Home

Manual - MidNite Solar

1. eene nennen 58 Battery voltage muhtinmeso line uuu oae bt ans aaa UM vided aldaaubs ined aaa a uM deuda dedu tus 61 Using MNGP Remote to Programa Classic Literae aa eau eM 62 Programming the Lite with a Networked Standard Classic 62 Programinne the Lite Wii the Local AP Ps set ostene aaa sha aasawa tide utat tin Rees cauti tide stan tia ut te Ere 62 ER Ql eode E NAA A austen A E Aes E AE VEAR E NE A EE AR amawata LEM 62 Notes ese Lilaea a a a SED ENE RR aka th aaa 62 Explanations of Solar and LegACy u uu yy St i se a ie mde edi uad e e IMEEM valide ees eM I M des 63 6 Page 10 001 1 REV G Classic owner s manual RevG 2056 Uploading New Firmware to the Classic 63 Connecting the Classic to the Internet nnns nnne eene nnns 66 NE ROERE ua ann m u adem u detta nitet tdm dante pnto td a ctf mta 66 Network Setup through the MNNGPD uir e a e pec etae eset ih e ee iare er Ais n Mee UE aep Dudes 68 WS DNC CES PROMIT c s SEEDEDE ESTER 69 LOCEN ROR E e ES ae ren ERE Med Rin EN su iha a ey MEM Mene I M atm 70 Positive Ground systems u u ls aa sasan
2. e MA SCS e MA SCS MA In order for the Classic to read the new settings you must power cycle the Classic Do this by turning the DC source PV Wind or hydro etc breaker off Then turn off the external battery breaker Than simply turn the 2 breakers back on starting with the battery breaker View Faults and Warnings The Classic has some helpful safety features including the GFP Ground Fault Protection and AFD Arc Fault Detector When one or more faults are detected the Classic will stop outputting power and display a fault message in the bottom right corner of the home screen STATUS View Logged Data The Classic logs 380 days worth of data in its memory The data logging in the Classic has two modes and frequency of data capture DAILY HISTORY Is captured once each day and is saved at night after 2 hours of no activity when the PV input voltage is below battery voltage for solar or 1n modes that do not necessarily rest at night like wind or hydro the capture will happen once every 24 hours Data logged each day is kilowatt hours Float time in hours and minutes the maximum power output for the day maximum FET temperature inside the unit maximum PV or input voltage and maximum battery voltage for the day HOURLY HISTORY Also referred to as Short term History is captured once every five 5 minutes anytime the Classic 1s not resting when it 1s charging Data logged every 5 minutes is powe
3. Classic owner s manual RevG 2056 setting the MNGP features The Classic comes with an integrated MidNite Graphics Panel MNGP which is the primary interface to the Classic Setting up contrast backlight and volume is simple just follow the steps below Push the Main Menu button Scroll left or right to highlight Misc and push the Enter button Use the left and right arrow keys to select the feature to set and press the Enter button Press the up and down buttons to adjust Press Enter to save MA e MA MA e Use the diagram below for MNGP reference Figure 19 Screen name Communication indicator Menu name USB activity indicator Menu BATTERY CHARGING PARAMETERS description Current limit lt lt lt gt gt 13 indicator Right soft key we Tire RE Right arrow key Left soft key Left arrow key Main Menu Status screen Enter button Down arrow key Navigating the Menu Push MAIN MENU Push right and left buttons to see the different menus To return to the status screen push STATUS button To navigate from one end of the main menus to the other end push the top right or left buttons Below the name of the menu is a description of the menu Pushing the left and right buttons will enable you to see all the main menus provided Inside some of these main menus will be sub menus to adjust the parameters of the selected feature Here is
4. Low rs amp T Delay L Hold Waste Not Low V Low fy High Delay OT AUX 1 CONTINUED Hold To Aux 2 on next page MODE MENU ON OFF ON OFF Function U Set VOC L R PV vocw Losa Dynamic L R Interval Minutes Wind Track L Graph Volts Amps L MNGP Memory Legacy P amp O L R Interval Minutes L _ Depth Watts Solar L R Interval Minutes Hydro L F interval MPP V Min V RF Symbolizes pushing the Right Soft Key D Symbolizes pushing the Left Soft Key AUX 1 CONTINUED Waste Not High R r V Low fy High T Delay Hold Low Bat Discon P Tumar sat r Delay Diverson R V Low fy High i nee Hold 10 001 1 REV G Classic owner s manual RevG 2056 CLASSIC MENU MAP B Symbolizes pushing the Right Soft Key 87 Page MidNite Solar Inc Continued from previous page AUX MENU Aux 2 Manual Off Manual On Diversion Hi bre Diversion Low di ioc Waste Not Hi amp T saca Waste Not Low T d Toggle Test PV V On High nn PV V On Low DI Clipper Control Volts Logic Input 1 Logic Input 2 Force Float In Whizbang Junior MISC MENU 3of4 LED Mode Time PWRSV Off Rick Mode Blinky LED 1 Comm Test Backlight R Adjust Backlight Contrast R Adjust Contrast Volume E Adjust Volume Extras Enter Password Play Off Rick Mode
5. it the Controller will never wake up in colder weather Graphics Panel MNGP Programming Menu Options Details Most settings can be accessed and modified Navigate using the LEFT amp RIGHT Arrows Pressing ENTER takes you into that menu The MAIN MENU Button also backs you out of any submenu Use the soft keys for options amp views Be sure to press ENTER to save changes before backing out of any menu submenu 71 Page 10 001 1 REV G Classic owner s manual RevG 2056 Troubleshooting FAQs How do I do a software Note this only works on the Classics with Displays not a Classic Lite with the Factory Restore on my MNLP LED Panel Classic or Classic SL Warning this will erase ALL settings Turn the PV breaker and Battery breaker off What you don t have a breaker Get one asap and make sure the display has gone dark Hold the left and right arrow and turn on JUST the battery breaker Continue to hold the arrow buttons until you see the Quick Start pop up Follow the on screen prompts to set up your controller WARNING You must get the battery charging voltages from the battery manufacturer and it is VERY important you do this and do not just leave it as default settings as it 1s likely this will undercharge and slowly destroy your batteries WARNING The Clock is a 24 hr clock Setting it off by 12hrs will cause it to reset to a new day at Noon How do I do a Warning this will erase ALL settings HARDWARE factory Tu
6. 10 001 1 REV G My Label is gone or I mixed up my covers how do I know what model Classic I have I can t read my serial sticker how can I find my serial How do I know what Nominal voltage my Classic is programmed for I have Aux programmed properly but I cannot get 12v out of it when I should I was in the middle of a firmware update and the update got interrupted what do I do Can I use wind and solar on a single Classic Can I have more than one Classic on a single battery Do I have to shut off my Classic if I have a different charger charging 79 Page Classic owner s manual RevG 2056 You can remove the cover and look at the stickers on the big yellow inductors on the left side of the circuit board You can press the status button several times and the Classic will say Connected to Classic xxx on one of them this is your model Press the status button several times and a screen will come up saying Connected to a Classic xxx in the bottom right corner is the serial number it will start with a CL Press the status button several times and a screen will come up saying Connected to a Classic xxx to the right of this it will say the battery voltage it is programmed to Example 48v Most likely the Jumpers on the bottom left corner of the circuit board are set for a dry relay not for a 12v signal See the Aux portion of the manual for help with that No problem simply start over with the u
7. 93 00 002 002 oog 081 081 081 081 091 091 091 091 Orl Ori Orl eu ora ora Ocl Ocl OZ OZ OZ Cra Ocl Ocl OLL OLL OLL 001 001 001 06 06 06 OZ OZ OZ CL SP Vc el CL SP v a CL ov v L CL 9v Vc cl CL ov V cl ov vc c 8p Vc cl ov Vc L 8p V Cl SP Vc cl ov v L v Indul Xe 7L 0L 9zis SIMA OGA091 Puqindino vindinoxej omejjino u OOA 10u A lddW Aa OGC 9ISSE OGC 9ISSE OGE SISSEL OGC 9ISSE OGC 9ISSE OGC 9ISSE OGC YISSB O OGC 9ISSE Q0c ISSE Q0c 9ISSE Q0c YISSe O Q0c 9ISSeE Q0c 9ISSE 00 9ISSE Q0c 3ISSE Q0c YISSe O Q0c 9ISSE QOc YISSE D Q0c ISSE Q0c 9ISSE Q0c 9ISSE Q0c 9ISSE Q0c 9ISSE OG SISSE OG SISSE QG vISSe O OG SISSE OG 9ISSE OG SISSE OG 9ISSE OG 9ISSe D OG SISSE OG SISSE OS YISSe O OG SISSE OG 9ISSE OG SISSE OG IISSE D BPO Table 12 Classic owner s manual RevG 2056 Classic Menu Items Status Charge Mode Aux Misc Logs Tweaks Temps and Net STATUS MENU Main Status One KWH IN Main Status Two Ahr IN BAT Main Status Three VOC V Amps IN BAT Whizbang Junior Shunt Capacity P eL ass 3b D Lifetime AH Reading Short Term History Power Ww 00 00 Log Moon Scope V In V Battery About Classic Software Version Nominal Battery V Classic Version R Symbolizes pushing the Right Soft Key D Symbolizes
8. All communications between the Classic and MidNite Solar s server are encrypted using a strong session based algorithm To respect your privacy however it is required that you manually enable this feature if you d like to use it In order to enable the web access feature e Press Main Menu e Scroll to NET menu and press the Enter button e Using the soft keys navigate to the ADVANCED menu NET NEXT ADVANCED e The Web Access option should be highlighted e Use the up down keys to enable or disable the feature e After saving the change you will need to reboot the Classic by removing PV power and Battery power with the 2 disconnects and waiting for the screen to go dark Wait 30 seconds and re apply PV and Battery power Note that the Web Access selection indicates the current setting of the feature 1 0 ENABLED means the feature 1s currently in operation Note also that you will need the values MA and DI handy in order to create an account on the My MidNite web site This unique number pair identifies your particular classic to our server and helps to prevent malicious users from trying to access your Classic The DI or Device Id is different than your Unit s Serial Number Local Network Note that your Classic identifies itself by name to DHCP enabled routers as Classic There is facility to change the name of a given Classic via the local and web based interfaces as well as using third party MODBUS software packages Advance
9. should be highlighted use the up or down arrow to change it to ON and press Enter Press the Status button once to return to the main status screen Note This 1s the same menu you would use to change between Charging algorithms IE Solar Hydro Wind etc Adjusting Absorb Equalize and Float Voltages Absorb Equalize and Float voltages are fully adjustable You will need to get the actual voltages from the battery manufacturer To adjust these voltages follow the steps below e Press Main Menu to enter the Main Menu Scroll right or left until Charge is highlighted and push the Enter button Highlight Volts and press the Enter button Use left and right arrow keys to highlight the set point voltage to adjust Use up and down arrow keys to lower or raise the voltage Press the Enter button to save the new voltages e MA MA MA MA e MA Current Limit The Classic has a current limit component which interacts with the temperature of the charge controller If the Classic 1s exposed to extremely hot ambient conditions the output current will be reduced automatically to keep the charge controller safe If the orange LED comes on the MNGP it means that the Classic is In current limit mode If you believe the Classic is not hot and the orange LED is on most likely the current limit set point 1s too low To check this follow steps below e Press Main Menu Highlight the CHARGE menu and press the Enter Bu
10. 66 Page 10 001 1 REV G Classic owner s manual RevG 2056 4 Port Switch Router Example 1 Local network through switch In some cases you may be able to connect Classic directly to your PC however this is not a recommended topography Wireless Bridge YZ Wireless Router Access Point Example 2 Local network through wireless bridge Wireless enabled Wireless Router computer Access Point SS A Example 3 Local wireless network 67 Page 10 001 1 REV G Classic owner s manual RevG 2056 Wireless Bridge Wireless Router Wireless enabled Access Point K computer Sz Example 4 Local wireless network through wireless bridge There are many different configurations possible when it comes to networking that are beyond the scope of this manual The basic ones in the above figures should help get you going Network Setup through the MNGP The Classic s Ethernet capabilities may be configured using the Network menu on the MNGP From the main menu select NET There are three screens that configure network settings Table 9 decodes the descriptions from the MNGP s small screen MNGP Long hand Description S O IP address configuration The Classic supports both static and dynamically DHCP allocated mode DHCP Static IP addresses If you are unsure which to choose try DHCP first If you have trouble move to the troubleshooting section IP IP Address The Net
11. 0 for this field Gateway This is the address of your router or modem the device which is connected directly to the Internet proper It will usually take the form 192 168 0 1 1 or 10 0 0 1 depending on your network configuration and hardware Check your router settings or ask your network administrator which local address to use Also refer to the troubleshooting section for tips DNS 1 The DNS is the means by which human readable internet addresses are resolved to actual IP addresses on the network These values can usually be set identically to the gateway address depending on your network hardware If your ISP provides you with specific DNS servers then use those addresses in these fields instead Example 1 Your gateway is a DSL modem with address 192 168 1 1 If your ISP has not given you explicit DNS servers to use then set the D1 field to 192 168 1 1 Example 2 Your gateway is a cable modem with address 10 0 0 1 Your ISP has specified primary and secondary DNS server addresses of 11 22 33 44 and 11 22 33 55 respectively Set the D1 address to 11 22 33 44 and the Web Access MidNite Solar will be offering a free web service with which you can access your Classic from a web page from anywhere in the world simply by pointing your favorite web browser to https www mymidnite com 69 Page 10 001 1 REV G Classic owner s manual RevG 2056 Instructions on setting up your My MidNite account can be found on the above webpage
12. 12v Aux 1 Function Graph shows the relationship between voltage and time of AUX 1 The axis labeled VOLTAGE could be battery PV wind input voltage etc depending on the function selected by the user VHIGH is the upper voltage limit as soon as the voltage reaches this limit the Delay time will then start as soon as the Delay time expires AUXI will change state and stay there until the voltage drops below VLOW set point then another timer called Hold Time will start and when this expires the output will go back to the original state 4A Page 10 001 1 REV G Classic owner s manual RevG 2056 LLI t O gt IDELAY TIME HOLD TIME TIME OUTPUT Diagram 4 Aux 2 Voltage Time Relation PWM The graph below describes the relation in Aux 2 between voltage and time The difference in Aux 2 is the use of PWM running at a hundreds of Hz rate and is suitable for use with Solid State Relays SSRs The way this works is user sets a desired threshold and a width voltage this means that at the desired voltage VOLTS the aux will start to PWM and it has to go above or below the width to completely change states from Ov to 12v or from 12v to Ov depending on the user selection active high or active low This gives a much smoother transition For more information see Configuring Auxiliary Input Output page 36 VVID I H IN VOLIS VOLTAGE lt O 7 OUTPUT Diagram 5 45 Page 10 001 1 REV G
