codes displayed in Prints Destination ID Exchange Name Description A C HOLD BROTHERS Success is how fast you get there Graybox User Manual v3 63 93 8 4 Graybox Symbology Graybox Standard Type Of Symbol max 8 chars XXX Preferred Class A also B T and V Z XXX A Class A also B T and V Z XXX A When Distributed XXX D XXX W Warrants Class A also B T and V Z XXX W A Called Preferred When Distributed XXX D Emerging Company MarketPlace HOLD BROTHERS Success is how fast you get there Graybox User Manual_v3 63 94 Glossary AMEX American Stock Exchange AMEX is a stock exchange situated in New York and was a mutual organization owned by its members BATS BATS is a sto
4. Delta from Market FE Er routing Exchange BEE Figure 28 Trailing Stops Buy Sell and Stop Sell Windows HOLD BROTHERS Success is how fast you get there Graybox User Manual v3 63 36 4 5 Changing a Floating Order An order that is not executed pending is called a floating order and these orders can be changed File Edit View WNew Trading Tools Configuration fae Eo 2 Seo Canes S e ee om Loy pce once Ts Status LTE 0010 E TR STOP Mis Si 100 SE Selected Change to Market Cancel Replace Accept Locate PreLoaded Orders Layout Blotter Boare Basket Keyboard Config Trading Options Setup View Entitlements View About E Figure 29 Changing a floating order Cancel Replace Order ID Order Type Price 3 49 S Quantity 100 cancel Izeg HOLD BROTHERS Success is how fast you get there Graybox User Manual v3 63 37 4 6 Canceling an Order You can cancel unexecuted orders You can cancel orders in different ways cht Graybox Locked File Edit Wiew New Tools Configuration Help Preference Window Cancel MS00 300T Orders ECM Order Cancel All Orders Close Outs All Buy Orders Trailing Stops All sell Orders All For Selected Stock selected Order Sa LOCKED Click To Unlock Figure 30 Canceling orders To cancel an individual order 1 Select the order in the Graybox main active order window 2 Click Cancel Order Or On the Trading men
5. HOLD BROTHERS Success is how fast you get there Graybox User Manual_v3 63 HH International Business Machi I minute Bar Char EALA Today sl Minute Close 124 60 Volume 7200 LAST VOL IBM 7300 10 00 00 E Figure 79 Information Panel 6 4 6 Series Style To set the Series Style Right click on chart window and select Series Style then select the required option See Figure 80 This Dropdown menu consists of the following options o Solid o Dot o Dash Dot International Business Macht 1 minute Line Chart d EA m M P et E li i EI a A Today lk Minute Edit Chart 26 08 2010 Color Settings 10 26 00 i BM 124 70 Chart Type Wolume 3100 Seriesotyle Interval Show Last Studies Data View Trend Line LAST VOL IBM 3100 Horizontal Line Info Panel T yi L ere pk Verge Wraps wd Show Volume Always On Top wd Show Toolbar DEES 15 58 00 Figure 80 Series Style ath HOLD BROTHERS 125 6000 125 2000 tral 1 124 8000 1 es FRR 124 4000 F300 0000 and Solid Dot Dash Dot Te FE Le PULP i 120000 3100 0000 10 26 00 Graybox User Manual v3 63 76 6 4 7 Color Settings You can set the thickness of the chart line background and foreground color of the chart area To set the Color Settings Right click on chart window and select Color Settings from the Market Maker menu See Figure 81 series Pro
6. SR ERAREKRK ae Matte Apply Cancel Show Conflicts Close out keys can be configured as hot keys from the KeyMapConfig window HOLD BROTHERS Success is how fast you get there 22 Graybox User Manual v3 63 23 3 4 Executions Ticker Window The Execution window displays all executions Contra Comm mme emmmer ege ee EE SE ee Figure 14 Execution Ticker window Following are the columns in the Execution Ticker window 3 5 Notifier The Notifier window displays all the system messages that are related to Graybox These include periodic system announcements that are made by the Graybox system administrators When Status of the order is to be checked Right click on the order in Graybox active order window and click on Get Status The status of the order is displayed in Notifier window HOLD BROTHERS Success is how fast you get there Graybox User Manual v3 63 24 Figure 15 Notifier Window Following are the columns in the Notifier window Time when the message is relayed by the administrator Source of the message Detailed message Criticality of the message HOLD BROTHERS Success is how fast you get there Graybox User Manual v3 63 25 4 Order Entry You can make order entries in different ways and in different windows This chapter explains different ways of placing orders and routing them 4 1 Market Maker mini Order Entry wi
7. To customize trading options for Graybox Right click the active order window Select Trading Options from the popup menu The Trading Options window appears as shown in Figure 32 Ma Trading Option Order Qty Default Qty Listed Default Qty OTC Default Display Qty Order Display Mode INET Orders XBOS Orders BATS Orders EDGX Orders EDGA Orders NSXS Orders DTTX Orders CBSX Orders NQPX Orders FLOW Orders BYXX Orders Order Oty ES Order Entry Windows Window style BESSCHEN Pref Quote Style ECN Quote Style Pref Wnd Focus On Listed Wnd Focus On ECN OE Wnd Type Auto Adjust Routing Exchange Show Firm Hedge Position Show Order Qty in MarketMaker Wnd C Follow MM Levels on Price Change C Cancel Retry on Reject C Use Pref Wnd for Listed Show Since Time for Active Orders Use Last Trade Price for Open P amp L C StepSize Based on Market Maker Wmd Show Position in MM Window Auto Close Mode IS C Reset Share Size to Default Qty Manual OE Listed Default Manual OE OTC Default ECN Order Entry Fenn e Positions Dialog Mode Orders in Level2 Wnd TIF Default Time In Force Time In Force In Secs ic IOC Mode FLOW Orders NQPX Orders ARCA Orders BATS Orders INET Orders RASH Orders TRAC Orders XBOS Orders NYSE Orders MILL Orders EDGX Orders EDGA Orders NSXS Orders DTTX Orders CBSX Orders BYXX Orders RASH Routing Mode Listed RASH Routing Mode OTC
8. Figure 86 Chart Studies SMA Settings HOLD BROTHERS Success is how fast you get there Graybox User Manual v3 63 79 Once the Settings are chosen click Apply A chart with Simple Moving Average value and pattern will be displayed See Figure 87 m EI minute Bar Char Les CHE x el og Ji EI ah Hour 1 Minute STRIPE EON HG AVERAGE 24 0693 24 2000 24 1800 24 1600 24 1400 24 1200 24 1000 24 0600 mF a vaca AA KIRKI 4 sug 26 09 56 00 10 21 00 10 47 00 k m Figure 87 Chart Studies SMA 6 4 11 2 Multiple Studies Similarly you can choose multiple studies for Technical analysis Simply choose the required study from the Studies dialog box and click on Add Indicator See Figure 88 You can also choose multiple settings of the same study for technical analysis 8 A Q Microsoft Corporation 1 minute Candle Chai a D Si Ce vi wk Ea a 5 Days v 1 Minute SIMPLE MOVING AVERAGE 24 0721 BOLLINGER BANDS 24 0724 BOLLINGER BANDS TOP 24 0985 BOLLINGER BANDS BOTTOM 24 0458 o bhi 24 1800 24 1200 ZA DCD ad ON STOCHASTIC MOMENTUM INDEX D 161 9676 STOCHA STIE MOMENTUM INDEX K 95 3263 2250 0000 1500 0000 750 0000 Ki Aug 26 10 02 00 10 12 00 10 22 00 10 32 00 10 42 00 10 52 00 Figure 88 Chart Studies Multiple Studies ath HOLD BROTHERS Graybox User Manual v3 63 80 6 4 11 3 Merge Charts Merg
9. Order Display Mode INET Orders BOS Orders BATS Orders EDGX Orders EDGA Orders NSMS Orders DTTX Orders CBSX Orders NOFX Orders FLOW Orders BYXX Orders Figure 34 Order Display Mode Box e Normal All orders going to an ECN are marked as Normal and they are shown on the NASDAQ Level 2 display as well as the ECN book However Normal orders cannot lock or cross the market If you attempt to do this the order is rejected e Automatic Graybox detects the orders that can potentially lock or cross the market and sends them out as Subscriber Only All other orders go out as Normal e Hidden The SNET preference box allows you to send hidden orders to Island by selecting the Hide check box on the preference box The order is not visible on Level 2 or the Island book 5 1 1 2 Market Maker Settings You can make different settings for your MMaker window here Show Firm Hedge Position Show Order Oty in MarketMaker Wind C Follow MM Levels on Price Change C Cancel Retry on Reject C Use SNET Pref Wnd for Listed Show Since Timer for Active Orders Use Last Trade Price for Open P amp L C StepSize Based on Market Maker Wind Show Position in MM Window Figure 35 Market Maker Settings Box Show Firm Hedge Position shows the number of traders trading from a firm HOLD BROTHERS Success is how fast you get there Graybox User Manual v3 63 41 Cancel Retry on Reject See Market Maker S
10. Routing exchanges and routing modes are displayed in the Destination Exchange drop down menu to help you in fast trading You can customize the routing order buttons displayed on the Order Entry window To rearrange the routing order buttons in the Order Entry widow 1 2 Right click Market Maker window Select Setup gt Order Entry Window gt Order Buttons The Routing Order Buttons window appears HOLD BROTHERS Success is how fast you get there Graybox User Manual_v3 63 30 Column Headers Selected HOOT 1 Figure 20 Routing order buttons 3 Select the required routing order buttons from Column Headers list Functions of the order buttons are as follows gt To move the selected routing order button from the Column Header list to the Selected list lt To move the selected routing order button from the Selected list to the Column Header list gt gt To move all the routing order buttons from the Column Header list to the Selected list lt lt To move all the routing order buttons from the Selected list to the Column Header list Up To move up the list Down To move down the list 4 Click OK 4 1 10 Cancel All open orders All orders for a selected stock in market maker window can be cancelled using the Cancel All button x in miniOE window 4 2 ECN Order Entry Windows ECN orders can be launched using individual ECN or using shortcut keystrokes Keystrokes for launching
11. Default SDOT Use NYSE HBES Routing Default AMEX Use Default BBSS Use ARCA Routing Mode EDGA Routing Mode EDGA Routing Style EDGX Routing Mode EDGX Routing Style BATS Routing Mode CSFB Routing Mode NSXS Routing Mode DTTX Routing Mode CBSX Routing Mode il FLOW Routing Mode BYXX Routing Mode Display Size Defaults ECN NQPX Orders FLOW Orders ARCA Orders BATS Orders TRAC Orders XBOS Orders RASH Orders MILL Orders EDGX Orders EDGA Orders NYSE Orders NSXS Orders DTTX Orders CBSX Orders BYXX Orders Scroll Max DEER vin FE Default Oty Per Stock Allow Different Qty for each MM Window Remove C Auto Insert Default Optimization aa Display Refresh Rate a oe reek een Book Optimzation Depth E Est Commision Rate 1000 Shares E MM Order Entry Display EEA Esignal Linking ECH Vax Conplance Mode EET Active Orders Sort Cle M Mouse Scroll Function Pie B Figure 32 Trading Options Window HOLD BROTHERS Success is how fast you get there Graybox User Manual_v3 63 40 5 1 1 Default Quantity You can set your default share quantity for Listed OTC stocks here The Listed OTC stocks carry the set quantity to the default every time a new stock is typed Default Oty Listed eL unn crc SS ER TR Figure 33 Default Quantity Box 5 1 1 1 Order Display Mode You can set your order display mode by using this option There are three types of order display modes Automatic Normal and Hidden
12. a dialog box appears with the message You must either change the other keystroke first so there is no conflict or disable the current keystroke To disable a function in the keystroke configuration table double click in the Disabled column It is a good idea to disable any keystrokes that you do not use especially if you are a new trader You can return to the default key mappings at any time To return click the Set Default button This deletes all the keyboard shortcuts that you defined 5 8 Trailing Stop Order You can set up the trailing stop orders for your trades For more information on trailing stops refer to Trailing Stops Buy Sell_4 4 To set Trailing Stops right click on the main Graybox window gt Setup gt Trailing Trailing Stop Window Defaults Direct Trailing Stop Hot Key Auto Trigger Trailing Stop on Entering Positions Cancel Figure 48 Trailing Stops Setup Window You can define appropriate Trailing Stops from the Trailing Stop window Defaults frame You can define Trigger order from the Trigger Based On dropdown menu The menu consists of Last print bid ask and Print Primary Exch Then you define the Trailing Stop Use from the drop down menu The menu consists of Stop Price Delta from Market and from Market You can also define the Trailing Stops through Direct Trailing Stop Hot Key frame You can select Direct Trailing Stop Hot Key from the drop down menu The menu consists
13. 221 446 Q Microsoft Corporation 25 89 Load from File 133 685 Q Ness Technologies I 7 68 Save Symbols to File 30 895 795 G PowerShares QQQ T 53 86 Save Data to File Clear Reload Use As Trading Basket Setup Columns Open MarketMaker Window Ee General Load from Analytics E d Show Title vV Always on Top Figure 91 GrayBox BoardView Window 6 5 1 Adding Symbols You can add stock symbols from the BoardView You can add as many symbols as required Type in the symbol number e Press ENTER and then type in another symbol The typed symbols are added to the BoardView To add symbols e Right Click the BoardView window Click on Symbols See Figure 92 Add required Symbols Click OK Board View after adding the symbols appears as shown in Figure 92 37 1 204 524 Agilent Technologies Inc C 1 292 991 Barnes Group Inc Commo 30919 179 761 776 Citigroup Inc Common Stock 3 1 679 375 Dominion Resources Inc 14 231 009 ENI S p A Common Stock 285 31 126 091 Ford Motor Company Com 6 128 875 Genpact Limited Common 3 114 645 Hyatt Hotels Corporation Cla Symbols in BoardView can be dragged and dropped to Market Maker window Market Maker window will show the dropped symbol HOLD BROTHERS Success is how fast you get there Graybox User Manual v3 63 82 6 5 2 Imbalances Imbalances of the symbol can be displayed in board view by selected the Imbalance columns