13. Aux 1 on when it reaches a set point based on battery voltage V High and turn it off at another set point based on battery voltage V Low It also allows you to set a delay time in seconds the Classic will wait before turning Aux 1 on after reaching the V High set point It also allows you to set a hold time in seconds the Classic will wait before turning Aux 1 off after reaching the V Low set point Aux 2 Control Settings Float Low This mode will turn Aux 2 off whenever the Classic is in Float Aux 2 will stay off until the Classic falls 3 tenths of a volt below the float voltage set point 40 Page 1020011 REV G Classic owner s manual RevG 2056 Float High This mode will turn Aux 2 on whenever the Classic 1s 1n Float Aux 2 will stay on until the Classic falls 3 tenths of a volt below the float voltage set point Day Light This mode will turn on Aux 2 at sunrise and turn it off at sunset based on the PV input voltage Nite Light This mode will turn on Aux 2 at sunset and turn it off at sunrise based on the PV input voltage Clipper Control This mode was intended to control the MidNite Clipper It will send out a PWM signal on AUX 2 whenever the controller is unloading the turbine because the battery is full or close to it There are several adjustment in this mode to optimize the Classic Clipper combo please see the Clipper manual for full details Pv V on Low This mode is PWM based and is just reverse logic of Pv V Hig
14. IN IN 6V Forces Float LOGIC INPUT 2 IN lt 2V Resting or IN gt 6V Charge LOGIC INPUT 1 IN gt 6V Resting or IN lt 2V Charge FLOAT LOW Aux2 off when in Float FLOAT HIGH Aux2 on when in Float DAY LIGHT Aux2 on at dawn off at dusk NITE LIGHT Aux2 on at dusk off at dawn CLIPPER CONTROL PWM Control for Clipper Pv VON LOW PWM sig below Pv in setpoint Pv V ON HIGH PWM sig above Pv in setpoint TOGGLE TEST Aux2 cycled 1 sec interval WASTE NOT LO PWM divert rltv chg state lo WASTE NOT HI PWM divert rltv chg state hi DIVERSION LO PWM Divert on Bat voltage lo DIVERSION HI PWM Divert on Bat voltage hi To set change threshold voltage as well as time do the following When in the function you wish to use press the right soft button This will take you to the VOLTS menu here is where you set your threshold voltage Use the left and right arrow keys to navigate through the options Use the up and down arrow keys to raise or lower the threshold voltage To change the time press again the right soft button to get to the TIME menu In this menu do the same as you did in the VOLTS menu until desired adjustments are made Press ENTER to save vy v Vv Vv Vv NN Figure 3 0 3 0 Aux 1 and Aux 2 Graphs Jumpers Figure 3 0 shows the two Aux port terminals with their respective Polarities These terminals are located at the bottom of the Power board below the battery temperature jack Use a mini flat head screw driver to tighten the s
15. Verbose Audio 1 Audio 2 MNGP Address USB Mod MB Port Phone Jack Routing To enable SMA mode Time 00 00 00 Date 00 00 0000 Off Backlite Short Backlite Long 10 001 1 REV G Classic owner s manual RevG 2056 CLASSIC MENU MAP Am MidNite Solar Inc LOGS MENU TEMPS MENU L Remote FETS Daily Logs Hourly Logs Lifetime LW Hours Lifetime Amp Hours WB Jr Net Amp Hours WB Jr Pos Amp Hours WB Jr Neg Amp Hours GW X X X X DI X X XX IP X XXX MM X X X X SN X X X X Web Access Disable Enable Mac Address Device ID Hi Fet T Hi Vpv Hi Vbatt kW Hours Float T Hi Power TWEAKS MENU Offset VBatt Power AF On Off V Batt GF On Off En LMX 0 On Off Amos Out Blk kW Hours Fit R Graph R ARST On Off A EQ R DvrtC nt On Off Insomnia On Off Nitelog On Off Shade On Off TMSYNC On Off L Followme On Off BTS NET Master Follow PSWD On Off WBRST Yes On D Symbolizes pushing the Right Soft Key D Symbolizes pushing the Left Soft Key Table 13 88 Page 10 001 1 REV G Classic owner s manual RevG 2056 Label Set from Classic Y n k MPPT SOLAR WIND HYDRO BUCK BOOST CHARGE CONTROLLER NOMINAL OPERATING ENVIRONMENT 25 C 4 DE RATED SEE MANUAL MCA x 3 e UGE pE R ic b 150 v CONF CMEMS TO UL Af Vi V 4 MAX PV URRE T OPER RATING 96A MJ I ARRA ME MAX ATi 4 1 V L2 MATTE TY
16. am E qaa skawpo 31 SI E O M O sn S u s us uu EET u 31 AWO BP S 31 Standard Classic programming sess esses esee e seen e esee e essen eene e senes 32 Commissioning the Classic Quick Stall j uuu uuu u u e eque Ub boca va E oes Caco t vao rcd a en be EUER MEO DOSE 32 Battery Charge stages and Meanings uuu ua I Ne EE du DUM FE umma E 32 SN ees 32 5 Page 10 001 1 REV G Classic owner s manual RevG 2056 Mode 1S OEP Sa uu vbi edu bate edita bat cedat ESS BER b aur aa M Ma rud bcd uds 33 Adjusting Absorb Equalize and Float Volt ges 5 icc rn e Ree nare a bt e ee qae enda den eios 33 Cu E M WM oso ERR SERENE MENES Er indc he Pic toD teles dodi a dcn nde patet nt dun ue t m Itu 33 LED M des and the Blinking Red LED tiet au eed etta praese be apayaq 34 Calubratine Battery and PV Vols y SIE REED E E Re Ui es M ICD i eee 34 Contouring DE Input SOUECO ae cox eril m Qa ka m a te ka essc a ee cara Do ope eese 35 ConHburmne the Classic Tor Wind Input SOULCE eristuseta n eee Ires suse Eun Uude essensen ee een 36 Setting he Date and Tim oou dome nE a da u rade t admo dc pude metet essa domes dd cud mitem do demos se T 37 Configuring Auxiliary Input OUtp t e ree eee exe aa S sU Ese E T E Ue eau e aie de 37 Aux PURE HO HS e A Kl 42 Aux 2 Runction Output IBDUL iecor
17. an overview of these menus 46 Page 10 001 1 REV G Classic owner s manual RevG 2056 CHARGE MODE AUX MISC LOGS TWEAKS TEMPS NET gt gt Below each of the menu names is a row with a description of the menu inside To enter a menu the name of the menu has to be highlighted Pushing ENTER will show the submenus The up and down arrow keys are enabled for easier navigation Highlighting a sub menu and pushing ENTER will take you inside the submenu where you will be able to change the parameters of the unit To get out of the submenus push MAIN MENU this will take you out of the submenus one at a time every time you push it See page 77 for entire Menu Map Viewing Other MidNite Products on the Display Coming Soon Connecting the Classic to Two MNGPs Network cable The Classic can be controlled with two MNGPs at the same time This will help when the Classic is in a shop and there is a considerable distance between the Classic and the controlling point office inside house garage etc Instead of going to the Classic to check status or to change a setting the user can run a cable to the controlling point and see the Classic in a second MNGP The cable is a six wire phone cable Connect one side of the extension cable to the Jack in the Classic labeled SLAVE OUT and the other end to the second MNGEP Since the Classic transmits power and data signals through the phone cable to the MNGP the length of the cable is limite
18. be 150V 48V a total of 198 Volts that the Classic can withstand without damage When the Classic input voltage rises above 150 volts it will switch off stop outputting power As long as the Classic 1s in HyperVOC mode the microprocessor and all other functions like AUX will continue running When the input voltage comes back down below 150v or the rated operating voltage of the Classic depending on model the Classic will wake up and start charging again automatically This could happen in a really cold morning with a system that has a Voltage Open Circuit VOC close to the maximum operating input voltage Note I A HyperVOC message will be displayed on the bottom right side of the Status screen Note 2 Max nominal battery voltage to be added 1s 48v HyperVOC can be useful in overcoming an industry shortcoming in charging 48 volt battery s with standard panels For example let s take a sample system with Solar World 165 s that have a VOC of 44 vdc The industry has limited us to 2 of these panels in series making it hard to charge a 48vdc battery on hot summer days With the Classic we designed in Hyper VOC to allow you to run 3 of these in series 3 panels at 44 1vdc will give you a total VOC of 132 3vdc When temperature compensated for cold climates to 125 gives you 165vdc This is above the maximum safe limits for most controllers but falls well into the Hyper VOC range of the Classic We do have to use Hyper VOC wisely though if we abuse
19. below this 5 or 6 character descriptions is the actual number in volts or watts or applicable unit of data displayed at that cursor position centered on the dot of the graph The third line down on the left side of the recent data screen shows the time stamp of that data where the cursor is positioned on the graph Finally the bottom left of the graph screen alternates between two indicators One is the charge stage at the cursor position and the other is the scaling of the vertical axis of the graph Power for instance can show a very wide range of values and power lends itself better to using a logarithmic vertical scale shown as LOG Voltage and other data shows up fine using a LINEAR vertical axis scale and is spelled out on the lower left of the graphic screen 52 Page 0 001 1 REV G Classic owner s manual RevG 2056 Screenshot 6 The Date of the particular selected cursor positioned data point is shown on the bottom middle of the graphic screen Moving the cursor left or right using the Left and Right arrow keys selects the next data points to the left or to the right of the present cursor position The flashing cursor is short and may be hard to detect at first so you may have to look for it The cursor aligns and centers itself right on the dot itself that is selected The bottom date or time displayed may tend to obscure the data line graphed behind it The time date and the graph data will be mixed together about a second af
20. data itself is not correct If the data 1s all zeros and the year 1s shown as 2000 the data IS most likely invalid and not correct or the logging memory has not been filled yet This is why the Classic powers up with the year 05 04 2003 It means that data was actually logged but the date was not set whereas if it is showing 00 00 2000 it will normally mean that the data 1s just zero and therefore invalid data as well as invalid time and date The upper right corner of the text log screens displays a number from 1 to 380 This number shows the index or position of the data in the 380 data log time slots The most recently stored data has an index of 1 Two data points ago shows an index of 2 etc This index goes for either Daily History or Recent History text log viewing screen 51 Page 10 001 1 REV G Classic owner s manual RevG 2056 Graphical Logging Display modes Both DAILY and HOURLY logging can also be viewed in a graphical manner While in the text viewing log screen pressing the Soft Right key labeled GRAPH will bring up this view screen The HOURLY view is also available in the main status cycle of screens changed by repeatedly pressing the STATUS key just after STATUS TWO screen This is labeled as SHORT TERM HISTORY in the STATUS screens A summary of the next Status screen will be shown while holding the status button before releasing it and entering that next status screen This also goes for the Recent History graph scree
21. do not add in amp hours so if you have a single string of 8 golf cart batteries each having 220AH then you have 220AH of capacity Verify the efficiency of the battery 1s set properly according to the battery manufacturer s specs typically 94 This is generally indicating you have a bad connection somewhere causing arcs This can be anywhere in the system so generally finding it 1s easier if you can turn things off and see what causes the Fault to clear This also can be caused by loads etc and be a nuisance trip Please see the manual for help with that This is indicating the LED panel MNLP is not talking to the Classic Try making sure the blue cable is plugged in well Try plugging the Blue cable into the middle jack If both of the above fail do a HARDWARE factory restore See manual 10 001 1 REV G My Classic Lite has the left hand 3 LEDs blinking on the LED panel When I make changes to my Classic Lite with the Local App they do not appear to stay My Time gets out of whack on the Local App when the Classic Lite is powered down and back up I am having trouble getting my Classic Lite on the network My Classic or Classic lite keeps going back to address 10 after I readdress it to something else I am having issues connecting my Classic or Classic Lite directly to my PC without a Router 77 Page Classic owner s manual RevG 2056 This indicates wrong code If you recently updated code you may
22. eyes Wear complete eye protection Avoid touching eyes while working near batteries Wash your hands with soap and warm water when done If battery acid contacts skin or clothing wash immediately with soap and water If acid enters an eye flood the eye with running cool water at once for at least 15 minutes and get medical attention immediately following Baking soda neutralizes lead acid battery electrolyte Keep a supply on hand in the area of the batteries NEVER smoke or allow a spark or flame in vicinity of a battery or generator Be cautious to reduce the risk of dropping a metal tool onto batteries It could short the batteries or other electrical parts that can result in fire or explosion 9 Page 10 001 1 REV G Classic owner s manual RevG 2056 Never wear metal items such as rings bracelets necklaces and watches when working with a battery or other electrical circuits A battery can produce a short circuit current high enough to weld a ring or the like to metal causing severe burns How to KILL Your Batteries Batteries are actually very delicate and require proper attention especially when off grid Think of your batteries and solar equipment as a small Nuclear Power plant Hydro damn or Natural gas fired power plant Just like any of those your system needs DAILY attention to make sure it 1s doing what it should Below is a short list of some of the most common ways we h
23. more info on ground fault protection Got Comm Indicates a lack of communication between the display and the Classic Consult Troubleshooting for information page 72 Insomnia This when enabled will keep the Classic from going to Resting This is intended for hydro mode only where you may need time to open water valves and do not want to wait for the Classic to wake up LED MODE This selection lets you pick the function of the 6 visible LEDs on a standard Classic 91 Page 100014 REV G Classic owner s manual RevG 2056 LMX LoMax This enables the Classic to track the input voltage all the way down to Battery voltage When disabled the Classic will stop tracking the input around 5 volts above the battery voltage When the input voltage is within a couple volts of the battery voltage the inductors can Sing this is usually not very loud and will do no harm Local App Monitoring software included with the Classic for monitoring over the Local Network or Internet MNGP Midnite Graphical interface Panel This is the graphical display included with the standard Classic controller MNLP MidNite LED interface Panel This is the LED display that comes standard with the Classic Lite Mode This menu lets you turn the charging ability of the controller On Off as well as lets you select the DC input source See page 32 for info on the Mode menu Mod Bus a standard protocol used for communications We have published our pr
24. press Enter Now press the SOFT RIGHT key labeled AUTO EQ Pressing the AUTO EQ soft key enters the Auto EQ setup menu screen The left side of the EQ setup menu will show and select the number of days or interval between auto EQ charge cycles If set to zero 0 it will display MANUAL which is the same thing as DISABLED lle Figure 18 On the right side of the Auto EQ setup menu is the number of DAYS that the Auto EQ will retry if it does not finish the number of Hours and Minutes the Classic has been programmed to EQ for during the first day For instance you set the Auto EQ for an interval of every 30 days and the RE TRY for 3 days Then the first day it attempts an EQ the Classic only accumulates 1 hour of a 2 hour EQ cycle the next day the Classic will re attempt the EQ cycle If the Classic still didn t finish the EQ cycle on the 2nd day of its 3 allotted re try days it will have one more day to try to finish the Equalize cycle After this if it did not complete the 2 hours of EQ time it will not continue another day The Classic will show EQ DONE on the status screen until either the start of the next day or until the user presses a button on the MNGP to stop 1t earlier At the bottom of the AUTO EQ screen shows the time in hours and minutes that the EQ is set for Pressing the Soft Right key labeled VIEW takes you to a screen where you can view the interval and re try counters timers 31 Page 10 0
25. pushing the Left Soft Key WARNING The Classic s USB part is NOT isolated from battery negative This is typically only an issue on positive ground systems or systems with a tripped ground fault protection device Care must be taken that a computer connected to the Classic s USB port ts ether isolated from grund and the Classic s negative or that the computer s USB negative is common with the Classic s negative and ground 85b Page CHARGE MENU Volts EQ Volts Absorb Volts Float Volts ChgTime Absorb Hrs Mins Time 00 00 EQ 00 00 Timer View Min Sec Timer View Hrs Min T Comp Comp Mv Deg C Cell Disable Mv EQ Comp D amp Temp Comp Set Point Volts Equalization Menu EQ Stopped EQ Started 8 Auto Equalize Setup Internal Re Try Auto EQ Counters Advanced Ending Amps Rebulk Volts SKP Days D Clasc Shunt Output Amps Input Amps Mint Comp Volts Max Volts R Hi Batt Temp C Right Soft Key Directional Arrow Keys CLASSIC KEY PAD 10 001 1 86 Page Classic owner s manual RevG 2056 AUX MENU Aux 1 Manual Off Manual On SOC Low Le nei SOC High B Low R Delay Lice Off Trip High Vent Fan Low R Volts Vent Fan High 8 Volts Float Low Float High Clipper Control Day Light Nite Light Toggle Test PV V On Low Low E Delay Luna PV V On High
26. side of a MidNite Solar E Panel 15 Page 10 001 1 REV G Classic owner s manual RevG 2056 Figure 6 Alternative Mounting To mount the Classic to a plywood surface use 1 1 2 wood screws in the top key hole slot hole and the holes in the wiring compartment Taking care to make sure the Classic 1s Plumb and Level Dimensions See page 81 for more details Figure 7 1l6 Page 10 001 1 REV G Classic owner s manual RevG 2056 Sealed or Vented The Classic has the ability to be sealed for protection from salt air or dust It comes from the factory Vented If you live in a dusty or salt air environment you may wish to seal the Classic Sealing the Classic does not make the unit water resistant To seal the Classic install the solid plastic knock out covers into any unused knock outs and snap the upper vent cover onto the Classic as seen in the photo below Note that the Classic will be slightly de rated will put out less power by sealing it Refer to the specifications page of this manual for the ratings in the sealed mode To obtain the parts necessary to seal the Classic please contact our Technical Support Team Refer to Figure 8 and 9 Figure 9 Figure 8 Battery Temperature Compensation The Classic comes with a battery temperature sensor BTS This sensor raises or lowers charge voltage based on temperature Connect BTS to the BATT TEMP jack Refer to Battery Tempe
27. the way you want it select MEM Use the up and down buttons to select a location 1 through 9 to save it in and select SAVE Now push the Enter button to save it to the Classic s memory For more information consult the videos found at www midnitesolar com Setting the Date and Time To set the date and time manually on the Classic follow the steps below Push the Main Menu button repeatedly until Charge is highlighted Scroll left or right to highlight MISC and push the Enter button Scroll to Time and push Enter Now scroll left or right to highlight the data you want to manually change Use the up and down buttons to change the data When you have all the data changed push the Enter button to save the changes The Classic includes a battery CR 1216 in the MNGP portion to keep the time running even when the power is disconnected To replace the battery refer to the Installation Manual Note If you plan to use the Local App to set the time and not the Classics Display Time Sync in the Tweaks menu must be disabled to prevent the MNGP display from over writing what the Local App does Configuring Auxiliary Input Output The Classic includes two auxiliary ports which can be configured to become inputs or outputs These aux ports can be used as a secondary power supply to be used for accessories such as vent fan Diversion loads Logic inputs WBjr or the Clipper for example The Aux output is limited to 200ma or
28. to 53 amps is not a significant change it does give you the idea that all things being equal lower voltages are a bit more efficient keeping in mind that an MPPT controller needs to have the open circuit voltage of the array about 30 higher than the highest battery voltage you plan to charge to NOTE You can find the Classic string sizing tool on the web page www midnitesolar com Unpacking the Classic When you receive your Classic you will want to unpack it and make sure everything is there and in good shape Refer to Figure 1 Included in the Classic package should be Classic charge controller Battery temperature sensor Knock out covers 3 screened Parts bag with stickers Terminal block cover and silicone grease User s manual printed 12 Page 10 001 1 REV G Classic owner s manual RevG 2056 Snap on upper vent cover Knock out covers 4 solid Note These items are optional and do not ship as standard equipment Email customerservice midnitesolar com for more information or if anything is missing or damaged Figure 1 Removing and installing the front cover on the Classic Removing the front art deco cover 1s required to gain access to the wiring compartment Be aware if this is not the first removal of this cover there is a cable connecting the cover to the electronics Do not pull hard or fast as damage could occur To remove the front cover of the Classic in preparation for installation remove the 4 Ph
29. with a Midnite blue one How can I verify that all my fans work on My Classic How do I find the Wizard My fans run all the time no matter what the Classic 1s doing I remotely mounted my MNGP display and now it won t power on or it blinks but won t power up How many amps can my Classic handle on the input side OR Can I put too much PV on my Classic My Classic is not making the same amount of wattage as I have for solar Panels 78 Page Classic owner s manual RevG 2056 Go to the C directory and find the folder labeled midnitesolar and open it In here you will find an uninstaller simply double left click it to run it After it is complete you can delete the midnitesolar folder to completely remove any files left behind All Classics use 142 for the password This is the inductors Singing when the Input voltage is really low This is normal and is no cause for concern however if it bothers you then you can disable it by going to the main menu and entering into tweaks Look for LoMax and set it to off and press enter Note If the PV array is real low voltage and its max power point is close to the battery voltage disabling LoMax will cause a slight loss in power as the Classic will not be able to track all the way to the battery voltage looking for the MPPT voltage No the Magnum sensor was a different resistance value so those classics where modified to use those sensors Call customer service if you n
30. 00 20 0 99 0 60 a 3 72 Figure 31 81 Page 10 001 1 REV G Classic owner s manual RevG 2056 Default Battery charge set points The table below describes the default preset voltages for the different nominal battery voltages This means that if you set the Classic from the QUICK START see page31 to a different battery voltage the Classic will take the default voltage set points Note If you manually adjust the absorb float or equalize voltage set points and then nominal battery voltage 1s changed to a different nominal voltage e g from 24v to 12v or to 48v etc manual adjustments may be required s 12v 36v 48v 60v TN Voltage Bulk MPPT Table 11 To adjust these voltage set point see page 32 of this manual Optional accessories Optional accessories for the Classic include Blank display for multiple Classic installations MidNite network cable 3ft in Length Regulatory Approval The MidNite Solar Classic charge controller conforms to UL 1741 Safety for Inverters Converters Controllers and Interconnection System Equipment for Use With Distributed Energy Resources Second Edition May 7 1999 with revisions through January 26 2010 and CAN CSA C22 2 No 107 1 2001 09 01 Ed 3 R2006 CONFORMS TO UL STANDARD 1741 2ND EDITION MAY 7 1999 WITH REVISIONS THROUGH JANUARY 28 2010 CERT TO CAN CSA STD C222 3084883 No 107 1 2001 09 01 82 Page 10 001 1 REV G Classic owner s manual RevG
31. 01 1 REV G Classic owner s manual RevG 2056 Standard Classic programming Commissioning the Classic Quick Start The Classic will enter into the Quick Set screens upon initial power up If the Classic does not enter into the quick set or you want to restore to Factory Default follow these steps to initiate a Quick Set With the power off to the Classic Hold the left and right arrow buttons down Turn the power on to the Classic and continue to hold the arrow buttons until the setup screen is displayed Answer the questions on the next few screens to complete the Quick Set Battery Charge Stages and Meanings Bulk MPPT This stage of the Classic means that the Classic will be putting out as much current as it can to raise the battery voltage to the absorb voltage set point This is also known as Constant Current Mode Absorb This stage means that the Classic will maintain the Absorb set point voltage until the batteries are charged This stage is terminated at the end of the Absorb time or the End Amps set point whichever is reached first At this stage the Classic is not putting out maximum current as that would increase the battery voltage over the Absorb set point This is also referred to as Constant Voltage Mode The absorb time is proportional to the bulk time 1 e the time bulk takes to reach the absorb voltage The battery 1s considered full at the end of the absorb charge cycle Float A Float cycle follows af
32. 02 Off On On 3903 On Off Off 3904 On Off On 3905 On On Off 3906 On On On Setting any value to custom effectively disables the MNLP Lite as a controller LED s and Equalize button still work and requires you to configure the Classic using a PC or MNGP Table 7 60 Page 10 001 1 REV G Classic owner s manual RevG 2056 Battery voltage and time settings Battery Absorb Float Equalize Absorb Absorb Equalize Time Equalize Type Voltage Voltage Voltage Minimum Maximum minutes Interval Time Time days minutes minutes 12 Volt battery Gel 14 0 13 7 30 90 Sealed 1 14 2 13 7 14 4 30 90 60 28 Sealed 2 14 3 13 7 14 6 30 90 60 28 AGM 14 4 13 7 15 1 30 120 120 28 Flooded 1 14 6 13 5 15 3 30 120 120 28 Flooded 2 14 7 13 5 15 4 30 120 120 28 Flooded 3 15 4 13 4 16 0 30 180 180 14 Custom 24 Volt battery Gel 28 27 4 30 90 Sealed 1 28 4 27 4 28 8 30 90 60 28 Sealed 2 28 6 27 4 29 2 30 90 60 28 AGM 28 8 27 4 30 2 30 120 120 28 Flooded 1 202 27 30 6 30 120 120 28 Flooded 2 29 4 27 30 8 30 120 120 28 Flooded 3 30 8 26 8 32 30 180 180 14 Custom 48 Volt battery Gel 56 54 8 30 90 Sealed 1 56 8 54 8 57 6 30 90 60 28 Sealed 2 57 2 54 8 58 4 30 90 60 28 AGM 57 6 54 8 60 4 30 120 120 28 Flooded 1 58 4 54 61 2 30 120 120 28 Flooded 2 58 8 54 61 2 30 120 120 28 Flooded 3 61 6 53 6 64 30 180 180 14 Custom O ff Auto Eq is set to Auto then the Equalize interval is in effect If Auto Eq is set to
33. 2056 Warranty MidNite Solar s Classic comes with a standard 5 year warranty We will repair or replace the Classic at no charge to the consumer during this 5 year period Appendix 83 Page 10 001 1 REV G Classic owner s manual RevG 2056 izing Classic Breaker s 8JI pue Jayealq jndul o saldde osje saoge 40128 Ajajes 9G anba jou op pue epo Anp 9500 JO paje je Sue sJexeaiq Jejos JINDII vy euegd 3 21INPIN e episul SIM 2367 Heyo siy uo peseq AJBANBAISSUOD si yeya SIU Je aa Ul SIOJONPUOD Buls JO yeyo du SI L 0L O3N AO0 DAAVS 10 DAAVS VOS OMVOL AVOE AQ0 OAV 10 DAAVS V0S OMVOLATOE AQ0 OAAVS 40 DAAVS VOS OMVOL VOE AO0 OAAVS 10 DAAVS VOS OMVOL AVOE AQ0 OAAVS JO SAAV9 V0S OMVOL VOC AO0 DAYS 10 DAAVO VOS OMVOL VOE AQOE OAAVS 40 DM V9S vO0S OMVOL VOC AO0 OMVS 40 DAAVS VOS DAAVOL VOE A00 DMV 10 DAAVS VOG AQ0 OAAVS 40 DAAVS VOS OMVOL AVOE AO0 OAAVS 10 DAAVS VOS OMVOL VOE AQ0 OM WS 40 SAAV9 V0S OMVOL AVOC AO0 OM VS 10 DM VO9ATOG AO00 OMVS 10 OMV9 e0S AQOE OAAVS 10 DAAVS VOS OMVOL VOE AO0 DAYS 10 DAAVO VOS DOMVOL AVOE A00 SAAV9 10 DAAV9 e0S AQOE SAAV9 JO DAAVO E0S AO0 DMY 10 DAAVOS VOS OMVOL VOE AQ0 OAAVS 40 DA VS VO0S OMVOL AVOC A00 OMVYr VvOS A00 DAAVS 10 DAAVO VOG AQ0 OA VS 40 OM VS VvOS OMVOL AVOC AOSL OAAVO AVEO O9N V9 v0S AOSL OMVS9 VED DOMVOL YOE AOSL ONMWS9 VE9 OANVOL YOE AOSI OMVO AVES DAAVS VOS
34. AO0SL OM V9 VED OMVOL YOE KOS OM V9 VES OMVOL YOE AO0SL OMYVO9 AVES DAAVS VOS AO0SL OMVS V 9 DOMVOL WOE AOSL OMVS9 VED OMVOL YOE AOSL VE9 A0SL DAAVY AVES DMAVSAVOG KAOS DMY9 VE9 OAAVOL YOE AOSL OMVr VOS A0SL DAVE AVES OMVS VOS KAOS OMV9 V 9 DAAVOL YOE 4410196 HGZ UMA ell JexeeJq Indu vvv vA cl GL 6rt L 99 vl 9c 8 90T 18 EC cS 6l L8 OL LVS LV ct 92 CC ve cl veg GL 6 9c 9v LI 60 cS 9 9c GS el r Ot v9l 66 SL ee ve sl SL OL 9v BE 28 c vo LI St vv 90 Sc 8 Cl Le 6S 6L 9v 9L SN AV9 9 OAAVS OMV9 OMV9 OMV9 OMVTY 9 OMV9 OMV9 OMV9 OMVr OMVTY OMY OMV9 OMVTY OMVrY OMY OMVT MVP OMVY OMVTY OMVTY OMY OMVY OMVTY MVP OMY OMVT OMY OMVTY OMVTY OMVTY OMVTY OMY OMVTY OMVT MVP OMY OMVY 9 0r 9 09 02 09 02 09 9 0G co 09 0 c9 0Z c9 9 09 08707 06 08 06 08 O2 9 08707 06 08 06 08 08707 08707 06 08 06 08 06 08 06 08 06 08 06 08 001 06 001 06 09 001 06 001 06 08 001 001 001 06 001 001 001 06 001 001 Or EG 09 gS cr GG c9 L9 EG G9 eL A 9 G9 CL v G9 07 v Ed 97 97 67 OL 9 6 97 45 6 08 L6 6 c9 v6 96 98 v6 96 Bulzis Jexeelg osse LLG 9LT cc 8 991 Gc GLE GL GI COG eee 99 9 feel v6 6 c cg S 99 LI 99 Gg S OL 9v LEZ 38 S Gg G OL 62 c 8Gp 9L 6 90 OL P ce 9 281 GLE GL SP 6 C
35. Do this by turning the DC source PV Wind or hydro etc breaker off Then turn off the external battery breaker Than simply turn the 2 breakers back on starting with the battery breaker The arc fault module has three adjustable parameters consisting of MODE TIME amp SENSITVY MODE Is assigned as a 1 from factory default and it should stay that way unless instructed by MidNite Solar TIME This sets the length of the arc the Classic has to monitor before tripping the Arc fault detection This parameter is set to 4 from the factory SENSITIVITY This parameter determines how sensitive the Arc fault detector will be 1 being the most sensitive and 15 the least This parameter is set to 10 from the factory If you experience nuisance tripping you can raise the sensitivity one digit at a time Follow the instructions below to make adjustments or disable Arc fault As a last resort you may disable Arc fault if your system cannot work with the arc fault detector Figure 22 48 Page 10 001 1 REV G Classic owner s manual RevG 2056 To change the parameters of the Arc Fault follow the steps below Press Main Menu Scroll to the right or left until TWEAKS is highlighted and press ENTER In TWEAKS press the right soft key to get to the BITS menu In BITS press the right soft key to get to ARC ADJ In this menu use the left and right keys to select the feature to adjust Use the up and down arrow keys to change the parameters
36. Follow Me coordinates charge stage but the Classics will still vary in the amount of power processed Follow Me was not intended to make them all produce the same amount of current just coordinate the stages To enable Follow Me you need to wire the Classics network cables as shown below You also need to enable Follow ME To do this go to the Tweaks Menu Press the Main Menu button repeatedly until Charge is highlighted Scroll to the Right until Tweaks is highlighted and press Enter Now press the right soft key Upper right button 4 times until you see the screen with Follow ME and BTSNET on it Here you need to highlight Follow ME and turn it on using the up arrow You will also need to highlight BTSNET and turn it on if you want to share battery temperature data After enabling these press Enter to save this data Ground Fault sharing To share Ground fault you need to remove all of the GFP Jumpers except one classic only You then need to make sure Ground Fault is Enabled in the Tweaks menu for any of the networked Classics you want to shut down on detection of ground fault For example say you have three solar Classics and one Wind Classic and you do not want the wind Classic to shut down for GFP Make sure in the tweaks menu of that Classic GFP is Disabled Naming the Classic The Local Application software Available as a free download at www midnitesolar com allows you to issue a name to the Classic with upper and lower ca
37. L BLOCK AND GND TERMINAL TO 35 IN LBS 4Nm SUITABLE WITH 75 C MINIMUM RATED COPPER CONDUCTORS 89 Page FOR USI 10 001 1 REV G Classic owner s manual RevG 2056 RS232 Jack Pin Out 1 89 cem MNGP 9X REMOTE a LED Normally internal MNGP Nd NO CONNECT TO a O RX epu d gt TX output SLAVE or u to GND power EXTERNAL MNGP TO da gt D output SLAVE or 19 b dineert EXTERNAL MNGP Figure 1 Classic RS 232 MODBUS RJ 11 PHONE JACK PINOUTS 90 Page 10 001 1 REV G Classic owner s manual RevG 2056 Glossary of Terms Absorb Constant voltage charge stage to fill the batteries The controller is regulating so maximum power will not be seen at this time The Absorb timer is also counting down to the switch to Float A EQ R This will reload the Auto Equalize counters basically it will start the counters from day 1 AF Arc Fault See page 48 for more info on arc fault protection Arc Adjust This menu is where you adjust the Arc Fault sensitivity For info on Arc Fault see page 48 A RST Auto reset of the Classic controller The Classic will reboot around Midnight every night when this is enabled This is useful for very remote sites where a loss of Internet capability for example would be a hard ship Aux Auxiliary relays The Classic has 2 relays Aux 1 can be configured as a 12 volt signal or a dry relay Aux 2 can be used as a PWM signal output Refer to pa