14. 4 10 Draw Horizontal Lines You can draw Horizontal lines over the chart to indicate highs and lows To draw a Horizontal line Right click on chart window and select Horizontal Line See Figure 84 E TSce Edit Chart Color Settings Chart Type SeriesStyle Interval Show Last Studies Data View Trend Line Horizontal Line Info Panel Remove Remove All Merge Graphs Show Volume vd Always On Top Ww Show Toolbar 10 39 00 Figure 84 Draw Horizontal Line HOLD BROTHERS Success is how fast you get there Graybox User Manual_v3 63 78 6 4 11 Studies You can do technical analysis of charts by using the studies option To select Studies Right click on chart window and select Studies or click on Studies Icon See Figure 85 ar Mining Average Z Weighted M man Average Figure 85 Chart Studies Selection The Studies options available are Simple Moving Average Exponential Moving Average Weighted Moving Average Momentum Oscillator MACD Bollinger Bands Relative Strength Index Stochastic Oscillator Stochastic Momentum Index MACD Histogram 6 4 11 1 Selecting a Study SMA After selecting Studies you can choose Simple Moving Average and click Add Indicator The Simple Moving Average will be added to the list and a settings dialog for the study Simple Moving Average will be displayed See Figure 86 MSFT CLOSE r 4
15. 61 Market Maker Window for Sort amp Round Quotes HOLD BROTHERS Success is how fast you get there Graybox User Manual v3 63 64 6 1 2 5 Order Buttons in the Order Entry Window You can customize column headers in the order entry window of the Market Maker This enables you to view the orders of selected ECNs as you prioritize them To customize 1 Right click the market maker window select Setup gt OrderEntry Window gt Order Buttons The Order Buttons window is displayed See Figure 62 Se Column Headers Selected HDOT n gt z gt gt lt Up Down Cancel Figure 62 Order Buttons Window 2 Select the required headers and move to Column Headers 6 1 3 Prints You can set the Prints area of Market Maker window To set the Prints area Select Setup gt Prints in the Market Maker menu See Figure 63 Sort Round Quotes V Hi Lite MarketMaker lgnore Market Makers Configure ECN Books Setup Level Display Levell Quotes b Order Entry Window Mini Order Entry Open Yahoo Finance Set as Default vd Enable Def Qty Override Prints Filter vd Always On Top Poni vd Show Time Lol ai vd Show Exchange ID ESignal Link Scheme Change Order ESignal Link Type Figure 63 Market Maker Menu Window You can enable disable Show Time Show Exchange Id and Change Order This Shows the time and exchange Id in the Prints area
16. Click Add You can also define the step size by which the price should be incremented For each stock different quantity can be set To delete any stock from the list e Select the stock and click Remove The Default Quantity settings for the stock stands removed This setting is applicable to all order entry window Market maker order entry window Mini OE window Listed Trading window ECN order entry window and the Preference window This setting is saved to the local layout not saved as a roaming profile 5 1 9 Optimization You can change the display refresh rate and the book optimization depth here HOLD BROTHERS Success is how fast you get there Graybox User Manual v3 63 45 Optimization 400 Display Refresh Rate 1 p Book Optimzation Depth H Figure 42 Optimization box 5 1 10 Other Settings You can make other settings such as Estimated Commission Rate MM Order Entry Display eSignal charting software and Max Compliance Mode here This option enables you to view your approximate profit loss in the position monitor This can be linked with Graybox in this option You can set Active Order Sort either in Descending or Ascending order You can set Mouse scroll Function to Symbol Price Quantity as per your trading choice Est Commision Rate 1000 Shares UN MM Order Entry Display Never B ESignal Linking e Max Compliance Mode Block New Covers Active Orders Sort SEENEN Mous
17. Smart Order Iteration Delta from Inside Hu o Send to ECNs Before Using Pref List if ECN in inside mkt EEE of tot ER cn GEE orto NONE Ey of Total jo Smart Order Auto Cover e aks OK Cancel Keymap Configura tior Graybox Window MarketMaker Window Pref Listed Trading Wind SubGroup Function key Shift ctrl Let Disabled 5E D Prim Exch Delta Send NSDQ SDOT Delta Short Setting 4 T 3E D Prim Exch Delta Send NSDQ NYSE T Delta Short Setting 1 J Smart Order Buy BK Smart Order Sell SK Smart Order Short Sell ER JS o Dynamic Smart Order Buy E E LH ae Dynamic Smart Order Short Sell P Swipe Swipe Buy yy Swipe a Swipe Swipe Buy 2 SE Swipe a Swipe Swipe Buy 3 Dee Swipe x Swipe Swipe Buy 4 t Swipe Swipe Sell 4 Pde de ded eed sel sel se sel sel se d Sends a Dynamic Smart Order Buy See Manual For Details e Regular keyBoard E E Pause ieee 2 alles Sn aps 2 Pie poon DONAA Undo All Apply Cancel Show Conflicts Figure 44 Smart Orders Setup Window 4 Type the four letter market maker or ECN symbol in the top field HOLD BROTHERS Success is how fast you get there Graybox User Manual v3 63 47 5 Click the Add button or hit the Enter key The ECN or market maker appears in the routing list Repeat steps 4 and 5 for each market maker and ECN that you want to include To change the order of a symbol in the list e Selec
18. clicking on the Open Yahoo Finance link on the settings menu A keyboard shortcut key can also be defined from the Keyboard Configuration settings for quick access This will open the Yahoo Finance page with the active symbol 6 1 1 Level 1 Display This section explains Level 1 display of Market Maker 6 1 1 1 Use Primary Exchange for Last Price You can use primary exchange for last price in the Market Maker To set primary exchange HOLD BROTHERS Success is how fast you get there Graybox User Manual v3 63 61 e Right click in the Market Maker window select Setup gt Level1Quotes gt Use Primary Exchange for Last Price View Sort t Round Quotes Hi Lite MarketMaker lgnore Market Makers Configure ECN Books Setup b Level Display PYI OTe a Q i EN Tene ee ee Levell Quotes Configure Levell Iterns Order Entry Window Use Primary Exch for Last Price SETELIT Mini Order Entry v Enable Def Qty Override Prini 7 v Always On Top Font 5 Colors ESignal Link Scheme ESignal Link Type Figure 57 Market Maker Window for Level 1 Display 6 1 2 Level 2 Display This section explains Level 2 display of Market Maker 6 1 2 1 Changing Display of ECN Books ECN books shown in the Market Maker window can be either Inside Market or full market You can change the display of ECN books To change the display of ECN books e From the Market Maker menu Select ECN Books then selec
19. current status of the connection between Graybox and ECNs Tool Bar shows or hides the tools buttons at the top of the Graybox active order window Title shows or hides the title on the Graybox active order winndow Always on Top This option sets the current window to display always on top of other window 2 Select the options that must be displayed Always on Top amp turning on off the title menu status and tool bar option is available in most of the Graybox windows like Positions monitor Market Clock Execution ticker Notifier window Hedges amp Locates monitor 5 10 Mini OE Setup To access Mini OE setup right click on the Graybox active order window from setup menu miniOE setup can be accessed 1 You can set the options in Default ECN s to be displayed in mini OE window 2 Enable Disable options for Enable Point and Click to set price Enable enter key to set order and Enable Double click to Send order 3 To create and edit mini OE short cut send order buttons To create a button select a destination select a price and choose a buy or sell action then click create A new button will be created at the bottom of the miniOE window with the selected options Clicking on this button will send order for the selected stock HOLD BROTHERS Success is how fast you get there Graybox User Manual v3 63 Default ECNs Defaults Enable Point amp Click to Set Price Enable E
20. from the Active Orders window and shown in the Messages window Graybox on logging on to the system can figure out the status of floating orders from the previous session linked to a user id For more details on the status of an order double click the order to see the Order Details window 3 1 1 Order Details Window The Order Details window displays order details To view order details double click the order in the Active order window The Order details can be got from Messages window too Your order details are displayed as shown in Figure 7 All orders that are entered are displayed in the Order Details window until these orders are cancelled expired or executed When there is no order this is disabled ew Order Details Sequence Order Type Side Symbol Quantity Qty Left Limit Price Time N Conf Time i Exchange Line Index Contra Stop Price Reference Message Status Display Mode Time In Force Figure 7 Order details HOLD BROTHERS Success is how fast you get there Graybox User Manual v3 63 17 3 2 Messages Window The Messages window displays messages related to orders Separate views are available for all message execution and cancellation orders for the day ie Messages All Exec Figure 8 Messages window This window shows all orders that have been executed cancelled user trashed or rejected and hence no longer active When there is no
21. least 7 characters long A and must contain at least one numeric Hote 4 Click OK HOLD BROTHERS Success is how fast you get there Graybox User Manual_v3 63 14 2 5 User Entitlements To view user entitlement Right click on Graybox main window and click View Entitlement the following entitlements are available for the user e Buying Power Displays the buying power you are entitled to e Floating Exposure Limit Displays your floating exposure limit over and above the Buying power e Max Order Size Displays the maximum size per order e Max Position Per Stock Displays the maximum positions that the user can take per stock e Max Number of Positions Displays the maximum positions available to you e Stock Price Limit Displays the Stock Price Limit e Stop Loss Displays your Stop Loss Limit e Force CloseOut Loss Limit Displays where the Force CloseOut triggers over and above the Stop Loss limit User Entitlements Login ID Buying Power Market Hours Pre amp Post Market Floating Exposure Limit Market Hours o Pre amp Post Market o Max Position Per Stock Max Number of Positions Im Stack Price Limit Share Count Limit Stop Loss Force Closeout Loss Limit EE Positive Block Threshold RE Positive Block Delta cn Max Order Size 10000 Buying Power Concentration Per Stock Market Hours a 100 Pre amp Post Market 9 100 Figure 5 User Entitlements windo
22. the close out positions Right click on main window gt Setup gt Close Out Keys Close Out Keys Setup box appears See Figure 13 To close trading all open stocks e Right click the Position window and then click the required Close Out option HOLD BROTHERS Success is how fast you get there Graybox User Manual v3 63 Close Out Key 1 Close Out Percentage Clase Out Mode Close Out Use Close Out Key 2 Close Out Percentage Clase Out Mode Close Out Use Close Out Key 3 Close Out Percentage Clase Out Mode Clase Out Use Close Out Key 4 Close Out Percentage Close Out Mode Close Out Use Graybox Window MarketMaker Window Pref Listed Trading Wd SubGroup shift Disabled Cancel Oldest SellSelectedStock T T TS Cancel Oldest Order TI TS Position Close Out Keyi JA o S e C O Position Close QutKey3 o nections Reconnect All Servers IT y ections Reconnect Marke Data Servers Position Close Out Key 4 een Sa Position Close Out Key 1 for Selected S F4 Position Close Out Key 2 for Selected S F6 Position Close Out Key 4 for Selected 5 lr CSFB XFinder Buy Entry CSFB XFinder Sell Entry _CSFB XFinder Short Sell Entry Col Cancel Oldest Buy Selected Stock es ee Es et eo ec ee et eS oe Position Clase Out Key 3 for Selected Stock Regular KeyBoard Print Scroll Pause Si IR E P Fo nie EC ice E i e E E Fage
23. to the key functions and enable them Hote 5 7 Setting Up Keyboard Shortcuts In this version of Graybox the Keystrokes are divided into three lists e Keystrokes for the Graybox main window e Keystrokes for the Market Maker window e Keystrokes for the Preference and Listed Trading window Regular KeyBoard r e Rlelele oer BIS ISS CIE CIS l Sleieieleleieleldele SS lslsl ielelsizlelVlt 1 Less Wl e lelelelelel 1 d i Figure 47 Key Map Configuration Window Refer to Figure 47 above All keys that are currently in use are in blue The key combinations for the different functions are in yellow When you highlight a function the keystroke is highlighted in yellow For example when you highlight Cancel All Buy Orders the keystroke Alt F12 gets highlighted in the Regular Keyboard To customize the keystroke perform the following steps HOLD BROTHERS Success is how fast you get there Graybox User Manual v3 63 51 1 Select the function for which to customize the keystroke 2 Inthe Key column click the existing keystroke For example in the Pop up window click the keystroke F12 which relates to the function Cancel All Buy Orders The F12 key in the Regular KeyBoard turns yellow 3 To change the keystroke from F12 to F11 click the F11 key from the Regular KeyBoard 4 Click Change to save the changes If the new keystroke you select is already in use for another function
24. 2 Graybox API Details of Graybox API is available in http support hold com api 7 3 Web Blotter Web Blotter with details of trading can be accessed from Graybox main window Tools menu gt Web Blotter HOLD BROTHERS Success is how fast you get there Graybox User Manual v3 63 89 8 Appendix 8 1 Frequently Asked Questions FAQ s 1 How to load or save the layout To Load a Layout go to File Menu gt Layout gt Load Choose a layout from the pre saved xml layouts To save a Layout Go to File Menu Layout gt Save After making changes to existing Layout save layout To save to a different name go to File Menu gt Layout gt Save as give a name and Save Alternatively layouts can be loaded and saved using the options available from the right click menu of the Graybox main window 2 Moving the main window the position window also moves along How to avoid this To avoid this change settings on the Trading options To change Right click on the main window gt Trading Options gt Positions Dialog Mode at bottom left side Change it from Docked to Floating 3 How to enable or disable the Mini order entry part on the MM window In the Marketmaker window right click gt View gt Mini Order Entry If there is a check mark then Mini order window is enabled Uncheck to disable mini order entry 4 How to enable or disable the Order entry part of the MM window In the MM window right cl