38. Manual the Equalization stage will not occur unless started manually Table 8 61 Page 10 001 1 REV G Classic owner s manual RevG 2056 Using MNGP Remote to Program a Classic Lite The Classic Lite can be programmed using an MNGP remote This is an easy way to get into and program not only the basic functions but the advanced features as well In Dip Switch Section Iset DIP Switches 1 2 3 and 4 to ON This will tell the Classic Lite s MNLP display to allow custom programming Next remove the plug from the back of the MNLP and plug it into the MNGP Now you basically have a Standard Classic The programming for this is found in the Standard Classic Manual Once programmed in this way the MNGP can be removed and the MNLP replaced All functions and voltages programed into the Classic will now be retained in permanent memory NOTE All Firmware versions need to match to mix MNGP s from one Classic to other Classics etc Programming the Lite with a Networked Standard Classic The third method of programming is to use a Standard Classic in the system to program the Lite in a simple Follow Me network In Dip Switch Section Iset DIP Switches 1 2 3 and 4 to ON This will tell the Lite s MNLP display to allow custom programming You will need to use the MNGP from the standard Classic to set the Address and Follow Me parameters See the Follow Me section on page 15 for full details NOTE All Firmware versions need to match to mix MNGPs fr
39. MidNite Solar E Panel The Classic can also accommodate other installation methods as well Mount in an upright position out of direct sunlight when possible For your convenience the Classic has four one inch knock outs that are pre cast The Classic has mounting locations and conduit locations that are similar to other brands of charge controllers to facilitate ease of upgrading older technologies 14 Page 10 001 1 REV G Classic owner s manual RevG 2056 Mounting the Classic directly to the E Panel Remove the front cover of the Classic nstall the mounting bracket on the E Panel and start the upper mounting screw into the bracket leaving it about half way out so you can hang the Classic on this screw Install the 1 inch close nipple into the E Panel as shown in the E Panel directions The 1 close nipple 3 locknuts and 2 plastic bushings are included with each E Panel One locknut acts as a spacer Carefully hang the Classic on the screw in the bracket and slide it over the close nipple see figure 4 nstall the lock nut and bushing on the close nipple and tighten the screw in the mounting bracket Don t install the front cover until you complete the wiring of the Classic Figure 3 A Charge controller bracket mounted to the E Panel The bracket comes with every E Panel Figure 3 Classic Mounted to side of E Panel Nipple locknuts and bushings that come with every E Panel Figure 4 Figure 5 Classic mounted to the
40. N AGM OFF ON ON FLD1 ON OFF OFF FLD2 ON OFF ON FLD3 ON ON OFF CUSTOM ON ON ON 10 194 1 REV DCA 4 06 12 10 001 1 REV G Classic owner s manual RevG 2056 Section 1 Switches Ithrough 8 Section 1 Section 2 JI T kas TYDET port On 1 2 3 4 5 6 7 8 Mode System Battery EQ Voltage Type Section 1 Mode Mode Switch 1 Switch 2 Solar Off Off Legacy Off On Reserved On Off Custom On On System Voltage System Voltage Switch 3 Switch 4 12V Off Off 24V Off On 48V On Off Custom On On Battery Type Switch 5 Switch 6 Switch 7 Gel Off Off Off Sealed 1 Off Off On Sealed 2 Off On Off AGM Flooded Off On On Flooded 1 On Off Off Flooded 2 On Off On Flooded 3 On On Off Custom On On On Auto Equalize Switch 8 Manual Off Auto On Table 6 59 Page 10 001 1 REV G Classic owner s manual RevG 2056 Section 2 Switches 1 through 7 Section 1 Section 2 1 2 3 4 5 6 7 38 Mode System Battery EQ kasi EE Voltage Type port Section 2 DHCP or Static IP address On Switch 1 Static IP Off DHCP On IP Address only if DHCP is set to Static IP Switch 2 Switch 3 Switch 4 192 168 0 223 Off Off Off 192 168 1 223 Off Off On 192 168 1 224 Off On Off 192 168 2 223 Off On On 10 0 0 223 On Off Off 10 0 1 223 On Off On 10 0 1 224 On On Off 10 1 1 223 On On On MODBUS Port Switch 5 Switch 6 Switch 7 502 default Off Off Off 3900 Off Off On 3901 Off On Off 39
41. ON ON O 10 1 1 223 0 ON o DEFAULT 1 Secun 2 01 015 R44 r 1 c3 4 E CIIM O O hA Y ie ta JA R4 j o oo rom om om n 7 n m ra m mmm mm 2 5 23 J BS wassana r zwnwwnes h G3 a od O y W vw 4 R P he ee oa ue y e rm es w 515 5 b DID a T O noDBUS o v a e BAI 3 DHCP IP ADDR PORT gt f bx 51 i S2 N o o TUS1 BATT S1 5 S1 6 51 7 CURRENT IMIT j a a GEL Orr OFT oto opis o A i m fi J SEA DOi OFF OFF ON o TT EE 2E OFF EF Q D6 M Ope uni o AGM OFF OM ON O ofi D FLo1 ON OFF OFF DHCP S2 1 u NM SYSU 51 3 n FLO ON OFF ON TVSZ t E FLOS CN BE 1 da P E 9 14v ors ON ON ON EQ 1 8 n K ON i ai OFF ON GROUND_F AULT Custom Figure 25 56 Page 10 001 1 REV G Classic owner s manual RevG 2056 Section 1 Switch settings explained Mode Switches 1 and 2 Section 1 On Section 1 the first 2 Switches are used to select which Solar Mode will be used For Solar Mode set switches and 2 to OFF This is the optimum setting for virtually all solar installations For Legacy Mode Set Switch 1 to OFF and Switch 2 to On Legacy Mode can be used in cases where the Open Circuit Voltage 1s close to the battery voltage For example a 22 volt open circuit array and a 12 volt battery Or where there are mixed sizes of panels in an array Solar Salad When switch 1 2 3
42. SOLAR inc ATTENTION Please Read this cover letter BEFORE installing the Classic or Classic Lite a7 For help with the Classic Classic Lite or Classic SL please see our how to videos and extended documentation Please visit this website www midnitesolar com classic Before calling tech support we recommend visiting this website for some of the most common issues Warning Arc Fault protection is not turned on by default Note neither the Classic Lite or Classic SL have ArcFault built in The National Electrical Code article 690 11 requires Arc Fault Protection The Classic has this built in as standard equipment This will need to be enabled if so desired Please Note The Arc Fault Protection has adjustable sensitivity and may require some tuning for your particular system to avoid nuisance tripping Some house loads like Table saws and well pumps and other motor loads can actually be seen on the PV circuit in the Classic appearing similar to DC arcs We have started with a general average we have found to work reliably but in some cases this sensitivity level is too high causing false Arc Fault Alarms When the Classic goes into Arc Fault it goes to Resting and will not charge the batteries Please consult the manual that came with your Classic for enabling and or fine tuning of the Arc Fault system Classic owner s manual RevG 2056 DANGER OF DEATH TO YOUR CLASSIC Warning with Tigo modules Solar Mode must not be used
43. V runs up to 100 feet use the Classic 150 runs up to 180 feet use the Classic 200 or above 180 feet use the Classic 250 If the wire size between the DC source and the Classic is larger than the Classic s DC terminal connector you can use a splicer block or similar connector to reduce down to 4 AWG close to the Classic The MidNite E Panels are supplied with a PV input bus bar that accepts up to 2 0 wire Connecting the Classic to the Clipper The connections between the Clipper and Classic are fairly basic There is the DC and conductors from the Clipper to the PV input on the Classic There is also a smaller set of and conductors connecting Auxiliary 2 to the PWM input on the Clipper To program the Classic to work with the Clipper the Aux 2 needs to be programmed Follow the steps below to program this Note see our instructional videos at www midnitesolar com Enter the Main menu and scroll to Aux and press Enter Scroll to the right to highlight the text under Aux 2 and press the upper right soft key 28 Page 10 001 1 REV G Classic owner s manual RevG 2056 Scroll up or down to find Clipper control and press the right soft key again On this screen we need to select AC or DC for the Clipper you have AC is default CAUTION CONNECTING A DC CLIPPER WITH THIS SET TO AC CAN DAMAGE THE CLIPPER Press the right soft key again here we need to set the absolute voltage we want the clipper to allow Press Enter to save
44. VON TA a Mer MAX PY SHORT CIRC CURRENT JGA AMEN MAX BATTERY CHARGE CURRENT 96A CERT TO CANICSA MAX BATTERY CHARGE VOLTAGE 93V 2 f STD C222 i k 3084883 jar A TAGES 12 72V a MIDNITE SOLAR CLASSIC 200 MPPT a WIND HYDRO BUCK BOOST CHARGE CONTROLLER NOMINAL OPERATING ENVIRONMENT 25 C 40 C DE RATED SEE MANUAL MAX PV VOLTAGE OPERATING 200V MAX PV CURRENT OPERATING 794 MAX PV VOC 2 t UV BATTER Y VOLTAGE MAX PV SHORT CIRCUIT CURR ENT POA MAX BATTERY SHARC GE CURRENT 79A MAX BATTERY CHARGE VOLTAGE aqy Designed and built Ta NOMINAL BAT VOLTAGES 12 7 gt MAX OUTPUT FAULT CURRENT 436A the U S A MIDNITE SOLAR CLASSIC 250 MPPT SOLAR WIND HYDRO BUCK soosr CHARGE CONTROLLER NOMINAL OPERATING ENVIRO NM ENT 2 C 40 C DE RATED SEE MANUAL MAX Pv VC JL TAGE OP ERATIN 3 2S0V MAX PV CURRENTIOP ERATINC G 62A MAX PV VOC 250V BATTERY VOLTAGE MAX PV SHORT CIRCUIT CURRENT 62A MAX BATTERY CHARGE CURRENT 62A MAX BATTERY CHARGE VOLTAGE 93V NOMINAL BAT VOLTAGES 12 72V MAX OUTPUT FAULT CURRENT 436A TTE NT ON ym MIDNITE SOLAR INC CES C kd IBN NES HA VE NE UNT SURFAC CHAUDES J I LA VU VU V V ARLINGTON Y A 9822 23 LE i r o oO m a is Hic AUX OUTPUT 1 13VID C 200mA RECONFIGURABLE AS 3 3VDC AUX INPUT AUX OUTPUT 2 500rn RELAY DRY CONTACT RECONFIGURABLE AS 13VDC 200m A OUTPUT MINIMUM INTERRUPT RATING 4000 AMPS DC FOR OVERCURRENT PROTECTION DEVICE TORQUE ri RMINA
45. a a eler e eier sunto MM edema aede 70 TEGUDICSBOOLID slats frase stood doped EEN de Poss ub buds uie dL ade Edom tant 72 Electrical Specifications ea coins th RO E ect coros heute UN led Md ta ieee e AU E UM ep Ces 80 Specifications Mechanical HT 81 Default Battery charge Set pommes uran u Gh u Lun oci Su ee ted un Susa S Sa asa 82 Optional ACCES SONGS uuu u mansn eins ecg te a ss TE E ere 82 Regulatory dcc 82 IVY ARE aniy ER E M PNE 83 APPENA u T PL n 83 Classic pi kO Sizi ERR LR E E 84 J Ted so CITOM C ls Can eee een E tuwa uusha osea eet Roo uan ee ee erent eer eee 89 R AC EE OU a E E voatoumsosdestnaitteuenn ond aaa tcm bremen fectum rn dms 90 Scope This Manual provides safety guidelines and installation information for the Classic charge controller It does not provide brand specific information about photovoltaic panels batteries etc Contact the manufacturer of other components in the system for relevant technical data 7 Page Doce REV G Classic owner s manual RevG 2056 Introduction The MidNite Classic charge controller is unique in its ability to be used for a great variety of DC input sources The Classic 1s designed to regulate DC input from PV and Approved Hydro and Wind turbines for other DC sources please contact MidNite Solar tech support The Classic 150 200 and 250 are designed to work with 12 24 36 48 60 and 72 volt battery banks The Classic c
46. able batteries Other battery types may burst causing personal injury and damage WARNING Explosion hazard during equalization the battery generates explosive gases Follow all the battery safety precautions listed in this guide Ventilate the area around the battery using ventilators with brushless motors thoroughly and ensure that there are no sources of flame or sparks in the vicinity The Classic comes with a Battery temperature sensor which plugs into the jack beside the DC Terminal connector labeled Batt Temp Route the cable through the E panel into the battery box Pick a battery in the middle of the bank and about half way up the side of the battery thoroughly clean a spot off on the case Then remove the protective tape from the sensor and adhere the temperature sensor to the battery Some manufacturers use a double wall case on the battery For mounting a temp sensor to a double wall battery case please refer to the battery manufacturer s recommended procedure 20 Page 10 001 1 REV G Classic owner s manual RevG 2056 COMMON Gh NEGATIVE Insert BTS to the jack labeled BATTERY TEMP on the control board 21 Page 10 001 1 REV G Classic owner s manual RevG 2056 Chassis Grounding In all installations the Classic chassis should be connected to ground For systems with a battery breaker sized 60 amps and smaller 10 AWG 6 mm copper is generally sufficient For systems with a battery breaker sized 100
47. ally best for PV systems especially if there 1s partial shading at times during the day SOLAR mode is best suited for shaded or un shaded PV arrays that are at least one nominal voltage above the battery voltage For severe partial shading or PV arrays with nominal voltage equal to battery voltage you may also want to try Legacy P amp O Perturb and Observe MPPT mode Legacy P amp O Legacy P amp O Perturb and Observe mode is a slow tracking mode similar to the Micro Hydro mode but with the difference that it 1s slightly faster and optimized for Solar Legacy mode can be very useful for arrays that experience heavy shading issues as well as PV arrays that have a low voltage If the array has a VOC Open Circuit Voltage of less than 125 of the battery voltage Solar mode will not work as well so Legacy will be a better choice Uploading New Firmware to the Classic The Classic has the ability to have its firmware updated with a standard USB cable and a Windows based PC The USB cable is Standard to Mini B Please see www midnitesolar com and click on the Software tab for the firmware and instructions Due to the various different Windows configurations we will not go into detail in the Classic Manual The Firmware upgrade is fail safe so if the wrong code is installed the Classic simply says Wrong code prompting you to load the correct code Also if the upload is interrupted for whatever reason simply start over WARNING The Classic s USB
48. amps and smaller 8 AWG 10 mm copper is required For grounding conductor requirements on your specific installation please consult your local electrical code The chassis rounding terminal is in the upper right corner of the electrical connection compartment Figure 14 DC System Grounding The Classic charge controller is designed to work with Negative Ground Positive Ground or Ungrounded power systems In grounded systems dc negative may be connected to ground either externally or by using the Classic s internal grounding jumper shown on figure 15 on Page 22 The internal grounding jumper should only be installed when the Classic s GFP is enabled In Positive ground or Ungrounded systems the GFP jumper must be removed See Figure 15 Also note that with Positive ground there will be items still referenced to battery negative that can complete a short circuit of the battery bank These items include but are not limited to the USB Cable and RS232 serial data lines Please contact Technical Support for assistance on Positive ground systems 22 Page 10 001 1 REV G Classic owner s manual RevG 2056 DC GFP Ground Fault Protection The Classic has internal ground fault protection GFP built in Since 2008 the NEC requires a DC GFP on all PV systems in the USA The built in DC GFP eliminates the need to purchase and install an external DC GFP If the internal grounding jumper is installed in a Classic the battery negativ
49. an be installed stand alone or as a multi unit networked installation Standard features of the Classic charge controller include 3 input operating voltage ranges 150 200 and 250 VDC Multiple DC input options example Solar Wind or Hydro Graphical display Previous 380 days of operational data logged Internet ready This Manual covers Classic 150 Classic 200 and the Classic 250 It covers the installation wiring and use of the Classic charge controller A WARNING Warnings signs identify conditions or practices that could result in personal injury or loss of life A CAUTION cautions identify conditions or practices that could result in damage to the unit or other equipment MIDNITE SOLAR CHARGE CONTROLLER INSTALLATION GUIDELINES AND SAFETY INSTRUCTIONS This product is intended to be installed as part of a permanently grounded electrical system as shown in the system configuration sections The following important restrictions apply unless superseded by local or national codes To use the Classic s built in DC GFP the System s DC Negative conductor must not be bonded to earth ground The Classic does this with its internal Ground Fault Protection circuitry The battery negative and ground are not bonded together directly but are connected together by the Classic s internal GFP device All negative conductor connections must be kept separate from the grounding conductor connections The equipment ground terminal inside the C