25. 2S i Se Since OOO B LMT ZZ 100 1 4 eet Cancel Selected Change to Market Cancel Replace Accept Lacate Check Order Status PreLoaded Orders Layout Blotter Board View Basket Keyboard Contig Trading Options Setup View Entitlements Views Help About GrayBox 57 Cancel send Selected Cancel Selected send All Loaded Cancel All Loaded SS LOCKED Click To Unlock Preference Window MSDO SD0T Orders ECH Order LUU B LhAT Cancel Close Outs Trailing Stops status HET lee All Orders All Buy Orders All Sell Orders All For Selected Stock selected Order SS LOckKED Click To Unlock Figure 53 Cancel Order HOLD BROTHERS gel there Graybox User Manual v3 63 58 5 16 1 Cancel Replace Orders Hotkeys Keymap ESLI E TT Graybox Window MarketMaker Window Pref Listed Trading Wnd Execute Execute Execute Cancels all sell orders in the stock you have the focus on Regular KeyBoard il dodd EIS _ SSE al ka a Be el _ L Return Show Conflicts Figure 54 Cancel Replace Orders Hotkeys More information on Cancel Replace orders hotkeys is provided in 4 6 Canceling an Order HOLD BROTHERS w fast you get ther Graybox User Manual_v3 63 59 6 Market Maker Window Configuration This section explains the configuration of Market Maker window of Graybox 6 1 Market Maker Window Mar
26. 4 3 Edit Chart Dialog You can also set Interval Show Last and Chart Type through Edit Chart Setup To set through Edit Chart Setup Click on the Edit Chart setup Icon in the chart or Right click and select Edit Chart option The Chart Setting Dialog window appears See Figure 77 Chart Setting Dialog window enables you to make settings in Tick Chart Bar Chart and Day Chart tabs Edit Chart Overlay Sym ee Line C Merged Tick Chart Bar Chart Day Chart Show Last Today EE S Select Datel Bar Interval Cancel Figure 77 Chart Settings Dialog Window HOLD BROTHERS Success is how fast you get there Graybox User Manual v3 63 74 6 4 4 Show Volume Along with the interval you can also set the Show Volume duration for the chart display To set the Show Volume Right click chart window and select Show Volume B BE p ge e e PS e Be EH International Business Mach 1 minute Bar Char migom i IBS S today Minute LAST VOL IBM 300 300 0000 Figure 78 Show Volume 6 4 5 Information Panel You can view the details like date time Current value and volume along with the chart display To set the Information panel Click on the Info Panel Icon in the chart or Right click on the chart window and select Information Panel from the menu See Figure 79 This dropdown menu consists of the following options o Always On o On Mouse Click o Never
27. 63 Order Ciel ERT le ele EE 64 Market Maker Menu Wingow NEE ENNEN NEEN EEN 64 Prints Area of Market Maker WiNdOW ccccccceeeee eee e eee e eee e eee e teen eet e ne neee nes 65 PRIMES Fiter REENERT 65 CUSTOM COOK dg e elle EE 66 Time amp Sales WINGOW EE 67 Time amp Sales Get Last SCAN EE 68 Time amp Sales Custom Gearch ccc cceceeeeeee cece cece eee ENEE ENEAN 68 PINO oe lid eee Cerne ener ene eee ee ree rrr 69 ECN Book Power Shares Exchange 70 PEUL ee eebe gg e e EE 70 ECN BOOK FINGER WINGOW sxsacnitanseveiatanancntniesvnmsaganaae E 71 Chart VIEW OF a SlLOCK EE 72 Interval Setting WINKOW NNN ENNEN ENEE 72 Show Last Setting WiNdOW EE 73 Chart Settings Dialog WiNndOW ssssssssssssrsrrnerrnnrnnrrnrrnrrrnrenrrnnrnrrnnrerrerrns 73 SOW EE ARE A E A EAA 74 iere leaa cin ein M File E 75 EE ENEE 75 Coor elle e E 76 CAED A EEN 76 Ray WG NG EE 77 Draw HOZOM ANLE eerie a A a EE EE 77 Chart Studies Selection NENNEN ENNER EE EE 78 Chart Studies EE ege ee 78 Cate Seles SMA ieee cc ttnsgecdantctnesemecesenesets asontusannceeeaotteenesse secs tsciadctese 79 Chart Studies Multiple Studies ccc cece cccecceeeeeeeeeeeeeeeeeeeeeeeeneeenees 79 Merge Cilia en de e EE 80 Moged CNA E 80 HOLD BROTHERS Success is how fast you get thoro Graybox User Manual v3 63 7 Figure 91 GrayBox BoardView Wipndouw EEN ENEE EEN 81 Figure 92 Graybox BoardView with Symbols Added cece cece esse eeeeeeeeneeee 81 Fig
28. CBSX Routing Mode NOPX Routing Mode FLOW Routing Mode BYXX Routing Mode Es El Figure 39 Rash Routing Mode Box Default routing modes can be set for each Exchange ECN if the routing is enabled 5 1 6 Display Size Defaults ECN You can set your Display Size Defaults ECN here Display Size Defaults ECN NOFX Orders FLOW Orders ARCA Orders BATS Orders TRAC Orders XBOS Orders RASH Orders MILL Orders EDGX Orders EDGA Orders NYSE Orders NSXS Orders DTTX Orders CBSX Orders BYXX Orders PELE e bk ekk EE EERE EE HEEL EERE EE Figure 40 Display Size Defaults ECN Box For each ECN the display size can be set in the following ways e As default e As order quantity HOLD BROTHERS Success is how fast you get there Graybox User Manual v3 63 44 e As some value Example 100 200 and so on 5 1 7 Scroll settings for Maximum and Minimum Qty The will change the maximum and minimum quantity that can be changed using scroll Scroll Max 10000 Min mn 5 1 8 Default Quantity Per Stock You can set the default quantity of shares per stock here The stock carries the set quantity every time the stock is typed Default Oty Per Stock TT Allow Different Qty For each MM Window k C Suto Insert Default Figure 41 Default Qty Per Stock Box e To set the default quantity shares per stock e Type the chosen stock name in the Stock field and specify the default quantity e
29. Enter your trader ID and password in the Trader ID and Password fields The system automatically displays your default BRSQ account number The administrator will provide your Trade ID and Password You can change the password after first login 4 Click OK The Graybox main window appears as shown in Fig 2 HOLD BROTHERS Success is how fast you get there Graybox User Manual v3 63 2 2 Main Window After you log on the Graybox main default window appears as shown in Figure 2 l jo x j nFite mEdite vieweNeweTrading Teale Configuration Help CT iw ab l 2 mT o Since Status PS LOCKED click To Unlock BATS JINET ILSTK ARCA JBELZ JHDOT PTIRACINYSE JRASH MILL JEDGA JEDG gt EES Figure 2 Graybox Main Window The Graybox main window menu consists of e File The dropdown menu consists of the following options o Layout to customize and save the layout see Section 2 3 o Change Password to change your Trader ID password o Exit to close the application e Edit Gives you the option to adjust edit preferences for order quantity The dropdown menu consists of the following options o Quantity 100s 1000s Manual Position Odd Hundred Odd Thousand e View Enables you to set up the View screens along with the GrayBox main window You can select the required screens for the dropdown menu The menu consists of the following options o Notifier o Positions Monitor HOLD BROT
30. FUNCIONS eege EE EE 88 7 Ac VIGWING SUAUISUICS EE 88 Tee E e e AP E 88 KE IB e gd EE 88 S elen D ie E er ere ee ee ee ee E 89 8 1 Frequently Asked Questions FAQ S ccccccccecceeeeee eset eee tent eee eeeenettnatnannaneaes 89 Gee Ola VO Om TMS CANA ll EE 92 8 2 1 Computer requirements ccccccecceece eee e eee NENNEN ENEE NEEN 92 8 2 2 Supported Internet Connections ccccce ce ee seen eee e eee eeeeeeesssseeeeeenenes 92 8 2 3 Graybox Installation amp Confguration cc cece ceeeee eee eee eee ees 92 8 3 Graybox Exchange codes displayed in Prints 92 Bte EI Ae SV IMDOlOGY EE 93 INDEX EE 95 HOLD BROTHERS Success is how fast you get there Graybox User Manual v3 63 List of figures Figure 1 Figure 2 Figure 3 Figure 4 Figure 5 Figure 6 Figure 7 Figure 8 Figure 9 Figure 10 Figure 11 Figure 12 Figure 13 Figure 14 Figure 15 Figure 16 Figure 17 Figure 18 Figure 19 Figure 20 Figure 21 Figure 22 Figure 23 Figure 24 Figure 25 Figure 26 Figure 27 Figure 28 Figure 29 Figure 30 Figure 31 Figure 32 Figure 33 Figure 34 Figure 35 Figure 36 Figure 37 Figure 38 Figure 39 Figure 40 Figure 41 Figure 42 Figure 43 Figure 44 5 LOJO gn NEE 9 Gray Dox Main e Lee EE 10 Gray OX Maihi et EE 13 Change Password GcCreen NNN NENNEN NEE ENEE EE E 13 User Entitlements WINGOW EE 14 A eg Order WINGO EE 15 lge el 16 Messages te e e EE 17 POS VO lgl 18 POSI
31. Graybox User Manual_v3 63 1 HOLD BROTHERS Success is how fast you get there Hold Software com Inc Graybox User Manual v3 63 2 CONTENTS We ug ele Te de E 8 Eislek Te 9 2 le OGGIAG ONTO Gia e EE 9 Dede IVAN Melle TEE 10 A CUSTOMIZING Ee EE 12 SE Cre MONG Eege BEE 13 Ze oer uge En Ee 14 Se Gla ee e a e Te EE 15 So E e Oraers WINGOW EE 15 S Ba D Order Detalls TO nelle 16 3424 MESSAGES WINDOW EE 17 Di Ee dee EE 17 Bo POSIIOM W lu ele ET 18 3 4 EXECUTIONS Ticker WINGOW EE 23 Bs NOUN GE tee 23 de Re a ENUY E 25 4 1 Market Maker mini Order Entry window seen eeeeeeeeeeenaas 25 4A 1 1 Setting Order TY ENEE 26 A E Oa e EE 27 EE 27 4 1 4 Switching between Live and Custom Mode 27 Feke WAV MI e C TEE 2 A 16 BUY GSE NEE 28 4 1 7 Setting Destination Exchange Routing Modes amp Strategies 5 28 4 1 8 AdGG amp Remove LIQUIGICY EE 29 4 1 9 Setting Routing Order Buttons NENNEN EE EE 29 4 1 10 Cancel All open ee TEE 30 42 ECN Order ENUY WING OWS EE 30 4 2 1 Sending ARCA BATS TRAC INET RASH Buy Ent 31 4 2 2 Sending ARCA BATS TRAC INET RASH Sell Entry ccccccceeeeeeeeaeees 32 4 2 3 Sending ARCA BATS TRAC INET RASH Short Sell Entm 32 MD NEE E ee e e EE ER 4 4 Trailing Stops TEE 34 4 5 Changing a Floating Ordr EE 36 AO CONC EINI af EE 37 A s Manual Order Entry gn e e EE 38 De E Ae ek eidel 20 5 Ls Configuring Trading gie lei c
32. HERS Success is how fast you get there Graybox User Manual v3 63 11 Hedges Monitor Messages Ticker Locates Monitor Executions Ticker Market Clock Menu Status Bar Tool Bar Title Always on Top When selected the respective commands open in separate windows e New This option enables you to open a new O O O O O Market Maker ECN Book Chart Boardview Ticker NYSE Openbook Manual Order Entry window Time and Sales e Trading This option helps you to place manage and cancel orders using different options To know more about trading Order Entry The dropdown menu consists of the following options O O O O O O O Preference Window NSDQ SDOT Orders ECN Order Cancel Close Outs Trailing Stops e Tools This option helps you to assign trade open blotter and assign trades e Configuration This option helps you to configure the keyboard shortcut and system for the transaction You can set the font color and sound for the application For more details see Chapter 3 Graybox configuration This dropdown menu consists of the following options O O O O Fonts Colors Sounds Trading Options HOLD BROTHERS Success is how fast you get thoro Graybox User Manual_v3 63 12 O O Keyboard Config Execution Options System Config Diagnostics Reconnect All Use Primary Settings Reconnect All Use Secondary Settings e Help
33. Help menu provides option for sending the log files created by Graybox to the Graybox support team as well as clean this log files Apart from above you can access help to open the manual and know Graybox version and contact information about Graybox 2 3 Customizing Layout To customize the layout e Go to Load and then Select saved multiple layouts to bring up the exact layout To save your current layout for Graybox e Click File gt Layout gt Save To change layout and save it in a different name multiple layouts e Go to File gt Save as By default Graybox opens the last layout used Predefined layouts are copied during Graybox mand installation A preview of the layout is shown during installation HOLD BROTHERS Success is how fast you get there Graybox User Manual v3 63 13 2 4 Changing Password Perform the following steps to change the password 1 Click File and select Change Password as shown in Figure 3 The Change Password screen is displayed as shown in Figure 3 Layout iE l a SA Change Password since Status Exit SS Locked Click To Unlock Figure 3 Graybox Main Window 2 Enter the Old Password and the New Password in the respective text boxes Change Password User ID Old Password in New Password is Confirm New Pasea Figure 4 Change Password Screen 3 Re enter the new password in the Confirm New Password text box da Passwords have to be at
34. Market Makers gt A new window will open By default all ECN s will be Visible to remove unwanted ECN s from MM window Select the ECN s and click the button gt to move the selected ECN s from Visibles to Ignores then click OK 9 How to open Boardview and include stocks on it To open a Boardview from the main window select the New menu gt Boardview gt A new Boardview window will open Enter the stock and hit enter Do the same to add more stocks in that Boardview Alternatively Boardview can be opened from Graybox main window and Marketmaker window by clicking on the Boardview Icon 10 How to open Charts on Graybox In the MM window or in the main window click on the charts icon to launch charts Charts can be opened from the New menu gt Chart this will also open a chart Historical data has to be enabled for seeing old data in charts contact us for details Otherwise only current data is updated 11 How long does it take to master the software Depends on person to person and how often how often you use it Based on the existing customer experience it takes 2 3 weeks 12 How often is Graybox software updated Since our Graybox software is developed by traders for traders and we utilize in house programmers it s updated whenever our programmers determine there s a better way to enable your trades Instead of waiting for quarterly major updates fine tuning updates are generally released every few weeks Hold Br
35. TION window MENUS NN 19 Customizing Upper POSITION window eee eee eee eee ene e eee e nent eee ees 20 Customizing position summary wWlpndOow cece eee e eee e eee e tenet eee eee e ees 21 d le Se OUE Keys e E ME 22 Execution Ticker WIMGOW NN 23 d leie NNO EE 24 Market Maker mini Order Entry wipdow eee e teen eee eeeeeeneee ees 25 POG OVD ee EE EE 26 Channeling Time IM FORCE EE 28 Changing routing EXCHANGES EE 29 RUNG Order DUONS EE 30 ECN Order entos Zegeg Sege hee e a A a 31 SEnNdiNO BUY ENUY E 31 SONAN Sel ENEY EE 32 sending Short Sell ENUY asirerrsieianaa kaana a ET AE A 32 Opening Preference WindOW NN NEEN EE EN 33 Preference ViIEOW saci cav cage sere arrana AEEA 33 Bell lee E ele SCU U EE 34 Trailing Stops Buy Sell and Stop Sell WINdGOWS cccceeeeeeeeeeeeeeeeeeees 35 Changing a floating order W 36 Canen EE 37 Manual order entry EE 38 Trading beleet e Le TEE 20 Default Quantity BOX EE 40 Order Display MOGC BOK EE 40 Market Maker Settings BOX NEEN ENEE NEEN EEN 40 AUO C e MOOO air A E eter eeeeaee te 41 Order Entry Positions Window Mode amp Level 2 Orders Settings Box 41 Time in Force Setting BOX EEN 42 Rash ROUTING Mode BOX EE 43 Display Size Defaults ECN BOX NENNEN 43 Default Qty Per Stock Bon 44 MN Ecg ele he e EEN 45 lge e gin e lomo o gt Genre eens Cee E E ere ee eee 45 Smart Orders Setup WINdOW EE 46 HOLD BROTHERS Success is how fast you get thoro Graybox U
36. The Change Order option is used to change the display area in the Prints Area See Figure 64 HOLD BROTHERS Success is how fast you get there Graybox User Manual v3 63 65 Exchange ID A Prints 09 32 13 09 32 13 09 32 13 09 32 13 1 Q 09 32 13 09 32 13 09 32 13 2 Q 09 32 13 19 32 13 Figure 64 Prints Area of Market Maker Window 6 1 3 1 Filtering the Prints Display You can filter the Prints of the Market Maker window To filter e Select Setup gt Prints gt Filter The Prints Filter window appears See Figure 65 Prints Filter Add Exchange Filter List lt Show All gt COMMON CODES N NYSE Q NASDAQ NMS A AMEX E BSE C CINN P PACIFIC T NASDAQ LISTED B BSE def PRIMARY EXCH Cancel d Figure 65 Prints Filter Window 6 1 3 2 Showing Hiding the Time You can set the Showing Hiding the Time option as per the requirements To show and remove the time in the Prints column e Right click on the Market Maker window select SetUp gt Prints gt Show Time HOLD BROTHERS Success is how fast you get there Graybox User Manual_v3 63 66 6 1 3 3 Always On Top You can set Market Maker window Always On Top of other windows or screens of the Graybox application To set Market Maker window Always On Top e Select Always On Top in the Market Maker menu See Figure 63 Minimizing Graybox minimizes all Graybox quote display windows 6 1 3 4 C
37. an ECN order are explained in the Keyboard Reference in chapter 6 EA Hote To open an ECN order e On the Trading menu select the required routing exchange and then click the required entry type HOLD BROTHERS Success is how fast you get there Graybox User Manual_v3 63 31 dt Graybox Locked File Edit Wiew New Tools Configuration Help Preference Window el Cancel MSDQ SDOT Orders V Eee ECHI ARCA ARCA Buy Order MILL ARCA Buy Entry Cancel BATS ARCA Sell Close Outs IMET ARCA Sell Entry Trailing stops TRAC ARCA Short Sell CSFB ARCA Short Sell Entry EDG EDGA ABC ES LOCKED Figure 21 ECN order entries Figure 21 depicts the ECN order entries available under ARCA routing exchange Following sections provide a detailed explanation on ECN order entries The Super ECN key sends orders to all ECNs at the price specified in the Preference Order box These orders go out at default quantity size 4 2 1 Sending ARCA BATS TRAC INET RASH Buy Entry You can send buy order entries through any exchange To send a buy order entry on any exchange 1 Open any Buy Entry window 2 Enter Stock name and stock Quantity 3 Use the left right arrow keys on your keyboard to select the price 1 cent per keystroke or use the Step option ARCA Order Entry cok RE oy Em Figure 22 Sending Buy Entry 4 Click Buy HOLD BROTHERS Success is how fast you get there Graybox User Manua
38. ased On Swipe 3 Swipe E Swipe Exchange STEE Swipe Factor Swipe Factor Swipe Based On Swipe Based On Inside Market Listing Exchange Delta Used to be SOE5 Delta Keys These keys will send orders to the Listing Exchange of a stock at the specified delta From the WBBO List Exch Delta Keyi Value io List Exch Delta Keya Value b s List Exch Delta Key 2 Value on List Exch Delta Key4 Value aos NAS Delta keyi Value mn Limit Price Based On Levelt Inside F Direct ECN keys Cancel Figure 46 Swipe Setup Window To configure multiple swipe keys 1 Go to the Graybox menu and pick setup 2 Then go to the swipe key To enable the swipe keys o Go to Keymap Configuration and enable the Swipe Keys If required you can change the keystrokes 3 Select the required Swipe ECN e g INET and the Swipe Factor e g 0 001 and specify if the swipe should be based on the Inside Market or ECN Market The SOES Delta Keys allow you to send SOES limit orders at a specified increment above the market price HOLD BROTHERS Success is how fast you get there Graybox User Manual_v3 63 50 To set the increment On the context menu click Setup gt Swipe In the SOES Delta Value field enter the decimal value of the increment for the limit price By default SOES Delta key functions are disabled and no keystrokes are assigned To use hotkeys go to the Keymap Configuration and assign appropriate keystrokes
39. can be accessed by right click on the main window go to Setup and Trailing Stop This will open the Trailing Stops setup window Figure 27 While placing the Trailing Stop Loss Buy enable Use Delta from Market option and set Delta from Market See Figure 28 Trailing Stop Window Defaults Direct Trailing Stop Hot Key ESS PR Stop Triggered By ES Destination E Auto Trigger Trailing Stop on Entering Positions Cancel Figure 27 Trailing Stops Set Up The ratio in change in the price of the underlying asset to the corresponding change in the price of a derivative is known as Delta This is sometimes referred to as the hedge ratio By setting Trailing Stop Loss Buy Sell you can limit the loss while not capping your gains Also you do not have to constantly monitor your investments HOLD BROTHERS Success is how fast you get there Graybox User Manual v3 63 35 Trailing Stop order can be auto triggered when entering positions This setting can be enabled or disabled by putting a check mark in the Auto Trigger Trailing Stop on Ge Positions entry from Trailing Stops Setup window o Use Stop Price ei Use Delta from Market 2 Use from Market Delta from Market EG vi Routing Exchange BEE Trailing Stop Sell o Use Stop Price Use Delta from Market Use from Market Delta from Market ons O H Use Stop Price Ge Use Delta from Market C3 Use from Market
40. can select the required routing strategy You can toggle between routing modes strategies using the Order Entry window A destination Exchange can be made default by using the Lock a button provided next to destination drop down box Select a destination and lock it all orders will be sent to this destination Once locked this destination is default order destination in the current market maker window s mini order entry Unlock gd this button to select multiple destination To change the routing modes strategies 1 Inthe Order Entry window click the Destination Exchange drop down menu HOLD BROTHERS Success is how fast you get there Graybox User Manual v3 63 29 2 Select the required routing mode strategy from the dropdown list as shown in Figure 19 The order is now routed through this mode strategy to the exchange Various Routing Options are available They are 2 1 BATS MPP This is BATS Midpoint peg order which sets the price at the midpoint of National Best Bid and Offer NBBO et ke me E Let 66 05 1 Net 0 81 Vol 6 069 835 Figure 19 Changing routing exchanges 4 1 8 Add amp Remove Liquidity Mini Order entry from the market maker window gives you the facility to Add or remove liquidity from the Market maker window itself Using this option will help you set the price so as to add or remove liquidity from market 4 1 9 Setting Routing Order Buttons
41. ch include periodic system announcements that are made by the Graybox system administrators The New York Stock Exchange NYSE is a stock exchange located at New York City USA and is the world s largest stock exchange by market capitalization of its listed companies Position The Position window displays stock position details This window is Window divided into two parts The upper part of the window displays a detailed stock position and the lower part displays the summary HOLD BROTHERS Success is how fast you get there Graybox User Manual v3 63 INDEX B basics 9 Board View 81 82 83 94 C Cancel Order 37 56 57 Canceling an order 37 Changing a particular order 26 Charts 8 71 Configuration 11 49 50 55 59 62 D DAY orders 42 Default Quantity 40 44 Display Size Defaults ECN 43 Dynamic smart orders 47 E Edit Chart Dialog 73 ESignal 45 56 94 G Graybox Main Window 10 13 52 53 54 70 Graybox trading 8 H Hidden 40 L Links 55 M main window 9 10 21 37 38 42 45 50 52 53 56 Manual Order Entry 11 38 41 95 Market Maker 25 29 40 41 47 50 59 60 61 62 63 64 65 66 69 71 72 73 74 76 85 94 Messages window 16 17 37 Multiple Swipe Keys 48 N Normal 40 42 O Order Display Mode 39 40 Order Entry 25 26 28 29 38 41 45 64 P Password 9 10 13 56 Preference window 33 34 Prints 60 64 65 R Ro
42. ck exchange based in Lenexa Kansas Missouri and was founded in June 2005 as an ECN and its name stands for Better Alternative Trading System In early 2009 it became the third largest exchange in the world by volume behind the New York Stock Exchange and NASDAQ BoardView BoardView is the feature available in the Graybox which provides trading information such as Last Traded Price Net Change Best Bid Best Size Best Ask and Best Size etc for selected stocks ECN Electronic Communications Network ECN is a completely automated network anonymously matching buy and sell orders and has been described as the black box of securities trading ESignal ESignal is charting software which can be linked with the application Graybox Graybox Graybox trading software application from Hold Software com Inc is a state of the art easily configurable trading software to date Locates This window shows the stocks available for the trader which can be monitor the deciding factor for the short sell of those stocks Window Market Market Maker window displays the quotes of the selected stock and Maker pending orders awaiting execution Window NASDAQ National Association of Securities Dealers Automated Quotations NASDAQ is an American stock exchange which is the largest electronic screen based equity securities trading market in the United States Notifier The Notifier window displays all system messages related to Graybox Window whi
43. con in Main Menu setup Colors setup Font show Size in 100s Show Tire Always On Top Figure 100 NYSE Open Book Window HOLD BROTHERS Success is how fast you get there Graybox User Manual v3 63 86 6 7 1 Set Up Colors Font You can set up Color Font as shown in Figure 100 6 7 2 Show Size in 100s You can set the Qty display size in 100s as shown in Figure 100 6 7 3 Show Time You can set the Show Time option See Figure 100 Enabling this option displays time You can disable this option by clearing it 6 8 Hedges and Locates Hedges and Locates window shows the hedges taken by the trader A Hedges amp Locates Symbol A SPT 0 100 1000 0 Figure 101 Hedges and Locates Window HOLD BROTHERS Success is how fast you get there Graybox User Manual v3 63 6 9 Market Clock Market Clock shows the current market time with date and market open close status Market clock is opened from the Order entry Window View Market Clock See Figure 102 C Market Clock Figure 102 Market Clock HOLD BROTHERS Success is how fast you get there 87 Graybox User Manual v3 63 88 7 Back Office Functions This section explains the back office functions of Graybox 7 1 Viewing Statistics The Statistics screen shows all your trades for the day with the number of trades the volume on ECNs SelectNet and Profit and Loss 7
44. ders available Let 66 05 1 Net 0 91 Vol 6 069 835 BSE 65 45 25 Sr d h EI Figure 17 Order types The Limit price and the Stop Limit are updated by real time quotes based on the current Inside Market The different types of order available are e Limit e Market e Stop e Stop Limit e Market on Close e Limit on Close e Trailing Stop e Trailing Stop Limit e Opening Cross e Dynamic Smart e Regular Smart HOLD BROTHERS Success is how fast you get there Graybox User Manual_v3 63 27 4 1 2 Set Order Price Price of the order is set by Manually by typing in the order price Selecting Live mode the order price will change accordingly to the last Bid or Ask on the Level 2 display Point and Click using mouse on the Level 2 Display changes price based on where the mouse was clicked Should be enabled from the Mini OE Setup 4 1 3 Set Order Quantity Order quantity can be entered manually From the RESV option you can set the default display quantity reserve quantity and the step size for increasing decreasing the quantity 4 1 4 Switching between Live and Custom Mode To enable price change according to the last Bid or Ask Click LIVE This can be toggled to enable or disable live updates as the market changes 4 1 5 Time in Force Time In Force TIF denotes the number of seconds the orders remain afloat before they time out By d
45. displays the position of the stock in different columns Following are the columns in the Position window Bia Pree at which the buyer is ready to buy HOLD BROTHERS Success is how fast you get thoro Graybox User Manual_v3 63 The lower part of the position window displays the position summary of the stock Following are the columns in the position summary window long positions and to the Ask for short positions Total Exposure Amount utilized to buy short sell shares at the position entry price Sum total of exposure of all the stocks in the position Net P L Open Net Profit or Loss on the position calculated on the commission provided in the commission rate in the trading options If not provided in the trading options it is the close profit loss Column headers Upper part of position window You can customize column headers of the upper part of the Position window If you do not wish to view only the column headers right click on Position window and click Show Hide Header see Figure 10 Repeat this procedure to view only the column headers w Show Header Positions O Show Summary MSFT Position Close Out 2 Position Close Out 3 Position Close Out 4 Close Out Selected Stock Close Out b Longs Only Close Out 3 Shorts Only Close Out 4 Winners Only Column Setup SES Summary Setup View Figure 10 Position window menus You can customize and view onl