50. and 4 are set to ON the Lite is in Custom Programming mode and can be programmed using any of the other 3 methods Custom set up will be required for Wind Hydro Fuel Cell applications as well as setting up the Aux output controls and for Battery voltages of 36 60 and 72 System Voltage Switches 3 and 4 Section 1 On Section 1 set Switches 3 and 4 to the appropriate positions Found in the Chart corresponding to your system s battery voltage 12 24 and 48 volt systems are included in this menu 36 and 72 volt battery set up can be accomplished using the Custom set up method Battery Type Switches 5 6 7 Section 1 Switches 5 6 and 7 allow you to select from 7 different battery types and charging profiles These profiles can be found in the 2 charts on the following pages These should cover most common applications If slightly different voltages are desired this can be done using Custom Mode and programming methods 2 3 or 4 Auto Equalize Switch 8 Section 1 Switch 8 is used to select Automatic equalization In the OFF position a manual equalization cycle 1f desired 1s selected by pressing the Equalize button on the MNLP for 3 seconds To Cancel Equalize Press Equalize button for 3 seconds With Switch 8 in the ON position the Lite will attempt to equalize the batteries automatically The equalize interval 1s dependent upon the battery type selected Please refer to Dip switch battery settings for 12 24 o
51. ave seen people kill there battery bank For Lithium battery banks we highly recommend using the Logic input on the Classic to let the BMS tell it to stop charging if it detects an issue brewing We also recommend the use of an independent battery monitor alarm if you have very expensive battery banks Not watching the Charge voltages and verify you are charging to the voltage supplied by the battery manufacturer Not verifying the temperature compensation neutral point typically 25 degrees C and the milli volts per dergree C per cell typically 5mv Not watching to verify the Absorb and or EQ time is set properly and that the equipment actually charges for that period of time Some equipment will have settings like End Amps that can terminate Absorb early and if set up wrong can damage a battery Not having enough charge current Solar Panels to properly charge the size of the battery you have Consult the battery manufacturer for the minimum charge current Using tap water or other liquids instead of distilled water in a flooded battery The Minerals in the tap water will destroy a battery Failing to keep all connections clean Not using ALL EQUAL LENGTH interconnect cables on each string It 1s important that ALL strings be wired EXACTY the same way Any variance in resistance on one string vs another will cause in balance and the batteries will be dead in less than 6 months Using more than 2 3 parallel strings and not using so
52. bility or liability for loss or damage whether direct indirect consequential or incidental which might arise out of use of such information The use of any such information will be entirely at the user s risk Contact Information Telephone 360 403 7207 Fax 360 691 6862 Email customerservice midnitesolar com Web www midnitesolar com 4 Page 10 001 1 REV G Classic owner s manual RevG 2056 Contents we TM o omm 7 MEU HII uu uu M 8 How to KIDL YOUE TS AUC CS u u diee orta E aa aaa nak aaa PUN SUE ieee eae 10 Classic Power Curves a esee e nean nnnnninanussses esses esee esses e nennen nnne eese esee en 11 B IPIS SUITE Cassit RT 12 Removing and installing the front cover on the Classic 13 Monnina the CL c n munasa 14 PRICE EH AEVO VL UTI u 22 a aa was qasusqa qM MIRI dM mede ad qu du 16 NUM GS I RECO TT TET 16 DEUS OF VOIE ics eedtus ntes ati pS pinta teu tE INS usa E UNI MM EMEN EUM MN MM E 17 Battery Temperature Compensation 17 Follow ME Charging coordination ec
53. crews The jumpers are described in the section below Aux 2 Aux 1 IN OUT RELAY OUT In order to select operation of Aux 1 between relay contact or 12v output JP6 and JP8 need to be configured accordingly following the instructions provided in this section Set for dry contact by default 43 Page 10 001 1 REV G Classic owner s manual RevG 2056 412v Aux1 PTC NC ontact GND Aux1 Diagram 2 When Aux is used to supply 12v out JP6 and JP8 have to be in the position shown in Diagram 2 The basic schematic of how this works is shown above The 12v out is more like 14 5v The maximum current from Aux 1 should not exceed 200mA The Aux 1 output can be set to operate at either Active High 12V or Active Low 0V when the Aux 1 function condition is true For more information see Configuring Auxiliary Input Output on page 37 lt Auxt Contact Diagram 3 To configure Aux to use the internal relay JP6 and JP8 have to be in the position shown in Diagram 3 This configuration is commonly known as dry contact because it does not provide 12v at the Aux1 terminals it acts more like an isolated switch to the ratings of the relay The Aux output can be set to operate at either normally open Active High or normally closed Active Low when the Aux 1 function condition is true For more information see Configuring Auxiliary Input Output on page 36 Aux 1 Voltage Time Relation Relay
54. ction 13 MNSPD300 AC Surge protection 14 MNSPD300 DC Surge protection 15 DC breaker for the Inverter Also serves as a disconnect for the Inverter 16 DC breaker for the PV into the Classic Also serves as a disconnect for the Classic 17 DC breaker for the Battery into the Classic Also serves as a disconnect for the Classic 18 AC L1 Input Bus Bar This is where the generator L1 input gets wired 19 AC Neutral Bus Bar This is where ALL AC Neutrals get wired 20 AC LI Output Bus Bar This is where the L1 Output to the Load center for the building would connect 2 Battery Positive Bus Bar This is where we would wire the Battery positive side of the Classic as well as where we would wire up DC loads Do NOT wire the battery cable to this bus bar 22 Earth Ground Bus Bar This is the common Earth Ground bus bar where all the grounds get wired back to and it needs to be connected to the building s ground rod system 23 PV Positive Bus Bar This is where the Solar Panels positive lead connects 24 Battery negative Bus Bar This is where the solar panel negative lead would go as wellas the Classics negative lead and any negatives from the loads Do NOT connect the battery negative cable to this bus bar 25 DC Shunt The Shunt measures the amperage in or out of the battery You connect the battery to one side and everything else to the other side 26 Earth Ground system of the building 27 Classic Char
55. ctual charge voltage based on the temperature of the battery see above calculation s the same works for cold batteries as well you just end up with a negative number so a battery that 1s 15 degrees C would look like 10x24 240x5 1200Mv or 1 2v so the Classic would actually charge to 60v 10 001 1 REV G Classic goes to Float to early Follow Me with my Classic Lite 1s not working My Classic says OCP is OFF on the display My Classic says OCP now and then on the display My Classic has an orange LED on the display lit up and or says Amp Limit My Classic says Hyper VOC on the display My Classic says Battery over V on the display My Classic says GRND FLT on the display and is making a loud beeping 75 Page Classic owner s manual RevG 2056 Make sure End Amps is not set to high causing the Classic to go to Float End Amps is in the Charge menu and the way it works is 1f the charge current falls below the End Amps setting AND the Classic 1s in Absorb the Classic will go to Float Setting End Amps to 0 will disable it End Amps setting is a value the battery manufacturer supplies Make sure you have the Absorb time is set properly Classic Lites older than serial CL05435 did not work with Follow Me please call customer service for a new MNLP Verify you are seeing the short blips of the blue LED internally as talked about above If not please check all your cables This ca
56. d The Classic advertises it s address every 10 seconds using the UDP protocol Advanced users and programmers may use this feature to identify Classics on their network Positive Ground systems When installing the Classic in a positive ground systems there are a few extra steps that need to be taken The Ground fault jumper needs to be removed and ground fault needs to be disabled in the menu Refer to page Disabling GFP on page 24 for instructions on doing this The overcurrent protection needs to be done a little different as well The input and output breakers need to be double pole breakers Battery negative and positive conductor both need to be protected Refer to Classic Breaker Sizing on Page 84 IMPORTANT Do not connect both positive battery and positive PV input to ground One or the other positive normally battery but not both otherwise the Classic input and output will be shorted 70 Page 10 001 1 REV G Classic owner s manual RevG 2056 HyperVOC M HyperVOC is a unique feature the Classic has built in HyperVOC refers to when the DC Input Voltage raises above the maximum operating voltage 150V 200V 250V depending on the Classic model HyperVOC gives you the flexibility to go up to the maximum operating voltage PLUS the nominal battery voltage For example the Classic 150 has an input voltage rating of 150 operating volts if the Classic 150 is connected to a 48 volt battery bank the HyperVOC voltage limit will
57. d to 100ft MidNite Solar only offers a 3ft as an optional accessory If you are making your own cable be sure be sure to insert cable end all the way into the phone terminal to get a good contact Use the phone crimping pliers to crimp both ends of the cable Figure 20 Figure 21 We recommend using flat phone cable for extension just because it 1s easier to work with Use the two pictures above as reference Make sure the color and position of the wires are as shown in the diagram below Use terminal connector tab as reference 47 Page 10 001 1 REV G Classic owner s manual RevG 2056 Diagram 6 Arc Fault Because safety is not an option the Arc Fault Detector is a unique safety component included in every Classic The engineers at MidNite take action as the 2011 NEC code requires The Classic is the first charge controller in the world to successfully stop a series arc The Classic can detect an arc in less than 100mSec From low power arcing to devastating high power arcing the Classic will detect and shut down with an audible and visible alert to announce that there is a problem in the PV side of the system When an arc is detected the Classic has to be manually cleared Resetting the Arc Fault Detector after detection has occurred The first thing to do 1s find and fix the actual arcing wire terminal splice etc The Classic needs to be powered down completely for 15 seconds and then powered back up
58. de energized and wait 5 minutes before working on the wiring in the Classic The Classic has 2 common neutral negative terminals Therefore only one neutral conductor is required to run from the E Panel and terminate on either or both common neutral terminal This negative conductor shoule be sized to match the battery cable The Positive DC source wire goes to the PV Turbine screw The Positive Battery DC wire goes to battery terminal Torque the terminal screws to the specs below To connect the wiring to the Classic Ensure the DC source and Battery are disconnected Connect a grounding conductor between the Classic and system ground Ensure the breaker between the battery and Classic meets UL489 standards Ensure the breaker between the DC source and Classic meets UL1077 standards Connect the DC source and Battery wire to the Classic Connect any communications cables or auxiliary input output wires Torque terminal connector screws to the following specs MA MA e MA The Torque specs on the DC terminal connector big blue terminal connector are Up to 10 AWG torque to 25 35 inch pounds 8 AWG torque to 30 40 inch pounds 6 AWG or above Torque to 40 50 inch pounds 24 Page 10 001 1 REV G Classic owner s manual RevG 2056 Diagram 1 Explanations 10 Solar Modules PV 11 DC Combiner Like our MNPV6 or MNPV12 for example 12 MNSPD300 DC Surge prote
59. e Classic Web Access When enabled allows the Classic to send data over the Internet to My MidNite s Server for you to view when wanted 92 Page 10 001 1 REV G
60. e LED is for Follow Me a short 1 10 of a second blip means it got a good packet a long blip second means it got a bad packet or no packet at all Consistent long blips generally indicate a bad cable Calibrating Battery and PV Voltage To calibrate the Classic battery and PV voltage reading you will need a Volt meter to check the actual battery bank voltage or input PV voltage Using the volt meter measure the voltage on the DC terminal connector of the Classic refer to Screenshot 1 compare this reading to the reading on the Status screen in the Classic press Status 1f not in this screen To adjust the reading of the Classic to the one in the volt meter follow these steps Press Main Menu scroll to TWEAKS and press Enter Highlight VBatt and use the up and down arrow keys to match both of the readings Press the Enter button to save Note Use the description below to help complete the calibration of the Classic voltages TWEAKS screen Battery voltage adjust MM Input voltage adjust VB OFFSET pv Input voltage Battery voltage 0 afar offset 12 6 VOLTS 0 0 8B 13s Displayed JER Displayed Input battery voltage Screenshot 1 voltage 34 Page 10 001 1 REV G Classic owner s manual RevG 2056 Configuring DC Input Source To select the Mode the Classic will run in follow the steps below Push the Main Menu button Scroll left or right until Mode is highlighted and then push the Enter button Scroll to
61. e and DC source negative must not be connected to the system grounding conductor anywhere in the system Grounding of these circuits will defeat the GFP function In a network with multiple Classics connected in Follow Me only one Classic should have its internal grounding jumper installed and all should have GFP enabled The factory setting will make a DC negative to System Ground connection in the Classic charge controller The GFP function will need to be disabled for Positive ground or an ungrounded DC system NE E BATTERY COMMON GND PU TURBINE NEGATIVE Y AUX1 RELAY OUT LAS 5 Ka Figure 15 Figure 16 The Ground fault device is simple to understand and use It detects a fault between battery PV negative and earth ground just like the breaker DC GFP system The difference with the Classic is that it turns off the charge ability and sounds a loud warning when a ground fault is detected The Classic s system consists of a PTC that is between the Negative and Ground internally in the Classic A PTC is basically a self healing fuse that will open when current exceeds its rating and reclose when current is dropped below its rating The Classic will monitor this PTC and disable the charging when it senses it go open When the fault is cleared the Classic will restore charging To disable the internal Ground Fault Protection function the jumper labeled GFP needs to be removed and the GFP function needs to be disabl
62. e coin battery in the display Check coin battery for voltage 1f under 2 5v replace the battery Check the coin battery for glue residue from the remove tag With coin battery removed press in on the 2 tabs to bend them in a little tighter and add more spring pressure to the battery Verify the WBjr is set up properly by looking at the WBjr status screen and verifying the values it is showing look proper The SOC will not show up until the Classic with the WBjr goes to float once so it can calibrate If there are multiple Classics in Follow me we need to make sure the one with the WBjr is the first one to go to float We recommend setting the Classics that do not have WBjrs for about 15 minutes longer on the absorb time this will ensure the Classic with the WBjr goes to float first f you are using End Amps make sure you use the Classic with the WBjr to do the sensing of End Amps If the WBjr status menu is not present or does not match the manual then you most likely have older firmware We recommend updating the firmware and doing a factory restore Warning all settings will be lost The firmware can be found on our website under the software tab Or at the URL below http www midnitesolar com firmware php firmwareProduct ID 1 Verify the neutral temperature for the temp comp is set per the battery manufacturers specs typically 25C Verify the Amp Hours of the battery bank 1s set properly Note batteries in a string