46. e Charts provides comparison of price movements between two symbols You can merge price movements of two symbols by choosing the Merged option from the Edit Chart Dialog box From the Edit Chart dialog box enter the Linked Sym and Overlay Sym Choose the type of graph to display put a check mark on the Merged box and click OK See Figure 89 Tick Chart Bar Chart Day Chart Show Last Today ES Bar Interval Cancel Figure 89 Merge Chart Settings The Merged charts is displayed as shown in Figure 90 D ration E ly li Ki gt alah Hour si Minute KI Aug 26 10 07 00 Figure 90 Merged Charts Options in Sections 6 4 11 are not available with chart type Tick Chart HOLD BROTHERS Success is how fast you get there Graybox User Manual v3 63 81 6 5 BoardView Graybox BoardView provides trading information such as Last Traded Price Net Change Best Bid Best Size Best Ask and Best Size etc for selected stocks BoardView can also be used to send Basket orders Basket order option is available from the sub menu as shown below 1 Click the icon in Graybox main window The Graybox Broadview window appears 2 Right Click the BoardView window The Broadview window sub menu appears See Figure 91 14 A0 n 21 14 39 9f 10 899 103 Q Dell Inc Buy Selected 1 295 235 Q Google Inc 530 12 Sell Selected 25 564 088 Q Intel Corporation 20 28 24
47. e Scroll Function symbol Figure 43 Other Settings Box 5 2 Setting Up Smart Order Routing This feature allows you to set up smart order keys default to CTRL B CTRL S and Shift S for one key execution with the market maker or ECN of your choice You can set up a list of ECNs and market makers as per your priority If the first choice is not available the smart feature moves down the list to the next available ECN or market maker and so on until the order goes out e Shift S sends a short sell order to your smart order routing list To set up Smart Order Routing 1 Shift focus to the active order window 2 Right click the active order window The Graybox main window appears 3 Select Setup in the menu The Smart Orders Setup window as shown in Figure 44 appears HOLD BROTHERS Success is how fast you get there Graybox User Manual_v3 63 46 For All SOESable MarketMakers Use SMM in the Pref List For ECNs in their displayed order Use ECN in the List For selecting NYS ASE for Listed Use WYSE amp AMEX resp For Quantity Remaining ais Sends INET Limit SOES Sends SOES MKT BRLUS Sends BRUT Lmt SLMT Sends SOES Limit TRA Sends TRAC Lmt SDLT Sends SOES DELTA ASES Sends AMEX Lmt Move Up WYSS Sends NYSE Dot Lmt ARCS Sends ARCA Lmt Move Dn C Split Order by Display Size C Use Level 2 Inside Market C Use Current Market for Dynamic
48. e and supports multiple trading styles such as scalping momentum swing and position Its multi server architecture eliminates system overload enabling execution of hundreds of trades a day When you are powered with all the data that you need from Level II quotes to late breaking news right in your trading screen you seldom make a wrong trade This user manual provides a detailed overview of Graybox Performance of the product is constantly assessed under real time operations and is instantly upgraded with new features in line with the dynamic industry trends Graybox supports all 32 amp 64 bit versions of Windows XP Windows Vista amp Windows 7 operating systems Please refer to Hold Brothers Support website http www support hold com for latest updates on the product HOLD BROTHERS Success is how fast you get there Graybox User Manual v3 63 2 Graybox Basics This section explains the basic features of Graybox including logging in features of main window how the user can customize a layout and the entitlements that a user can avail of 2 1 Logging on to Graybox To log on to Graybox 1 2 3 Click Start Select Programs gt Hold Brothers gt Graybox Trader Graybox Logon screen is displayed as shown in Figure 1 Or You can also double click Hold Brothers icon on the desktop Graybox Logon Trader 10 Password E BRSQ i Setup Cancel Figure 1 Logon Screen
49. efault TIF is set to 180 seconds However you can change the TIF for individual orders If LIVE is clicked the order gets updated by current market price automatically If the price is changed manually the LIVE mode gets disabled Do not set the default TIF below 120 seconds for INCA orders Else the order s get rejected You can change the TIF type for a particular order from the TIF dropdown list as shown in Figure 18 The options available for Time in Force are Default TIF Day IOC At Open Open X Imbalance Close X Imbalance Intraday X Only HOLD BROTHERS Success is how fast you get there Graybox User Manual v3 63 28 Let 66 05 1 Net 0 94 Vol 6 069 835 e OPM IME All orders go out with a Default TIF as selected in Trading Options unless they are manually changed for a particular order 4 1 6 Buy amp Sell To switch between order sides Click BUY SELL as required By default the buy side price is the best inside ask and the sell side price the best inside bid However to toggle the quote side click BID ASK If you change the prices manually the window stops updating the Limit Stop Limit entry fields and the order does not remain Live To return to the live mode Click Live 4 1 7 Setting Destination Exchange Routing Modes amp Strategies Graybox allows you to trade through different exchanges You
50. ettingS EN 55 ER E ON Ee EE 55 SA6 Cancel e e EE 56 5 16 1 Cancel Replace Orders HOtkeyS ENNEN AEN 58 6 Market Maker Window Configuration eee ene eee e eens 59 6 1 Market Maker WING OW eege gege EE EE EES 59 Seda slOVEl 1 DISDIOY E 60 Bede 2 BOVE 2 RE 61 iA E ien EEN 64 a gt Kin vU 67 63 ECN BOOK ee e EE 69 6 52 be CNAN Nd Lae GOlOlS EE 70 62542 lt ChenGING TRG EE 70 6 3 3 Showing Hiding Executions and Cancels A 70 6 3 4 Filtering ECNs in the ECN Book EE EEN NENNEN ENEE 71 6 3 5 ECN Book Window Always On Top 71 6 3 6 ECN Book Window Aggregate by Price ccccccceee cece eee eee eee e eee ee ees 71 G CAINS E 71 icc ne asaneiuecsecousascsoneecctecsosetenoctsaeecenaonneunsntaceesntesesesasenatenentandente 72 Oe 5 e LOSE EE 73 HOLD BROTHERS Success is how fast you get there Graybox User Manual_v3 63 4 OA e ri ee RI e E 73 Fe SOW en EE 74 624 bel del gn ge ia Palle EE 74 oo Rehe SS EE geed 75 E ele gg e LEE 76 46 VIEW Chart RE 76 E Draw Ree LINES sessirnar EA snes a 77 6 4 10 Draw Horizontal LINCS EE 77 Ee Di EE dE le 78 Os Ob EE 81 6 5 E e e in enne EE 81 O29 22 ol MID IAIN e 82 SE mis emcees ge ht rt nt ae re 82 6a A CUSTOMIZING ee 82 6 5 5 GENeldl OPON EE SE Ee EEN ge E Ee SE e ER e 84 6 6 1 Setting Up dn CR li EE 84 Oi NV SE OPC EE 85 E cdg Ce UD COONS en EE 86 Oe 7eZ so NON SIZ IA EE 86 EE ON e 86 6 8 Hedges And LOCALES ee NEEN 86 Os ET e ent 87 Pe BACK OMICS
51. ettings Box in Figure 35 Once the Cancel key is hit Graybox automatically resends cancel requests for SOES and ECN orders 5 1 1 3 Automatic Close Mode Automatically changes the quantity to your current Long or Short position in that particular stock when you go to cover your position Auto Close Mode EG C Reset Share Size to Default Oty Figure 36 Auto Close Mode However if the position is greater than your default qty size then the order will go out for the default size For example if you were long 375 shares of CSCO and your default is a 1000 your quantity for CSCO would go out for 375 shares Reset Share Size according to default quantity This feature resets the share size after taking into account the default quantity and the current position For example if you are long 100 shares of DELL and your default Quantity for DELL is 1000 the next order only the next order automatically goes out for 900 5 1 1 4 Smart Order Auto Cover This option is not available in the Trading Options image When using Smart Ordering Smart Orders detects an open position if any for the specified stock and resets the quantity to cover the position So instead of sending out orders for your default quantity size it sends orders for your open position If your open position is greater than your default qty size the order goes out for the default qty size only 5 1 2 Order Entry Positions Window Mode amp Leve
52. from Column setup Imabalnces of both NASDAQ and NYSE stocks are available When Imb and Imb columns are selected the imbalances will be displayed when the Imbalance data is available 6 5 3 Load from Analytics You can load stocks from Analytics Analytics option provides All and Top 10 to 30 Imbalances for Buy Sells and Both for the day Top 10 to 30 imbalances can be loaded by percentage also See Figure 93 This allows you to make instant trading decisions and take or switch between positions based on Analytics To Load from Analytics right click the BoardView window The sub menu appears See Figure 93 Graybox BoardView N kam mit Agilent Technologie Barnes Group Inc C Sell Selected D DI Citigroup Inc Comm Dominion Resource Load from File E ENI S p A Common Save Symbols to File Ford Motor Compan 116 075 Genpact Limited Co 113 245 Hyatt Hotels Corpor Save Data to File Clear Reload Use As Trading Basket Setup Open MarketMaker Window Load from Analytics Top 10 Imbalances Top 10 Imbalances by Top 20 Imbalances Top 20 Imbalances by Top 30 Imbalances Top 30 Imabalances by All Imbalances Figure 93 Load from Analytics Window 6 5 4 Customizing Headers You can customize the Column Headers in the BoardView default screen To customize Column Headers 1 Click on the Z icon in Graybox main window Graybox Broadview window appears 2 Right Cl
53. g on to the application CON O UI Enter your trader ID and password in the Trader ID and Password fields The administrator will provide your Trade ID and Password You can change the password after the first login 9 Click OK The Graybox main window and eSignal main window appears 10 Click Page and then click Advanced Charting in the eSignal main window 11 Right click MM window and then click Setup 12 Click ESignal Link Scheme and select the required color from available choices 13 Right click MM window and then click Setup 14 Click ESignal Link Type and select the option Both 15 Click Page and then Save Page to save the page 5 16 Cancel Order You can cancel orders from the Graybox main window Canceling orders from Graybox main window menu will enable you to execute your cancels faster as you can place cancel orders in groups for Buy Sell and Selected orders To place cancel orders through hotkeys 1 Right click the Active Order window The Graybox menu appears 2 Select Cancel from the Trading dropdown menu 3 Select the orders that you wish to cancel 4 Click OK OR Click on Trading Menu from the active order menu Select Cancel from the menu Select the orders that you wish to cancel Click OK a ee HOLD BROTHERS Success is how fast you get there Graybox User Manual v3 63 H Graybox Locked File Edit View New Trading Tools Configuration Help vc o 3
54. hanging the Font You can set different fonts for different stocks and price levels in the Market Maker window To change Fonts 1 Select Setup gt Font gt Custom 2 Select the required Font and Click OK or click Auto Size to return to Original 6 1 3 5 Changing the Colors for Price Levels You can change colors for different stocks and price levels in the Market Maker Window To change the colors 1 Select Colors Setup gt Color gt Custom Ranges Background Repeat For Remaining Levels Figure 66 Custom Color Window 2 Click the color for the price level you want to change The window Color menu appears 3 Select the color you want to use and then click OK Alternatively Click Define Custom Colors select the color on the window and then click OK 4 Click OK to save changes or click Default to return to original HOLD BROTHERS Success is how fast you get there Graybox User Manual v3 63 67 6 2 Time amp Sales Time amp Sales provides with real time data of securities with volume time of execution price and exchange You can open Time and Sales by clicking the ca icon from Order Entry or Market Maker window See Figure 67 Menu in time and sales has options to change colors display the data with gridline and show quantity in multiple of 100s for easy visibility 13 14 51 100 E 13 14 51 400 B 13 14 51 ZU B 100 j eni 100 100 Clear 100 Show Gridli
55. ick gt View gt Order entry If there is a check mark then Order entry window is enabled Uncheck to disable order entry window 5 How to limit number of ECN order buttons displayed in the Order Entry Window To view only certain ECN order entry buttons in Order entry window In the MM window right Click DSetup gt Order Entry Window gt Configure order entry button A new window Opens Two panes display the ECN button options right side pane displays ECN buttons that are available in order entry window left side pane shows buttons that are not available Selecting the ECN and moving them between the two panes will change the order entry buttons accordingly 6 How to highlight ECNs in the Level 2 area of MM Window To Hi Light certain ECN s In the MM window right Click gt Hi Light Market Makers gt A new window will open Select the ECN s that needs to be hi lighted and click the button gt to move the selected ECN s to Hi Lite from left pane to right pane then click OK 7 How to remove crossed quotes HOLD BROTHERS Success is how fast you get there Graybox User Manual v3 63 90 To remove crossed quotes In the MM window right Click gt Ignore Market Makers gt A new window will open In that window put a check mark net to Ignore All Crossed Quotes 8 How to ignore unwanted ECNs in level 2 montage of Marketmaker window To view only certain ECN s In the Marketmaker window right Click gt Ignore
56. ick the BoardView window The sub menu appears Figure 94 3 Right click gt Setup gt Columns Select Deselect the Column Headers using the gt and lt arrows You can also rearrange the Column Headers by selecting and moving them Up and Down to see the BoardView in required order See Figure 94 HOLD BROTHERS Success is how fast you get thoro Graybox User Manual v3 63 83 Column Headers OBI ea gt gt lt lt up _Down Down Gen Figure 94 Column Headers for BoardView 6 5 5 General Option You can make General Setup of BoardView Select the General Option in the submenu The BoardView Setup General window appears See Figure 95 _ BoardView Setup General Ex Graybox BoardView Enable Grid Lines Show Qty in 100s Use Level 2 Data for NBBO if Show Headers Ask Confirmation before sending Basket Orders if Show Tick Images Use BY Default Oty Use MET for zero Limit Price E Cancel Figure 95 BoardView Setup General Window The window is self explanatory and you can select the required options 6 5 6 Refresh Interval You can set a refresh interval option to refresh the BoardView Setting this option refreshes trading data information of a specific stock at specified intervals and enables you to make or change trading decisions This setting is generally for the BoardView to sync up with the MM window s Level 1 data and is particularly useful for
57. iisnavesnnccncsmsvysaniaesawenpnniadute wis EA A aia 20 e En DE DEFI RR Tee vesuvensawcrastanenmaadterenreiasennt qadanunabee A a aeaa 40 HOLD BROTHERS Success is how fast you get there Graybox User Manual_v3 63 3 5 1 2 Order Entry Positions Window Mode amp Level 2 Order Settings 41 E D ICU Ol CO EE 42 De OC OG EE 42 5 1 5 ECN Exchange Routing Mode NENNEN ENEE EE 43 5 1 6 Display Size DeraullS ECNoveinsiinnasaneacenqaasawineanssaame npeninesecenseedsarawenvees 43 5 1 7 Scroll settings for Maximum and Minimum Qty c cece cece eeeeeeeeeeeeees 44 51140 DeETAUIC Quantity Per STOCK EE 44 et SC ODUMIZ ge E 44 SEN DS Er Oe gn eg d e e EE 45 5 2 Setting Up Smart Order Routing sisniiiastnasivvonndiavavaguiriaie via esuscueweeneeteavereas 45 5 2 1 Split Order DY Display SiZ cise cieciiodsneecansneredsceustess aiapetodeuaatdunciceteves 47 Doe Dynamic SMart EE Ee e 47 5 4 INe Super ECN E 47 Een EMS ECN KOV orra E E E 48 5 0 MUDIE SWIDE TEE 48 5 7 Setting UD Keyboard SMOMCUUS ice csscsanencadcddeecininntcecuedidcekneveseeacnoteddscveretedes 50 as alng SOP RGN E 51 5 9 Showing or Hiding Parts of Graybox Main WindoOW sssssssssssssrssrrsresrrerrene 52 5 10 IPM OE EE EE 52 5 11 Graybox Main Window Setting Colors EN 53 5 12 Graybox Main Window Setting Font EN 53 5 13 Graybox Main Window Setting SOUNAS cceeeee cece cess eeeeeeeeeeeeaaeeaas 54 5 14 Changing Server and Router S
58. in active order window or from market maker window To change the display 1 Select ECN Books in the Market Maker menu and then select the ECN Book view 2 Repeat step 1 for each ECN book as required TO open a window for ECN Book quotes Click in the shortcut bar or in the MM box Click Ga ECN books brought up in this fashion are automatically linked to the MM box HOLD BROTHERS Success is how fast you get there Graybox User Manual v3 63 70 Let ECN Book BY Cee xX Sc ECN Book Freeport ETB Y HTB N RS 0 P n l Wl Figure 71 ECN Book Power Shares Exchange 6 3 1 Changing the Colors You can change the colors for different stocks and price levels To change the colors Refer 5 11 Graybox Main Window Setting Colors To change back to the Default Colors Select Setup Colors in the ECN Book menu then Select Default Set Colors w Default Set Font Custom Show Executions Show Cancels Filter Books Always On Top Aggregate by Price Use Optimized Data Figure 72 Default Color Setting 6 3 2 Changing the Font You can set different fonts for different stocks and price levels in the ECN Book To change the Font see 5 12 Graybox Main Window Setting Font 6 3 3 Showing Hiding Executions and Cancels You can set the Showing Hiding Executions and Cancels in the ECN Book HOLD BROTHERS Success is how fast you get there Graybox User Manual_v3 63 71 To show or hide the Execu
59. ket Maker window displays the quotes of the selected stock MM window displays the pending orders that are awaiting execution To open a Market Maker window e Click New gt Market Maker in the Active Order window You can open multiple MM windows Gd QMicrosoft Corporation ETB N NM N RST N CHin DO A l la oo 200m 25 87 HAS LOCATE Let 25 96 1 Het O 07 Hi 26 07 Low 25 75 Level 1 Vol 22 016 859 View Prints Show 12 41 18 Alerts 12 41 18 12 41 18 12 41 18 12 41 18 12 41 16 12 41 14 12 41 03 A OF 12 41 03 Level 2 12 41 03 Display 12 40 56 Prints 12 40 52 12 40 49 12 40 47 12 40 43 12 40 42 12 40 42 12 40 42 12 40 42 12 40 42 12 40 42 12 40 42 Figure 55 Market Maker Window When you type in the symbol of the stock in the top left field Market Maker displays the live quotes of the stock Market Maker window is divided into two parts While the upper part displays information such as last traded price bid and ask prices net change from previous day s close and volume etc about the selected stock the lower part displays the real time quotes of Bid and Ask for different ECNs in a stream Market Maker window has an option to auto locate symbols When a symbol for hard to borrow stock is entered a Locate button is displayed using which symbols are located Information displayed in the upper part of Market Maker consists of e Lst Last Traded Price e Net Net change in price from previous da
60. l 2 Order Settings You can select default ECN Order Entry Settings here Manual OE Listed Default amin Manual OE OTC Default ESMEE ECN Order Entry ce gt Positions Dialog Mode Docked Orders in Level Wind CE Figure 37 Order Entry Positions Window Mode amp Level 2 Orders Settings Box HOLD BROTHERS Success is how fast you get there Graybox User Manual v3 63 42 For manual order entry box the default ECN can be set in Manual OE listed Default amp Manual OE OTC Default The default price for ECN order entry as add or remove liquidity can be set There are two modes available for Positions Dialog Mode Floating and Docked If you enable Floating Positions window and Graybox window can be moved separately If you enable Docked the Positions window is attached to the Graybox main window and moves with it Order can be displayed as a bar with options to cancel the order in Level 2 window using the options in Orders in level 2 Wnd 5 1 3 Time In Force Time in Force sets the period for which an order should stay active The default is set as DAY orders Day orders in Graybox remain active through the trading day including post market hours Default Time In Force w B Time In Force In Secs 0 Figure 38 Time in Force Setting Box If Use TIF In Secs is selected for Default Time In Force then a valid value in seconds is needed for the Time In Force In Sec
61. l v3 63 32 4 2 2 Sending ARCA BATS TRAC INET RASH Sell Entry You can send sell order entries through any exchange To send a sell order entry on any exchange 1 Open any Sell Entry window 2 Enter Stock name and stock Quantity 3 Use the left right arrow keys on your keyboard to select the price 1 cent per keystroke or use the Step option Figure 23 Sending Sell Entry 4 Click Sell 4 2 3 Sending ARCA BATS TRAC INET RASH Short Sell Entry You can send short sell order entries through any exchange To send a short sell order entry on any exchange 1 Open any Short Sell Entry window 2 Enter stock name and stock quantity 3 Use the left right arrow keys on your keyboard to select the price 1 cent per keystroke or use the Step option Figure 24 Sending Short Sell Entry 4 Click Short Sell HOLD BROTHERS Success is how fast you get there Graybox User Manual v3 63 33 4 3 Preference Window The Preference window is used to make order entry in the Active Order window To open Preference window on the Graybox Main window select Trading gt Preference Window and select the order type File Edit Wiew New Tools Configuration Help Preference Window Bid Cancel H DO DOT Orders Offer ECH short Offer Order Pref Buy Cancel Pref sell Close Outs Pref short Sell Trailing stops SS Locked Click To Unlock Figure 25 Opening Preference Window The Preference Bid Offer Short Offer P
62. launch these orders the preference box must be open These orders go out as your default qty size NSDQ NYSE order goes out for the quantity specified in the setup 8 EI 7 i L Hote You can setup the SuperECN key to exclude certain ECNs This feature can be used to go long sell or go short To exclude ECNs from the Super ECN key 1 Right click the Active Order window The Graybox menu appears HOLD BROTHERS Success is how fast you get thoro Graybox User Manual_v3 63 48 2 Select Setup and then select SuperECN Key The Super ECN Key Setup window as shown in Figure 45 appears SuperECN Key Setup Es Ignore CJ mer C Bats CSFB C arca C mi C nsys xBos TRAC LJ or J RASH ARCAPRC J nyse C EDGY EDGA Prim Exch Order Qty EUMM NSDQ oder pe DESS wrSEOrdeTye M Direct SuperECN Key 1 Delta from Inside x Direct SuperECN Key 2 Delta from Inside C Max spread for Order Ca pase Price on EES Cancel Figure 45 Super ECN Key Setup Window 3 Click the ECN s that you want the Super ECN key to ignore Entering 0 in the NSDQ NYSE box disables the NYSE NSDQ order 4 Select the type of order you want to send out from the dropdown menu of SOES order type 5 Specify at what price you want to send the order with respect to the Inside Market Buying at the offer selling at the bid 6 Click OK 5 5 Direct Super ECN Key Graybox set of Super ECN Keys
63. ndow The Market Maker window consists of a mini order entry screen This window routes orders to all available ECNs Exchanges You can trade both listed and OTC securities by using the mini Order Entry window You can also place different types of orders such as Stop Stop Limit MOC and LOC and change the Time In Force for an individual order To view the mini Order Entry window from Market Maker window 1 Right click the Market Maker window 2 Select View gt mini Order Entry window The mini Order Entry window appears in the middle of the Market Maker window Let 66 05 41 Net 0 81 Low 66 00 Hi Level I Display Vol 6 069 835 mini Order Entry window Level II Display You can disable the mini Order Entry window if you do not want to view the window This can be done using the right click menu option in Market maker window Right click in market maker window in the menu select View gt Mini order entry check uncheck to enable disable mini OE window Up and Down Arrow keys can be used to increment decrement price of a symbol for order entry HOLD BROTHERS Success is how fast you get there Graybox User Manual v3 63 26 4 1 1 Setting Order Type You can change the order type and side in the mini Order Entry window You can make the following changes in the required order To change the type of an order click the order type list The dropdown menu in Figure 17 displays the different types of or
64. nes Load from File Save to File 100 Background Colors S00 Filter 2 5 Find Ticks 0 n A Unrnark all Finds Fag pay Show Qty In 100s 500 Set Up Figure 67 Time amp Sales window Search options available are e Get Last available in conditions of a minute to hours and Full day See Figure 68 e Custom Available for a selected date between a time intervals See Figure 69 HOLD BROTHERS Success is how fast you get there Graybox User Manual_v3 63 Figure 69 Time amp Sales Custom Search e Data in Time and Sales can be customized and filtered according to Exchange Trade Condition Trades Bids and Asks and Minimum Size See Figure 70 HOLD BROTHERS Success is how fast you get there 68 Graybox User Manual v3 63 69 Select e Exchange C Trade Condition Select Exchange UnSelected Selected gt K F lt T gt gt ES Select Trades and Quotes i Trades Bids Asks Minimum Size ES 400 Figure 70 Time amp Sales Filter 6 3 ECN Book Window You can set the ECN books in the Market Maker window to Inside Market full market or none In the Inside Market setting you can see the best Bid and Ask on that ECN In the full market setting you can see the list of all the Bids and Asks at different levels for all the available ECNs ECN Books can be opened from the New menu from Graybox active order window or through the Sa icon
65. nter Key to Send Order Enable Double Click to Send Order Send Order Buttons Send to DES Set Order Price Set Order Action Inside Ask f Buy TI Sell 0 Inside Bid shortim BNYSER NYSE BUYG INSIDE ASK Save Cancel Figure 49 mini OE Setup 5 11 Graybox Main Window Setting Colors You can set the colors for the Main window To change the foreground and background colors for the Stock and Quantity boxes and the message bar perform the following steps 1 Right click the Active Order window The Graybox menu appears 2 Select Setup then Color Color Option window appears Color Setup Colors Foreground lit EI enen RE Ss Get e 0 Figure 50 Color Options Window 3 Click the EI button next to Foreground or Background The color window appears 4 Select any color Click OK 6 Click OK again to save your changes 5 12 Graybox Main Window Setting Font You can set the fonts for the column headings and tabs in the Graybox main window 1 Right click the Active Order window The Graybox menu appears 2 Select Setup The Fonts window appears HOLD BROTHERS Success is how fast you get there Graybox User Manual v3 63 54 3 Select the required font and then click OK 5 13 Graybox Main Window Setting Sounds Whenever a trading event such as an execution a partial fill a confirmation a cancellation or an error occurs Graybox can play a sound for confirmati
66. of Use Delta from MKT Use from MKT Then you define Value from the drop down menu of Value HOLD BROTHERS Success is how fast you get there Graybox User Manual v3 63 52 You can then set Stop Trigger from the drop down menu of Stop Triggered By The menu consists of Last Print Bid Ask and Last print Primary Exc Finally you can define the destination exchange from the drop down menu of Destination The menu consists of BELZ SOES NYSE Direct SOES AMRO SOES and SMART ORDER 5 9 Showing or Hiding Parts of Graybox Main Window You can set the viewing parts of Graybox main window To show or hide parts of the Graybox main windows 1 Click View in the main menu and select the options from the dropdown menu Options of dropdown menu are O O O Notifier shows all system messages related to Graybox Hedges monitor Locates monitor shows the stocks available for the trader which can be the deciding factor for the short sell of those stocks Messages shows or hides the Incoming Messages such as login logoff to the server connectivity status and emergency messages and so on Positions shows or hides the Position window which shows your positions and your current available buying power Executions shows or hides your executions Market Clock shows or hides the market clock Menu shows the menu at the top of the Graybox Active Order window Status Bar shows or hides the ECN Status Bar which shows the