63. e edible au aa u DERE etu af Oa ed pde 43 Aux land Aux 2 Graphs Uff Debs susct tetti tates Msn aat teniente E E it unaque un t a tede DER Ue pIE 43 Aux Voltase Time Relation Relay 2V secco a mee eph trm etc x a a br eb tom trm dca added un ane 44 Aux 2 voltaeesLm e Relation PW M sas erne net be ha an nana eN aun s aaa wamaqa aap Su asas 45 setts the MINGP Teatre Sie sitet dedos oat cif ae se um Re UIN LM ISI nese 46 Navas dime s le MB opuntia Atl oot asia doti tss haapa Mo sna Cane 46 Viewing Other Mid Nite Products on the Display iieri text Ria Rer Urin aon Sentia here ituri Re pe etude 47 Connecting the Classic to Two MNGPs Network cable nennen eene nennen nennen nennen enne nnns 47 ATOT QUIE eon rt E ette bent eub ineo utr cata peer qua om ttr cut beds a UM oed utt cute eMe disce UM ute u u asa 48 View Faults and W aming S oer be cU u ME IE M D IM M IM ISI Le PLU UE 49 VIC WoO SCCM Atari heise lcm CE 49 Graphical Eose me Display MOSS uuu apasun s bawat ene Mau Mn t E M our uU M eese ERIS 52 Classic Lite uultis E 54 CED Ox AT ANON TEE E N A 54 PEOSTQmimng iiec a etie tua RM ME ME I MM IUE M CI UE MM I ME aaa ie UE 55 PIS wi De acest beatos orto boton Desisto oru sotto Dese hai au kamas haasi haasi habun 55 Section 1 Switch settings expIalled peo epe usha eunte G ebattaki ukuykuta qataykusaq 57 Section 2 Switch settings explained
64. e firmware and doing a factory restore Warning all settings will be lost The firmware can be found on our website under the software tab Or at the URL below http www midnitesolar com firmware php firmwareProduct ID 1 We advise against this as it is more complicated than most people feel comfortable with We recommend a cheap router for this as it makes it much easier The way to think about this is the Computer and Classic have NO address until the Router addresses them so if we must go direct we have to address both of them To do a direct connection we recommend a cross over Ethernet cable Then you need to set the Classic to a static IP say 192 168 1 5 then you need to go into the IPV4 properties on the PC and set it for a static IP also of say 192 168 1 2 Note the important part here is that the first 3 sets of numbers match 192 168 1 xxx for example and that the LAST sets of numbers do NOT match as this is the unique identifier of where each item is You will not need to worry about Gateways or DNS IPs for this connection For more help with this see our video on direct connection to Classic or consult your network guru 10 001 1 REV G I cannot find an uninstaller for the Midnite firmware updater What 1s the PASSWORD for the Classic I hear a singing sound coming from my Classic Sort of a high pitched whine that varies I have a classic that came with a grey Magnum Battery temp sensor can I replace it
65. e using Dip Switches under the front cover of the MNLP 2 The Classic Lite can be programmed with an independent MNGP 3 The Lite can be Networked with a standard Classic and programmed using the standard Classic s MNGP 4 The Classic Lite can be programmed using the Local App Through the Ethernet connection software available at www midnitesolar com Dip Switches Below you will find an Explanation of the Dip switches and the values associated with their settings Up is on and down is off on the switches To access the Dip switches you need to remove the front cover on the Lite display panel Firmly grasp the left and right side of the cover and slide it off Figure 24 55 Page 10 001 1 REV G Classic owner s manual RevG 2056 Now you will need to use the supplied tool Toothpick to place all 15 switches in the correct position AII the information on the switches can be found on the labels on the MNLP as well as in the tables below Keep in mind if any of the switches are set to Custom the Lite display becomes a LED display only and you will need to use the included PC software or a MNGP to program the Classic 2 SLIDE SWITCH UP TO TURN oN MINH 2 1 IPADOR E13 SQA PORI 13 526 527 STATICIP OFF 1921680223 OFF OFF 592 OFF DHCP o ON i 192 168 1 223 d OFF OF F oO 3900 71911681 224 OFF ON OFF 3901 192 16 amp 2 213 OFF ON O 10 0 0 223 O OFF 3001315 ON OFF 0 L1001224
66. ed in the TWEAKS menu See Disabling GFP for instructions To reset the internal GFP function after detection has occurred fix the actual ground fault then turn OFF the Classic and turn it back ON Do this by turning the external battery breaker to OFF position and then to ON position 23 Page 10 001 1 REV G Classic owner s manual RevG 2056 Disabling GFP The GFP feature should only be disabled to operate the Classic in an ungrounded power system or in systems where GFP is not required Press Main Menu Scroll to the right or left until TWEAKS is highlighted and press ENTER In TWEAKS press the right soft key to get to the MORE menu In MORE scroll until GFP is highlighted Use the up and down arrow keys to toggle between on and off Press ENTER to save vy v Vv Vv v v Wiring the Classic A WARNING Shock hazard Disconnect the batteries and input power before opening the Classic front cover ALWAYS use proper Over current and disconnects on the PV and Battery at the Classic When two or more Classics are paralleled onto one SINGLE DC Source a blocking diode must be used between each Classic and the input source to isolate each Classic from the other ones With Solar arrays you would have one array per Classic this only applies to larger wind or hydro turbines The Classic should be wired by a qualified professional and needs to meet all applicable electrical codes Always make sure all source and battery circuits are
67. eed help with a new sensor If you unplug the battery temp sensor and use a flat bladed screw driver to short out all 6 pins inside the jack Carefully so as not to bend the pins the fans should all start spinning You won t we removed the wizard as it asked a lot of questions that did nothing and was confusing We replaced it with the Quick Start that comes up when you first power the classic or do a factor restore Check to make sure you did not pinch the Fan wire at the top in the casting Check that you made the cable exactly the same as the blue one Note that Pin one on one end becomes Pin 6 at the other end Mirror image Iry a heavier cable We have found that off the shelf phone cables are good for about 25ft max before the voltage drop is to great We have found that cable like Cat3 or Cat5E can go about 100ft no problem The Classic regulates very well so within reason there is no limit on the input amps or PV wattage We recommend you not exceed 150 of the capacity The Classic just like a grid tie inverter can be over driven on the pv side it simply produces the max amount it 1s rated for First it should be noted a solar panel is rated in a lab so in the real world we typically see about 80 of what it is labeled So a 100 watt panel becomes an 80 watt panel Does the Classic say Absorb Float or EQ If so that means the battery 1s nearly full and the Classic is throttling back to prevent over charging the battery
68. f all DC breakers before connecting any wiring Torque all the Charge Controller s wire lugs and ground terminals to the specs found on page 21 Copper wiring must be rated at 75 C or higher Keep cables close together e g using a tie wrap as much as possible to reduce inductance Ensure both cables pass through the same knockout and conduit to allow the inductive currents to cancel DC battery over current protection must be used as part of the installation on the input and output Breakers between the battery and the Classic must meet UL489 standards Breakers between the DC source and the Classic must meet UL1077 or UL489 standards SCS Design the battery enclosure to prevent accumulation of hydrogen gas at the top of the enclosure Vent the battery compartment from the highest point to the outside A sloped lid can also be used to direct the flow of hydrogen to the vent opening Sealed AGM Gel etc batteries do not normally require ventilation Consult your battery manufacturer for details A WARNING PERSONAL PRECAUTIONS DURING INSTALLATION WARNING BATTERIES PRESENT RISK OF ELECTRICAL SHOCK BURN FROM HIGH SHORT CIRCUIT CURRENT FIRE OR EXPLOSION FROM VENTED GASES FOLLOW PROPER PRECAUTIONS Someone should be within range of your voice to come to your aid 1f needed Keep plenty of fresh water and soap nearby in case battery acid contacts skin clothing or
69. ge 37 for more Aux info BLK Bulk MPPT Mode By using the up arrow in Tweaks under BLK you can force the Classic into Bulk mode Bulk MPPT Maximum current charge stage the Classic is trying to bring the batteries to the Absorb voltage set point We are basically putting all available power into the batteries Comm This menu allows adjustment of things like Mod Bus port USB Mode and MNGP address DvrtCnt When enabled allows the charge stage timers to continue to run when the diversion modes are holding the battery voltage just below the actual set point Equalize Constant voltage charge stage to equalize the batteries The controller is regulating so maximum power will not be seen at this time The Equalize timer is also counting down to the switch to Float EQ MPPT Maximum current charge stage The Classic is trying to bring the batteries to the Equalize voltage set point We are basically putting all available power into the batteries Float Constant voltage charge stage with a lower voltage than the Absorb charge point The controller is regulating so maximum power will not be seen at this time Float MPPT Maximum current charge stage The Classic is trying to bring the batteries to the Float voltage set point We are basically putting all available power into the batteries FLT Float mode By using the up arrow in Tweaks under FLT you can force the Classic into Float mode GF Ground Fault See page 23 for
70. ge controller 28 AC Generator 29 Batteries The Voltage must match the voltage of the inverter Typically 2 3 strings of batteries would be considered the max 30 Classic temperature sensor This is used to compensate for the temperature of the battery If a battery is cold it has to be charged to a slightly higher voltage and when it is hot it will be charged to a slightly lower voltage 3 DC Cables to Inverter 25 Page 300011 REV G Classic owner s manual RevG 2056 CLASSIC WIRING FLOW DIAGRAM REVB 10 3 14 dh a AAAAARARM Diagram 1 26 Page 10 001 1 REV G Classic owner s manual RevG 2056 DC Terminal Connector 26 ZITIUDPHD Tues o o EC o o O9 gt HE vga 199 S RE FE S p uar I 4 e wee slc JUMPER CONFIGURATION 784 Fan fed RELAY OUT JP4 INSTALL FOR ant AU M 1 TERMINALS Figure 17 The Classic s DC terminal connector is located on the circuit board as shown in figure 17 The connector will take up to a 4 AWG 4 AWG THHN when installed in the Classic and MidNite E Panel is rated for over 100 amps and is therefore suitable for the highest power available from the Classic 150 After installing the wires for the last time snap in the blue cover that is included in the parts bag Over Current Protection and Wire Size Requirements The over current devices wiring and installation methods used must conform to all electrical codes applicable to the locati
71. ghlights the DAY change key Pressing the UP key decrements the date goes back 1 day and displays that capture date above the word DAY There are 380 days of information stored in the Classic After 380 days are captured and stored the oldest data stored will be overwritten as new daily data fills in as the most recent data 50 Page 10 001 1 REV G Classic owner s manual RevG 2056 The HOURLY log menu actually captured every 5 minutes works very similar to the DAILY log menu except that the time stamp above the word TIME is the time shown in 24 hour format that the data was captured that day The category of data captured is of course more suited for minute by minute capture rather than the maximum data statistics captured on a day by day basis in the DAILY log screen The left side of the recent history text log screen can be individually viewed by selecting the left side and pressing the UP DOWN arrow keys to show the power voltages charge stage etc and various information captured at the time shown on the right side time selection Screenshot 5 At the bottom of the DAILY text log screen the TIME the maximum statistics were stored is shown whereas at the bottom of the HOURLY text log screen the DATE of the capture is shown Again if for some reason the year of the time stamp was less than 2011 the time date will alternate between INVALID and the time date stamped along with that data and does not necessarily mean the
72. h It would be comparable to using the NC contacts of the relay used in Pv V High It can be used that way with a solid state relay with NC contacts for a failsafe load Pv V on High This mode is PWM based and will PWM Aux 2 above a user set voltage V High based on the input voltage to the Classic and stop when it hits a low voltage set point V Low Toggle Test This mode will cycle Aux 2 for 1 second off and 1 second on repeatedly This mode is mostly for testing purposes Waste Not Lo This mode is PWM based and is just reverse logic of Waste Not Hi It would be comparable to using the NC contacts of the relay used in Waste Not Hi It can be used that way with a solid state relay and NC contacts to do diversion above a set voltage 41 Pacge 100011 REV G Waste Not Hi Classic owner s manual RevG 2056 This mode is PWM based and will PWM Aux 2 when the Classic gets within a certain range of the voltage set points for each charging stage V High and stop when it gets to a low set point V Low These set points are user adjustable and will allow the Absorb Float and EQ timers to continue to run You will adjust these set points to negative numbers and the numbers are an offset from the voltage set point For example a 0 2 would turn Aux 2 on 2 tenths of a volt below your set points This mode will allow you maximum diversion while maintaining your 3 stage charging Diversion Lo This mode is PWM based and is just reverse
73. have updated with the wrong model code Look at the inductor stickers they will have the model of classic on them also so you can verify and re update with that model code This is generally caused by failing to put the MNLP LED panel into Custom mode To put this into custom mode set S1 Switches 1 and 2 to ON or UP this will allow the LED panel to read the classic but not make ANY changes to its programming so you can program the Lite with the Local App Unfortunately on the Lite there 1s no battery to back up the real time clock like there 1s on the regular Classics You will need to use the Local App to reset the time after a power cycle The Local App will turn yellow if the time is not in sync with the PC you are viewing it on And the Local app has a time sync button on the Basic Configuration tab We recommend setting the dip switches for normal operation and DHCP Connect to it with the Local App and verify it has connected to the network Now at this point we can go switch the S1 switch 1 and 2 to ON or UP to set the MNLP to custom Do this with the Classic Lite powered on Now you can change the network settings on the Local App if you want Note setting switches to custom first and then powering the Classic Lite can cause issues trying to connect as it assumes you are already connected We anticipate setting to Custom AFTER connecting to the network There was a bug in older firmware that would cause this We recommend updating th
74. ic and are rated for continuous duty 10096 rating No de rating 1s required for the output breaker when using MidNite Solar breakers PV in particular will be capable of producing more current than its name plate rating in extreme situations so the safe minimum wire size should be selected for the PV array maximum short circuit current Please consult PV manufacturer for specifications The US National Electrical Code requires 1 56 times the PV short circuit current for wire size on the PV input Output wire size follows the NEC guidelines Typical wire size for output is GAWG for the Classic250 and 4AWG for the Classic200 and 150 but check all de ratings for your wire type and installation method Long Distance Wire Runs The Classic offers some unique opportunities 1f you are faced with longer than normal wire runs between the DC source and the Classic The Classic comes in 3 input voltage ranges letting you design a DC source at a higher voltage if it 1s beneficial For example let s say you have a 300 ft run from a PV array to the Classic You could wire for an open circuit voltage close to 250vdc accounting for the coldest temperature you will encounter This will allow you to run a smaller gauge wire than with a lower voltage charge controller The efficiency of a high voltage Classic 1s less than the lower voltage versions so you need to weigh the benefit If this sounds too complicated use this rule of thumb in selecting the proper Classic P
75. illips head screws with a 2 Phillips screwdriver Lift the front half of the Classic casting off You will need to unplug the display cable It works the same as any phone cable When installing the cover for the final time squeeze a small amount of Silicone grease Included in the parts bag onto the metal pins of the male jacks on the Display cable before plugging them in 13 Page 10 001 1 REV G Classic owner s manual RevG 2056 To re install the front cover of the Classic you will need to plug in the display cable and carefully route it around the components on the circuit board as you set the cover in place See Figure 2 Do not force the cover if it does not seat into place easily stop and look for any cables or wires that may be interfering With the cover seated in place install the four Phillips screws with a 2 Phillips screwdriver d Rau o i s 4 d M as SE skue of ue wr Eg v i A P f U E j 4 g gt EI i a kJ oa il SITIS ET d i EN qu obable Ls HEE Tum Ul v fil a t Tm e C Lan t Ht lt dilh Kc _ _ u L nnd Ya hi Figure 2 Mounting the Classic The following section covers typical mounting arrangements If you require additional details that are not covered here please contact our technical support team The Classic 1s designed to be directly mounted onto the
76. ing Voltage 160V PV A 140V PV 120 PV mm 70 PV 53A 4414W 83 3 72V Table 2 11 Page 10 001 1 REV G Classic owner s manual RevG 2056 250V Classic Power Graph 61A 878W 62A 1779W ERR 58A 1722W a 55A 3212W 55 n 835W se RE eS EM V s 3095W NSN 8728W e Y 43A MPPT Input Operating Voltage BD 40 SOS 180V PV 40A A 200V PV 3468W 14 4 28 8 43 2 57 6 72 86 4 w 12V 24V 48V 72V Table 3 The graphs above represent the max power output for a given input for each Classic Using and understanding these power graphs will help maximize Classic s output power and aid in selecting wire and breaker disconnects Notice that lower battery voltages and lower PV input voltages result in higher continuous output power The PV voltages listed are for reference and are not intended to be the only PV voltages supported The battery voltages listed show the most used battery bank configurations Other voltages are also supported The Classic battery voltage parameters are fully user adjustable For example if you are using a Classic 250 and 48v battery bank the maximum continuous output power based on 25 degree C ambient is 55 amps when using a PV array that yields a Maximum Power Voltage of 180 volts The same set up using a bit higher voltage modules that result in a 200V Maximum Power voltage will result in only 53 amps Although 55
77. ing the PV array 10 001 1 REV G How do I verify Follow Me is working properly The Fans seem way to loud Updating the firmware and the Classic went well but the MNGP will not update Classic goes to absorb at too low of a voltage Classic goes to absorb at too high of a voltage 7A Page Classic owner s manual RevG 2056 You should first go to the Main menu and then into the Temps menu and verify all controllers are seeing the Battery Temp from the one with the BTS plugged in You should also see a blue LED flashing inside the top vent There are two types of blink A short blink that is about one tenth of a second means it is getting good information A long blink that is about half a second indicates it did not get any info If the blinks are ALL long then you probably have a bad cable and all cables should be checked immediately Tf it is the internal fans make sure no wires or anything have come in contact with them inside the wiring compartment If it is the external fan you may want to remove the front half of the Turbo plastic housing and make sure the fan is still adhered into the back plastic housing If the fan has come loose a dab of silicone on each side should solve the noise issue Please make sure not to get any silicone on the fan blades Make sure the MNGP Display is actually plugged in using the blue display cable in the top jack of the main circuit board Verify you have an MNGP and n
78. is rock solid call customer service Iry doing a factory restore Warning all settings will be lost f this is a new install check for reverse polarity on the PV positive and negative on the blue terminal block inside the Classic If the system has been running all along and this just happened call customer service Make sure you did not put a different display on the Classic Firmware must match on the Classic and MNGP Do a HARDWARE Factory Restore See manual Enter the main menu and select Mode Turn the Mode ON ad press Enter to save this Then press Status to return to the main screen If using the Classic for wind and you cannot turn the mode on this can also indicate the wind curve is not linear and the classic cannot work with it Please make sure the wind curve continually goes up hill Check that the blue display cable is plugged in and connections are sound Try unplugging it and plugging it back 1n Check for corrosion also Do a HARDWARE Factory Restore See manual Check to make sure the blue display cable 1s plugged in well and that it is not running down over the 2 big yellow inductors on the left hand side of the circuit board This 1s normal as the battery is almost full and the extra power is not needed so the controller throttles back to prevent over charging of the battery This is normal as Follow Me simply coordinates the charge stages each Classic still works independently as far as regulat
79. lassic must be connected to Earth Ground for the internal DC GFP to work With the exception of certain telecom applications the Charge Controller should never be positive grounded The Charge Controller equipment ground is marked with this symbol If damaged or malfunctioning the Charge Controller should only be disassembled and repaired by a qualified service center Please contact your renewable energy dealer installer for assistance Incorrect reassembly risks malfunction electric shock or fire The Charge Controller is designed for indoor installation or installation inside a weatherproof enclosure It must not be exposed to rain and should be installed out of direct sunlight 8 Page 10 001 1 REV G Classic owner s manual RevG 2056 For routine user approved maintenance Turn off all circuit breakers including those to the solar modules batteries and related electrical connections before performing any maintenance Standards and Requirements All installations must comply with national and local electrical codes professional installation is recommended The NEC in the USA requires a DC ground fault interrupter for all residential PV installations NEC requires an ARC FAULT detector on all charge controllers and inverters operating above 80VDC Both of these devices are built into the Classic DC and Battery Related Installation Requirements All DC cables must meet local and national codes Shut of
80. last found MPP Voltage The range of this sweep is determined by the Sweep Depth user adjustment and is expressed as a percentage of Watts that the sweep started from For example if in Legacy P amp O mode the Classic was outputting 500 Watts and the Sweep Depth percentage was set for 10 50 Watts the sweep will bring the input voltage DOWN until the output power drops down to 450 Watts then will sweep UP in voltage until the power drops again down to 450 Watts and then go back to the newly found MPP Voltage waiting for the next sweep Wind Track This mode uses a power curve that is either built by the user or one of the pre installed graphs The power curve consists of 16 set points that consist of output amperage and input voltage allowing the user to custom build a curve for their Wind turbine Please refer to the Wind section of the manual for full details on programming the curve as well as our video that will help in understanding how to adjust these curves using the wind graph editor Dynamic This 1s typically used for PV solar input sources and tries to follow on a slow dynamic basis the changing conditions of the input source This mode has one user adjustment which is a forced sweep perturb trigger interval for times when the input condition changes do not trigger a dynamic sweep The interval 1s 1n units of minutes U Set VOC This 1s a fully manual mode based on a percentage of VOC The Classic will sweep based on the use
81. less per channel Here is an explanation of how they work Aninternal re settable Positive Temperature Co efficient PTC fuse protects the AUX internal components from overcurrent or a short circuit AUX 1 consists of either RELAY or LOGIC operation depending on the user selection function gt AUX 2 could be set to become an INPUT or OUTPUT One at a time this port could be reading the state of a device connected and takes an action from there AUX 1 AUX 2 RRO OFF RELAY LOGIC INPUT OUTPUT CLASSIC SETUP Screenshot 2 37 Page 10 001 1 REV G Classic owner s manual RevG 2056 To configure the Classic s Aux ports Push the Main Menu button Scroll left or right to highlight AUX and push the Enter button Scroll left or right to highlight the relay you wish to change Push the right soft key labeled SETUP Scroll up or down to change the function of the relay Select the right soft key to set the parameters of the function When finished push the ENTER button to save the changes The Main Aux Screen shows both Aux and Aux functions Places output to Low state 0 Volts Selects the assigned function to the Aux output or input Sets output for Low state 12 Volts or Relay On Table 4 The Following is a list of the Aux 1 and 2 functions with brief descriptions of their function AUX 1 Control Settings 12V 200Ma or Dry 1A Contact SOC Low This mode will set AUXI to 0 0V accordi
82. loat it can show this and will go away as soon as the other controller goes to float If this is a new install the wrong nominal voltage may be selected and a factory restore will be needed if this is a running system then you may have another charging source that has malfunctioned and over charging the battery bank Generally this would be caused by the PV or Battery positive shorting to ground somewhere in the system The first thing to do is verify it is a real fault by carefully measuring between Battery Negative and Earth ground If you see any voltage here than the system has a fault Call your installer for help finding and rectifying the fault The Classic will automatically stop showing the fault when the issue is fixed 10 001 1 REV G My Classic says Set date and time on the display I have a WBjr and the SOC is not showing on the main status screen I don t see a WBjr status screen or I don t see all the settings shown in the manual My State of Charge seems inaccurate Classic says Arc Fault on the display and is making a loud beeping noise My Classic Lite has ALL of its LEDs blinking slowly 76 Page Classic owner s manual RevG 2056 Verify you are not setting the date and time with the local app without time sync off in the tweaks menu If not using the local app to set the time then verify that time sync is ON in the tweaks menu Verify the Remove paper was removed out of th
83. logic of Diversion Hi It would be comparable to using the NC contacts of the relay used in Diversion Hi It can be used that way with a solid state relay and NC contacts to do diversion above a set voltage Diversion Hi This mode is PWM based and will PWM Aux 2 at a set point based on battery voltage V High and stop it at another set point based on battery voltage V Low Aux 1 Function OUTPUT Relay or 12V OV Signal jumper selectable ON OFF Function Dry Contact 1A max Aux 1 has the relay so Diversion functions must operate slowly SOC LOW SOC HIGH GFP TRIP HIGH VENT FAN LOW VENT FAN HIGH FLOAT LOW FLOAT HIGH CLIPPER CONTROL DAY LIGHT NITE LIGHT TOGGLE TEST Pv V ON LOW Pv V ON HIGH WASTE NOT LO WASTE NOT HI 42 Page Battery State of Charge Active LOW Battery State of Charge Active HIGH Ground Fault sets AUX1 HIGH for 0 1 seconds repeatedly Aux on below setpoint Aux on above setpoint Aux off when in Float Aux on when in Float PWM Control for Clipper Aux on at dawn off at dusk Aux on at dusk off at dawn Aux cycled 1 sec interval Aux on below Pv in setpoint Aux on above Pv in setpoint Divert based on charge state lo Divert based on charge state hi 10 001 1 REV G Classic owner s manual RevG 2056 LOW BAT DISC Disc load based on bat volt DIVERSION Slow Diversion control Aux 2 Function Output Input OUTPUT 12V 0V Signal 500Hz PWM WIZBANG JR Current Shunt Option FORCE FLOAT
84. mething like common bus bars When you use more than 2 strings it is very hard to properly charge the middle strings The only safe way to do this is wire each string with equal length cables to a common bus bar Not making sure your lead acid batteries get a full charge at least once a week Routinely using more than 50 of the capacity of the lead acid battery Using more than half the battery capacity drastically shortens the batteries life once in a while is fine but on a daily basis will kill them in months Not leaving ample space between cells for cooling We recommend at least 1 inch between the cells for cooling Please ask the manufacturer what they recommend Trusting a State Of Charge meter They can all get off over time and give you false readings You need to verify specific gravity and or verify the charge voltage 1s being met Never fully rely on the SOC it 1s just a good quick reference 10 Page 1000141 REV G Classic owner s manual RevG 2056 Classic Power Curves 150V Classic Power Graph 96A 1380W 94A 2700W w 93A 13 meas 90 92A 1325W e 86 5022W 83A 4847W E 50 MPPT Input Operating Voltage 80A 4672 75 9 120V PV A 110V PV 76A 4 100v PV mm 90V PV 4438W 70 70V PV pa 14 4 28 7 58 4 Table 1 200V Classic Power Graph 79A 1137W 784 2238W T T9885 78A 4550W 13A 1050W 12A 74A 1065W 2066W MPPT Input Operat
85. n An Equalize stage can be scheduled or started at any time by holding the Equalize button down for 2 3 seconds Holding the EQ button down for 2 3 seconds at any point once equalization 1s activated will cancel the equalization stage and return back to the most appropriate battery stage When the equalize button is pressed the EQ light will come on solid Once Equalize proper starts the light will flash If Equalization cannot begin immediately then the Lite will try to engage equalization for 18 hours and then stop if it can t 30 Page 10 001 1 REV G Classic owner s manual RevG 2056 Equalization with the standard Classic Manual EQ To do a manual Equalization charge go into the Charge menu and highlight EQ and press Enter Now EQ Stopped will be highlighted Scroll up to select Eq Started Press the Status button to return to the home screen To stop a manual EQ in progress simply reverse the steps above A manual EQ when started will last for that day unless the Classic is on Hydro or Wind and the controller never goes to Resting that night In this case it will stay in EQ until it completes or the controller goes to Resting Auto EQ The Classic can be set up to automatically equalize your batteries periodically programmed as days between Equalization and the number of days the Classic will try to finish the programmed equalization charge cycle To set up Auto EQ go into the CHARGE menu and highlight EQ and