67. on Graybox has a set of default sounds or you can use any wav file of your choice To set the sound for trading events 1 Right click the Active Order window The Graybox menu appears 2 Select Setup then Sounds The Sound Setup window appears Sounds Execution Partial Fill Confirmation Cancelation Error Bullets Conce Figure 51 Sound Setup Window 3 For each event that you want to associate a sound with a Click the he button next to the event A list of sounds appears b Select the required sound c Click OK 4 Repeat this step for each event that you want to associate a sound with 5 When you are finished with assigning sounds click OK To protect your trading application from unauthorized access you can change password as often as you wish To change your password See 2 4 Changing Password HOLD BROTHERS Success is how fast you get there Graybox User Manual v3 63 55 5 14 Changing Server and Router Settings You can change the Server and Router settings of your Graybox application Every configuration setting made in the System Configuration window is saved to the data base and could impact trading Please take trade tech Support assistance while configuring this window To change the settings 1 Right click the Active Order window The Graybox menu appears 2 Select Setup then Servers The System Configuration window as shown in Figure 52 appears
68. orders 4 7 Manual Order Entry Window 1 On the Graybox Main window select New gt Manual Order Entry The Manual Order Entry window appears as shown in Figure 31 Order Details Order Side Qty Type Stop Limit Price SENG Figure 31 Manual order entry 2 Enter the following information o Order Side Select the type of order either Buy or Sell o Quantity Enter the order quantity o Symbol Enter the required stock symbol o Price Select the order price o Type Select the order type o Time In Force Select how long the order is valid See 5 1 3 o Destination Select the destination exchange 3 Click Send HOLD BROTHERS Success is how fast you get there Graybox User Manual v3 63 39 5 Graybox Configuration The configuration of the Graybox is done through the Trading Options window by setting up smart order routing dynamic smart orders and keyboard shortcuts 5 1 Configuring Trading Options You can configure your Trading Options through the Trading options window You can set Order Display Mode for different exchange orders IOC Mode for different orders Display Size Defaults Default Qty Per Stock and Different Trading Options Every configuration setting made in Trading Options is saved in a central location and provides for a roving profile However the display elements are saved as part of the local layout and they must be transferred in order to maintain the same look and feel
69. others has placed over 70 man years of programming into Graybox 13 Do you offer tech support for Graybox software Yes Contact support hold com helpdesk hold com or call 646 745 2222 14 What kinds of securities can Graybox software handle Our Graybox software enables you to trade NASDAQ and NYSE and AMEX listed stocks 15 What trading styles can Graybox software handle Scalper momentum position rebate and swing We haven t met a style we couldn t handle HOLD BROTHERS Success is how fast you get there Graybox User Manual v3 63 91 16 Can I use third party quotes with Graybox software Yes Graybox software currently links to eSignal Contact us Support hold com for details 17 What if my quotes in market maker window are stuck Use the option to reconnect to servers when your quotes are stuck This is available from the menu Configuration gt Reconnect All Use Primary Settings or Configuration gt Reconnect All Use Secondary Settings from the Graybox active order window HOLD BROTHERS Success is how fast you get there Graybox User Manual v3 63 92 8 2 Graybox Installation 8 2 1 Computer requirements Big is good Faster s even better Graybox is available in 64 bit and 32 bit versions and is compatible with Windows 7 Vista Windows XP and Window 2000 Intel Core 2 Duo 2 4 GHz or higher 4 GB RAM VGA adapter with a minimum of 128MB on board video memory
70. pertes Background E Foreground Trend Line Color lei Candle Stick Up Color Candle Stick Down Color ok va Figure 81 Color Settings Apart from Series and Color the Weight Dropdown menu consists of the following options o Thin o Med o Thick o Very Thick Other options such as the background foreground and trend line colors can be chosen along with the colors specific to the chart 6 4 8 View Chart Data You can view the chart data in the case of Bar Chart To view the chart data Right click on chart window and select the view chart data See Figure 82 1274 97 15 31 DU 5 174 97 15 32 00 L5 145 2 125 15 15 33 00 be 125 25 15 34 00 be 125 125 26 15 35 00 5 4 175 125 42 15 36 00 15 45 5 125 355 15 37 00 moo 125 42 125 35 15 38 00 1 40 125 40 125 352 125 58 15 39 00 15 39 125 50 125 59 125 40 15 40 00 1 40 125 45 125 357 125 38 15 41 00 CA 125 35 125 23 125 26 15 42 00 125 36 125 20 125 36 na eshnin 15 43 00 195 af 175 51 175 46 125 49 Figure 82 Chart Data Point HOLD BROTHERS Success is how fast you get there Graybox User Manual_v3 63 6 4 9 Draw Trend Lines You can draw trend lines over the chart to indicate a trend To draw a trend line 7 Right click on chart window and select Draw Trend Line or click on the Trend Line Icon See Figure 83 E DESS E Draw IJAN Hour em Minute R Remove Remove All Figure 83 Draw Trend Line 6
71. ref Buy Pref Sell and Pref Short Sell options open the Preference window as shown in Figure 25 BATS GES eren C PRELOAD Cancel BO Figure 26 Preference window HOLD BROTHERS Success is how fast you get there Graybox User Manual v3 63 34 You can open the Preference window using shortcut keys set in Keyboard configuration Hote To enter an order in Preference window 1 Open the required Preference window 2 Enter the Symbol Price and Quantity 3 Increase decrease the price in steps using the Step list A Select the routing exchange execution platform routing strategy and order type Select PRELOAD to load data 6 Click Buy Sell Short Sell based on the preference type to submit the order LP 4 4 Trailing Stops Buy Sell Trailing Stop Loss Buy is a useful stop loss order You can set stop loss price at some fixed price percentage below the market price When the stock price rises the Stop Loss Buy price rises proportionately When the stock price falls the stop loss price remains the same ands gets executed at match price See Figure 27 Trailing Stop Loss Sell is a useful stop loss order You can set stop loss price at some fixed price percentage below the market price When the stock price rises the Stop Loss Sell price rises proportionately When the stock price falls the stop loss price remains the same ands gets executed at match price See Figure 27 Trailing stop setup
72. s field 9 1 4 10C Mode This box enables you to configure settings for Immediate Or Cancel Mode All your orders are filled either immediately or cancelled The default value can be set for each ECN Exchange supported by Graybox e IOC All Orders go out as Immediate or Cancel If the ECN has a match in their books the order gets filled or else the order is automatically cancelled e Normal Orders are sent out with the default Time In Force This allows the ECN to be proactive in the order matching and forward orders to SNET or other ECNs if a match is not found in the books This feature can delay cancel orders at times e Automatic This allows Graybox to determine whether orders go out as IOC or Normal By default all orders that post liquidity are sent out as Normal and all orders that grab liquidity are sent out as IOC For example all Buy orders above the offer go out as IOC while all buy orders under the offer go out as Normal HOLD BROTHERS Success is how fast you get there Graybox User Manual v3 63 5 1 5 ECN Exchange Routing Mode You can set your ECN Routing Modes here RASH Routing Mode Listed e RASH Routing Mode oTc DS Default SDOT Use NYSE HBES Routing Default AMEX Use Default BESS Use ARCA Routing Mode EDGA Routing Mode EDGA Routing Style EDGY Routing Mode EDGY Routing Style BATS Routing Mode CSFB Routing Mode MNSXS Routing Mode DTTX Routing Mode
73. ser Manual_v3 63 Figure 45 Figure 46 Figure 47 Figure 48 Figure 49 Figure 50 Figure 51 Figure 52 Figure 53 Figure 54 Figure 55 Figure 56 Figure 57 Figure 58 Figure 59 Figure 60 Figure 61 Figure 62 Figure 63 Figure 64 Figure 65 Figure 66 Figure 67 Figure 68 Figure 69 Figure 70 Figure 71 Figure 72 Figure 73 Figure 74 Figure 75 Figure 76 Figure 77 Figure 78 Figure 79 Figure 80 Figure 81 Figure 82 Figure 83 Figure 84 Figure 85 Figure 86 Figure 87 Figure 88 Figure 89 Figure 90 6 Super ECN Key Setup WINGOW EE 48 SWIDE SEUD VIG e EE 49 Key Map Configuration WindOW cccccccceee eect teste eee eee eeeeeeeeeeaeaaaaaanaaanags 50 Trailing Stops Setup WINGOW EE 51 glat eg e EE 53 Color Options WiNGOW ccceccee cece cece eeeeeeeeeeeeaaaeaaeeaeeeaeeeeeeeeeeeeeeeeeeeeenengs 53 Sounda SetuP Kn e e TEE 54 System Configuration WiINKOW NN 55 ACS I Orde EE 57 Cancel Replace Orders HotkeyS ENEE NEEN ENEE NEEN 58 Market Maker le Tele TEE 59 Market Maker View Setting Men e ENEE EEN NEEN EEN 60 Market Maker Window for Level 1 Display 61 ECN Books Configuration WiNGOW cccccccccee cess tees tees eeeeeeeeeeeaaaaaaaaaaaaas 62 Hi Lite Market Makers WiNndOW s ssassasnssannsassnsasnnsnnsnsnnsnnsnsnnsnnnnnnnnnnnnnn 62 Ignore Market Maker Quotes WINCOW sssssssssssssrsnsnrsrrnnrnrnrrnrnenrnrenrrnenne 63 Market Maker Window for Sort amp Round Ouotes
74. sition summary column headers 1 Right click the Position window and then click Summary Setup The Summary setup widow appears as shown in Figure 12 HOLD BROTHERS Success is how fast you get there Graybox User Manual_v3 63 21 Figure 12 Customizing position summary window 2 Select the required column headers from Column Headers list Functions of the buttons are as follows o gt To move the selected column header from the Column Header list to the Selected list o lt To move the selected column header from the Selected list to the Column Header list o gt gt To move all the column headers from the Column Header list to the Selected list o lt lt To move all the column headers from the Selected list to the Column Header list o Up To move up the list o Down To move down the list 3 Click OK Position Close Out You can use this option to close the trading of a particular stock This option closes out the open position of a particular stock by selling longs and buying shorts at the current market price To close trading of a particular stock e Right click the Position window and then click the required Position Close Out option Close Out You can use this option to close the trading of all open stocks This option closes out all open positions by selling longs and buying shorts at the current market price You can configure the Graybox to the preferred close out positions To configure
75. stocks traded with very low volumes or not traded cone Figure 96 BoardView Refresh Interval Window HOLD BROTHERS Success is how fast you get there Graybox User Manual v3 63 84 6 6 Ticker TO open a separate Ticker e Click the in the Graybox main menu The right click option consists of the following options O O O O Setup Show Time Caption Always on Top Jet Cascade Format shows the option of Colors and Fonts Clear 6 6 1 Setting Up the Ticker To set up the ticker e Right click ticker panel and Select Setup Ticker Setup window appears You can Figure 97 Ticker Setup Window add symbols as shown in Figure 97 Show volume in 100 s You can Select either Jet or Cascade Format and insert them at Top or Bottom of the window See Figure 97 Ticker Setup Window Here Cascade mode and Bottom options are selected Show Time Ticker in Cascade and Jet Modes are shown in Figure 98 and Figure 99 respectively HOLD BROTHERS Success is how fast you get there Graybox User Manual_v3 63 85 Figure 99 Jet Ticker 6 7 NYSE Open Book NYSE Open Book provides a real time view of the Exchange s limit order book for all NYSE traded securities Through the NYSE Open Book you can see aggregate limit order volume at every bid and offer price and the depth of market data To open the NYSE Open Book e Click on the icon in Market Maker window or click the i
76. t the market you want to view for the ECN Book See Figure 58 HOLD BROTHERS Success is how fast you get there Graybox User Manual v3 63 62 NASDAQ GH NSDQ Full None INET Not Entitled O oO CO Optimized Data ARCA Book Inside R None Optimized Data BATS Book OH Inside Full None EDGX Book Inside Full None EDGA Book Inside Full None NYSE Open Not Entitled O O O Cl Show LRPs in the Level Montage Cl Ignore Regionals Cancel _No Books Figure 58 ECN Books Configuration Window 6 1 2 2 Highlighting a Particular Market Maker You can highlight a particular Market Maker This draws attention to the spurt in the movement of the stocks To highlight a particular Market Maker 1 Select Hi Lite MarketMaker in the Market Maker menu Hi Lite MarketMakers window appears Figure 59 Hi Lite Market Makers Window 2 Select the Market Maker and then Click gt gt to move the selected Market Maker to Hi Lite You can select and highlight multiple Market Makers Repeat step 2 for each Market Maker you want to highlight 3 From the dropdown menu of Style field select either black or red as the highlighted color 4 Click OK to save HOLD BROTHERS Success is how fast you get there Graybox User Manual v3 63 63 6 1 2 3 Ignore Market Maker Quotes You can clear the Market Makers and ECNs from Graybox display This does not remove them permanen
77. t the symbol in the list e Click the Move Up or Move Down button as many times as necessary 5 2 1 Split Order by Display Size You can split an order by display size It breaks up your order if the volume is shown on level two is less than the size of the order you are sending For example if you send a Sell Order for 2000 shares and INET shows 800 shares the order is split up so that 800 shares goes to INET and the remaining 1200 goes to the next ECN and SO On You can also specify at what price the order should be sent out above the Inside Market by adjusting the delta value EN Hote You can remove an ECN or Market Maker from the list To remove an ECN or market maker from the list 1 Select the symbol in the list 2 Click the Delete button You can clear the list and start over To clear the list click the Clear button 5 3 Dynamic Smart Orders Dynamic smart orders work with the same settings as regular smart orders with the following exceptions e Dynamic order sends out all orders as IOC orders e Dynamic order sends out the orders again at the same price or raises the price up to 5 times if the orders are cancelled or rejected 5 4 The Super ECN Key The Super ECN key default Alt 1 sends orders out to all ECNs listed in the setup box Shown in Figure 45 at the price specified in the Preference order box You can send a NSDQ NYSE limit or market order for the size specified in this setup box To
78. thing displayed in the messages window it means no transaction whatsoever has taken place for this trading day For more details on the status of an order double click the order The Order Details window Order Details Window3 1 1 shows the status and the error message if any 3 2 1 View Selections You can narrow down the incoming messages that are displayed in the Messages window There are four tabs available in the Messages window They help you in viewing the required incoming messages Based on your trading needs you can select one of the following tabs All To view All orders Execs To view only executed orders Following are the columns in the Messages window at HOLD BROTHERS Success is how fast you get there Graybox User Manual v3 63 18 Time Time when the order is executed or cancelled Status The exchange and status of the order Cancel indicates that the order is cancelled Executed indicates that the order is executed You can adjust the column width by using the mouse Note 3 3 Position Window The Position window displays your stock position details This window is divided into two parts The upper part of the window displays a detailed stock position and the lower part displays the summary Positions ERT zee Figure 9 Position window Figure 9 Position window shows long positions in green and short EA positions in red Hote The upper part of the Position window
79. tions column 1 Select Show Executions in the ECN Book menu 2 Select Show Cancels in the ECN Book menu 6 3 4 Filtering ECNs in the ECN Book You can filter ECNs in the ECN Book To filter ECNs in the ECN Book 1 Select Filter in the ECN Book menu The ECN Book Filter window appears See Figure 73 Filtered List ECN oo rage e Figure 73 ECN Book Filter Window 2 Type the name of the ECN in the ECN field then Click Add The added ECN appears in the Filtered List field 3 Click OK To remove any ECN from the Filtered List e Select the ECN Click Remove and Click OK 6 3 5 ECN Book Window Always On Top You can place the ECN Book window Always On Top of any other windows or screens To set the ECN Book window appear Always On Top Select Always On Top in the ECN Book menu 6 3 6 ECN Book Window Aggregate by Price You can set the ECNs on price aggregate For example instead of viewing all the INET bids at a particular price you can view one bid with the volume aggregated for ECNs 6 4 Charts You can view the movement of the stock through different charts such as tick bar candle line and day charts For example Tick chart view of IBM stock is as displayed in Figure 74 To open charts Click the H icon in the Market Maker window and select the appropriate chart view from the dropdown menu for your chosen stock HOLD BROTHERS Success is how fast you get there Graybox
80. tly When you reload the box they re appear If you select Ignore All Crossed Quotes then all quotes that do not match with the level 1 data are automatically ignored Ignores EDGY MSCO NSDO SBSH Ignore All Crossed Quotes Cancel OK Figure 60 Ignore Market Maker Quotes Window You can also save the list of Ignored Market Maker in the Graybox layout To get back the Ignored Market Makers e Open Ignore MarketMaker Quotes window and remove the required Ignore Market Makers from the Ignores list To move the MarketMakers from Ignores to Visible box individually e Select the required MarketMaker and click lt To empty the Ignores list e Click lt lt 6 1 2 4 Sorting and Rounding quotes in the Market Maker Window You can customize the order of the MarketMakers and ECNs by sorting SeeFigure 61 If you select Volume the MarketMakers and ECNs are shown in the order of highest volume Similarly the quotes can be rounded off to the nearest selected value ES p Sort t None Alphabetical Round Quotes Round Quotes Volume Hi Lite MarketMaker Ignore Market Makers Configure ECN Books Open Yahoo Finance Set as Default Enable Def Qty Override d Always On Top Hi Lite MarketMaker Ignore Market Makers Configure ECN Books Open Yahoo Finance Set as Default Enable Def Qty Override vd Always On Top Figure
81. u point to Cancel and then click Selected Order Or Press F12 key routed to the exchange For cancellation confirmation click in the Messages window and verify if the order is actually cancelled SelectNet orders must be active for at least 10 seconds before they are canceled A Orders may still be filled while they are being cancelled or before they are EN Hote To cancel all orders e In the Graybox main active order window click Trading menu point to Cancel and then click All Orders Or e Press Ctril F12 This is the default keystroke The button on the number pad cancels all orders in a selected stock To cancel all orders for a selected stock 1 Select the stock so that it appears in the Graybox main window 2 Onthe Trading menu point to Cancel and then click All For Selected Stock HOLD BROTHERS Success is how fast you get there Graybox User Manual v3 63 38 Or Press F11 This is the default keystroke To cancel all buys for an individual stock 1 Select the stock so that it appears in the Graybox main window 2 On the Trading menu point to Cancel and then click All Buy Orders Or Press the Shift F12 This is the default keystroke To cancel all sells for an individual stock 1 Select the stock so that it appears in the Graybox main window 2 On the Trading menu point to Cancel and then click All Sell Orders Or Press the AIt F12 This is the default keystroke 3 Canceling SNET and SOES
82. ure 93 Load from Analytics VWindow 82 Figure 94 Column Headers for BoardView NENNEN EEN EE 83 Figure 95 BoardView Setup General WINGOW cccccccccceeeeeeeee eens teen eee eeeeeseeeeeanaaaanes 83 Figure 96 BoardView Refresh Interval WiNdOW s ssssssssssrsrrsrrsnrsnrenrrnrrerrenrrrrerrrna 83 Figure 97 Ticker Setup tele TEE 84 Figure 98 eet EE 85 Figure 90 te EE 85 Figure 100 NYSE Open BOOK VIDEO ess dE E EES NEE ES ee EK e E EN 85 Figure 101 Hedges and LocateS WiINdOW cc ccccccccccceceeeeeeeeeee eee e teen eee eeeeeeeeeaeanaaaaees 86 Figure 202 Maier ee EE 87 HOLD BROTHERS Success is how fast you get there Graybox User Manual v3 63 8 1 Introduction Graybox trading software application from Hold Software com Inc is a state of the art trading software that is easy to configure Using Graybox you can send multiple orders to every ECNs at different prices with a single keystroke and in less than a second of your time Graybox is power packed with features such as dynamic and static smart orders blasting super ECN ordering and adjustable close out features e Direct access to NASDAQ ECNs NYSE AMEX and access to Dark Pool Providers e Scientific Analytical Charts and Tools for effective market monitoring e Personalized Position Manager to monitor and adjust your positions instantly e The Graybox quote display a quote monitor for market makers and ECNs Your Graybox is easily customizabl
83. uter Settings 55 S Setting the Colors 53 Setting the Font 53 Setting the Sounds 54 Setting Up Keyboard Shortcuts 50 Setting Up Smart Order Routing 45 Showing Hiding the Time 65 T The Super ECN Key 47 48 Ticker 11 23 84 85 Trading 11 25 28 30 33 37 38 39 41 48 50 56 94 Trailing Stop Order 51 U user entitlements 14 HOLD BROTHERS Success is how fast you get thoro
84. w HOLD BROTHERS Success is how fast you get there Graybox User Manual_v3 63 15 3 Graybox Windows Graybox contains many windows that display order details order status and so on 3 1 Active Orders Window The active orders window displays your active live pending orders in the market dt Graybox Locked el ld Zem File Edit View Mew Trading Tools Configuration Help Oe ER E H A E S Be E Cancel ee ALS Type Symbol Qty Price Since Status T Figure 6 Active Order window EN For Active orders window menu details see 3 1Active Orders Window OD Note Following are the columns in the Active order window Sym Stock symbol Qty Number of shares to buy or sell Price of the stock Since Duration in hours minutes seconds from the time the order has been accepted by the exchange HOLD BROTHERS Success is how fast you get there Graybox User Manual_v3 63 16 Status The exchange and status of the order New indicates that the order is just entered Floating indicates that the order is floating Partial indicates that the order is partially filled Cancel indicates that the cancel order is sent Auto Cancel indicates that the application is attempting to cancel the order TRL Stop indicates that the order is a trailing stop order Time in force After an order is completely filled or canceled it moves to the Messages window If an order is rejected it is immediately removed
85. work without having the Preference window or the Listed Trading window open The orders go out at the current Inside Market which are the best inside ask for buys and the best inside bid for sells short sells They use the same setting as used by the other Super ECN Keys Z n The keystrokes are disabled by default and can be assigned using the KeyMapConfig Window in the MarketMaker tab Hote 5 6 Multiple Swipe Keys Swipe orders do not go by the best NASDAQ bid offer but go at the increment based on the best bid offer for the specific ECN or the Inside Market The order is placed on top of the specific ECN book or Inside Market HOLD BROTHERS Success is how fast you get there Graybox User Manual_v3 63 49 ECN swipe keys are commonly referred to as Shave Keys You can configure five sets of ECN swipe keys You can send orders at a specified differential factor above below the best Bid Offer for a specified ECN To launch this order the preference box need not be open but the keys need to be enabled separately in the keymap configuration For each Bid Offer sent to an exchange a factors set for inside the market etc executions this maximum factor acts as the referral point Swipe amp Delta Keys Setuy Supe Swipe Swipe Exchange Swipe Exchange Swipe Factor Swipe Factor Swipe Based On Swipe Based On Swipe Swipe 5 Swipe Exchange Swipe Exchange Swipe Factor Swipe Factor Swipe Based On Swipe B
86. y s close e Vol Total volume of shares traded e Imb Market and Market on Close imbalances HOLD BROTHERS Success is how fast you get there Graybox User Manual v3 63 60 e Bid amp Shr Highest Bid and number of shares bidded for e Ask amp Shr Highest Ask and number of shares on offer e Cls Previous day s closing price e Int Percentage of Imbalances with respect to volume traded e Opn Day s opening price for the stock e OBI Open Bid indicator shows the approximate bid value e Low amp Hi Lowest and highest prices the stock is traded for the day e Time Last traded time e OAI Open Ask indicator shows the approximate Ask value e Thermograph Indicates volume trend Green indicates higher volume in Ask orders while red indicates higher volume in Bid orders You can change the display in Market Maker view for Level1 Level2 Thermograph and Prints To change the display Select Deselect Level1 Level2 Thermograph and Prints depending on the view you want to set wd Level 1 Market Depth Round Quotes EE d Level Hi Lite Markethlaker vd Prints Ignore Market Makers Mini Order Entry Configure ECM Books Order Entry Setup Toggle states wd Show Mihi Buttons wd Show Tool Bar set as Default vd Show Title Enable Det Qty Override v Always On Top Open Yahoo Finance For the active symbol in Market Maker window Market data can be accessed by
87. y the required columns of the upper part of the Position window To customize the column header 1 Right click the Position window and click Column Setup The Column setup window appears as shown in Figure 11 HOLD BROTHERS Success is how fast you get there Graybox User Manual v3 63 20 Column Headers Selected sym r Qty E _ lt lt Ee Cancel Figure 11 Customizing upper Position window 2 Select the required column headers from Column Headers list The functions of the buttons are as follows o gt To move the selected column header from the Column Header list to the Selected list o lt To move the selected column header from the Selected list to the Column Header list o gt gt To move all the column headers from the Column Header list to the Selected list o lt lt To move all the column headers from the Selected list to the Column Header list o Up To move up the list o Down To move down the list 3 Click OK Column headers Position summary You can customize the position summary window If you do not wish to view the column headers e Right click the Position window and then click Show Hide Header See Figure 12 Repeat this procedure to view the position summary column headers You can customize and view only the required columns of the upper part of the Position window You can customize and view only the required columns in the position summary window To customize po

Graybox™ - Trade-UA

Contents

Download Pdf Manuals

Related Search

Related Contents

Graybox&trade; - Trade-UA

Contents

Download Pdf Manuals

Related Search

Related Contents

Graybox™ - Trade-UA