86. n happen on older Classics that have had the firmware updated This will have no effect on the operation of the classic but to make the message go away do a factory restore to fix this Warning all settings will be lost This can be normal if the battery bank is small or the inverter cables are too small If this shows up just once in a great while that would be ok but if it 1s happening pretty regularly you may want to look at the size of the battery cables Age of the battery bank or the size of the battery Call customer service for assistance This indicates the Classic is current limiting Either because it has reached the current limit you have set in the Charge menu under limits or because it 1s to hot and it is backing its current down to prevent overheating Go into the Main menu and the Charge category Look in the Limits sub menu and verify the amp limits for In and Out are set to what you desire This is indicating that the input voltage has exceeded the operational voltage of the Classic If this 1s happening now and then on rare occasions when it 1s really cold then this is normal If this 1s happening all the time this indicates the PV array was wired for too high a voltage Please consult your installer for assistance with that This is an indication the Classic thinks the battery voltage is to high and has stopped charging This can happen with multiple controllers that are not networked together if one of the classics goes to f
87. n in Status Each data point shown in the graphical view screen is shown as a dot There are a maximum of 96 dots appearing horizontally per screen with some information about each dot shown on the left side of the screen An individual data point can be selected for investigation by moving a small flashing once per second vertical cursor horizontally across the graphed data by using the Left and Right arrow keys The most recent data is shown on the right most side of the first screen The cursor first appears around 20 dots or data points from the right side of the first screen About 20 data points ago in history To scroll the data viewed one third of a screen to the left hold the Shift key and the Soft Left button down and also tap the Left arrow key Each press of this combination of buttons will scroll the graphical view horizontally another 1 3 screen Holding the Shift key and Right arrow key on the most recent data screen will push the cursor up against the right side and onto data point one Pressing the Up arrow button will change the data viewed to the next category For instance in the Recent history graph screen the displayed data will change from Power to input voltage battery voltage and kW Hours Pressing the Down arrow key will bring the category of data back down again A very brief 5 or 6 character annunciator displayed in the upper left corner tells us what category of data the graph is showing us The number just
88. nerne nn nnee 17 Battery Temperature Sensor Installation 20 Chassis Grounding ccccccecseeeeesesssessessseseesseeseeeseeseeeeeseeeeeeeeeeeseeeeeeeeeeeeeeeeeeeeeeeeeeeeeseeeeeeseeseeeeeeeseeeeseeeeeeeeeeeeeegs 22 DC SVStem CHOUD HIE u m u u uuu MUNDI NRI IMMER DNE M DNE MM LERET M DE MM 22 DC GFP Ground Fault Protection r 23 i bH AGED aun ee eee aaa eer tee Terre eer ere eee er ee Te eee ee eee ee eee eee 24 NE FEE CLAS SU gc 24 DC sim ca ECS EET C E ee ee 27 Over Current Protection and Wire Size Requirements 27 bU D R T E E E 27 Over Ue 1 E OC IO uu r EE Eee 28 o Di ANE O T i P E E am am cs E A E E 28 Connecting the Classic to the DDDOE associere kreere dere mI usua tM pm Epp EM eer DM DELIS 28 Maximum and Minimum Wire SIZ62u__ u u u u uuu askasskasaquwankuskaqaqatiqawaqqakkasapaqpiqassqhskasakaspaywawaukhasaqass 30 Equalization Manual and Auto 30 Equalization wihi the Classic i 30 Egualizauom Wile MG standard CHASSIC u u a
89. networks with static IP allocations e Press Main Menu e Scroll to NET menu and press the Enter button e Highlight and select STATIC e Using the left and right keys navigate to the settings to change and use the up and down arrows to adjust the desired fields e Press the ENTER button at any time to commit the settings to the Classic s Flash memory Please note that static settings span two menu screens You may use the soft keys to navigate between the two menus Pressing the ENTER key in either menu saves all settings to Flash memory For convenience when you manually set the device s IP address the Gateway and Primary DNS addresses follow the change See the following sections for details on each of these fields IP Address This is the local network address of your Classic It usually takes the form 192 169 0 1 x or 10 0 0 x depending on your networking equipment You must be careful when selecting this address If it does not match your network subnet then the classic will not be able to communicate with the network If it is the same as another device on the network then collisions will occur causing both devices to act erratically Check your router settings or ask your network administrator which local address to use Also refer to the troubleshooting section for tips Subnet This refers to the class of local network you are using This depends on your network hardware but most users should use 255 255 255
90. ng to the LOW and HIGH settings HOLD LOW and DELAY HIGH activation TIMES can be set in seconds SOC HIGH 0V SOC LOW 12V SOC High This Mode will set AUXI to 12V according to the LOW and HIGH settings HOLD LOW and DELAY HIGH activation TIMES can be set in seconds SOC HIGH 12V SOC LOW 0 0V If the classic is set to do an auto restart at 23 59 midnight the state of the AUXI will be remembered so it will return to the last state 12V or OFF after it resets and comes alive again GFP Trip High This mode sets AUXI HIGH 12V for 0 1 second when a ground fault is detected Vent Fan Lo This mode will turn AUXI OFF above the voltage set point you program It allows you to run a vent fan for a battery bank based on battery voltage There 1s a voltage set point that you set and AUX 1 will turn off when the battery reaches that set point The voltage has to fall 2 tenths of a volt below the set point for 30 seconds before AUXI will turn back on 38 Page 10 001 1 REV G Classic owner s manual RevG 2056 Vent Fan High This mode will turn Aux 1 on above the voltage set point you program It allows you to run a vent fan for a battery bank based on battery voltage There is a voltage set point that you set and Aux 1 will turn on when the battery reaches that set point The voltage has to fall 2 tenths of a volt below the set point for 30 seconds before Aux 1 will turn off Float Low This mode will turn Aux off whene
91. o Display To Display Classic 1 Classic 2 Classic 3 Classic 4 ALL You can Network as many Classic s as needed The Last Classic has to connects to the first Classic as shown by the orange Line You need to go from Out on Classic 1 to In on Classic 2 and so on Midnite Solar offers 3ft Network cables If you need custom lengths and want to make your own the Network Cables need to be 4 conductor with RJ11 jacks the blue and white wires in the picture below are not needed Pin 1 on one end becomes pin 6 on the other Most off the shelf 4 conductor phone cables can be used Figure 10 Follow Me diagram When installing the Follow Me cables for the last time it is recommended you add a bit of the included silicone grease on the metal contacts of the male ends of all the cables 19 Page 10 001 1 REV G Classic owner s manual RevG 2056 Cable Clamp for network cables Battery Temp Sensor included USB connector Ethernet connector Figure 11 Battery Temperature Sensor Installation A CAUTION To reduce risk of injury charge only deep cycle lead acid lead antimony lead calcium gel cell or absorbed glass mat type rechargeable batteries Other types of batteries may burst causing personal injury and damage Never charge a frozen battery WARNING RISK OF INJURY To reduce the risk of injury charge only properly rated such as 6 V 12 V and 24 V lead acid GEL AGM Flooded or Nickel Cadmium recharge
92. om one Classic to other Classics etc Programming the Lite with the Local App You can use the Local Application software available at www midnitesolar com to program it as well You will need the serial number of the Classic to unlock the two way functionality of the Local App Please see the Local App instructions for more details You will also need to set the Dip Switches to Custom Clearing Faults If either the Ground Fault or Current Limit fault light 1s lit then the equalize button can be tapped to clear these faults If the fault condition has not been removed however then the light will re illuminate indicating that a fault condition 1s still present Notes on the Lite If anything is set to Custom then the MNLP lite will not send any programming data to the Classic So a Custom setting effectively disables MNLP Lite Control over the Classic requiring the user to use a PC or MNGP to configure the Classic Note The Custom setting still allows full function of the LED s and the EQ button 62 Page 10 001 1 REV G Classic owner s manual RevG 2056 Explanations of Solar and Legacy solar This 1s the default mode for PV systems and has a very fast sweep typicallya half of a second or less that will re sweep at user adjustable sweep intervals unless the Classic finds that it needs to do a sweep on its own because of changing conditions The timed sweep interval is user adjustable and is in units of minutes SOLAR mode is typic
93. on of installation Wiring needs to be protected with proper strain relief clamps and or conduit See page 76 for a breaker and wire size chart The network cables USB cable BTS cable and auxiliary input output cables should run in a different conduit to preserve their signal When installing the Classic in a MidNite E Panel it is acceptable to run all wiring through the same knockout hole It 1s legal to run signal and power wires together as long as all wiring 1s listed for the highest voltage to be encountered Follow all local code Current Rating The Classic limits the output current based on the model you have 27 Page 10 001 1 REV G Classic owner s manual RevG 2056 The Classic current ratings are Classic 150 150 Lite 96 amps maximum Classic 200 200 Lite 79 amps maximum Classic 250 250 Lite 62 amps maximum Over Current Protection The Classic must have over current protection to protect wiring from over current events A means of disconnect must be installed on the DC in and DC out of the Classic Consult your local codes to determine over current ratings The breaker between the battery bank and the Classic must conform to UL489 The breaker between the DC source and the Classic must conform to UL1077 or UL489 The NEC requires 1 56 times short circuit current for PV over current protection This 1s reduced to 1 25 times when using a breaker rated for continuous duty All MidNite Solar breakers are hydraulic magnet
94. or the Classic to de energize Figure 27 64 Page 10 001 1 REV G Classic owner s manual RevG 2056 2 Remove the four screws holding the front cover of the Classic charge controller Do not let the front cover hang by the cable Figure 28 3 Holding the front cover with one hand place a screw in the top left hole of the front cover and screw it into the top right hole of the back casting 7O Oy MES d s MAINE Figure 29 65 Page 10 001 1 REV G Classic owner s manual RevG 2056 4 Useany Standard to Mini B USB cable to connect the Classic to the PC The smaller terminal connects to the USB port on the Classic The USB port is located on the right side of the Ethernet Jack in the lower part of the Classic ww LS _ _ Led Lad Lad Lad Lad ud Figure 30 Connecting the Classic to the Internet Networking The Classic supports standard 10 100 base T Ethernet networks For Gigabit networks you will need a common network switch that is capable of mixed mode operation The Classic may also be placed on a b g orn wireless networks by using a wireless network bridge device Depending on your network you may use one of the topographies detailed in Example 1 through 4 below Note that the switch may be self contained or in many cases may already be integrated into your cable or DSL modem Refer to Figure 30 for Ethernet connector location in the Classic
95. or the Classic will not survive MidNite does not recommend the use of Tigo Module Optimizers with the Classic If Tigo modules must be installed Legacy P amp O MUST be used When the Classic is used with Wind or Hydro a Clipper type device will most likely be needed to protect against over voltage A battery based diversion load WILL NOT keep the Classic safe from over voltage High input voltage is recorded and over voltage is not covered under warranty Never hook a Pump or other load to the Input side of the Classic If a Load must be hooked to the input side of the classic the load and Classic need to have blocking diodes on them Never Parallel 2 Classics onto one PV array If 2 Classic s have to be paralleled for wind or hydro NOT SOLAR there must be blocking diodes on each Classic For Larger systems with Large inverters and or multiple inverters like the Radian or XW for example it is important to use appropriate sized cables and bus bars or damage to the inverters or charge controllers can occur Take a single XW E Panel for example it has a positive bus bar for Charge controller battery side connections This bus bar is sufficient for 2 charge controllers so if you needed 3 or more then you need to look at the best way to handle the amperage Or a Dual Radian for example is actually 4 separate inverters Proper size cables become very important as well as large enough battery banks Most manufacturers of Battery based inverters
96. ot an MNLP The MNLP is an LED panel that comes with the Classic Lite and does not need to be updated When the black box pops up telling you to power the Classic up Count to 4 before turning the breaker on If you do not have a breaker or disconnect and you are trying to connect a wire to a terminal block or a battery the connection will likely be to dirty for the boot loader Install the proper breakers Verify this 1s not normal operation do to the battery being warmer than the neutral point You can verify the battery temperature by going into the main menu and selecting the Temps menu The Classic like all other chargers will adjust the actual charge voltage based on the temperature of the battery It uses 2 variables you program in for this 1 Temperature neutral point Typically 25 degrees C and this 1s found in the WBjr set up menus 2 Milli volts per degree C per cell typically 5Mv So verify both of these are set per the battery manufacturers specs So for an example 1f Absorb was set for 58 8 volts and the battery is at 35 degrees C and the temp comp is set for 5mv we have a 10 degree C difference 10 x 24 240 x 5 1200Mv or 1 2v so the Classic would actually charge to 57 6v Verify this is not normal operation do to the battery being cooler than the Neutral point You can verify the battery temperature by going into the main menu and selecting the Temps menu The Classic like all other chargers will adjust the a
97. otocol to allow users to interface with the Classic See www midnitesolar com for our Mod Bus protocol My MidNite Web based monitoring for the Classic Not available yet NiteLog When enabled allows the Classic to log data in the evening when the Classic is Resting PV Shading This indicates the Maximum power point voltage is less than half the open circuit voltage Pwr Save Allows you to adjust the time the Backlight stays on Resting The Classic is not charging the battery due to low light For certain reasons Resting will appear Please see page 32 Shade When enabled the Classic will show PV Shading on the display when the Maximum power point voltage is less than half the open circuit voltage T Comp Temperature compensation using a temperature sensor to measure the ambient temperature of the battery bank and will adjust the voltage set points up or down accordingly to ensure a full battery There are 3 parameters to set Minimum and Maximum adjusted voltage as well as volts per degree C per Cell Typically this is 5 mV but please consult your battery manufacturer See page 17 for Temperature compensation info Tweaks This menu has all the advanced adjustments for the Classic For example Voltage off set adjustments etc VBatt Battery voltage measured at the battery terminals of the Classic VOC Open Circuit Voltage unloaded voltage measurement Vpv Input voltage measured at the input terminals of th
98. pdate The Classic has a boot loader that will always look for new firmware on boot up so you can not damage the Classic No they both require drastically different tracking algorithms so you will need two Classics Yes as long as they have separate Solar Arrays No the Classic will work just fine in conjunction with ANY other charger on the same battery 10 001 1 REV G Classic owner s manual RevG 2056 Electrical Specifications Classic150 Classic200 Classic250 l Operating Volts in 150VDC 200VDC 250VDC Max Hyper VOC 150 battery 200 battery 250 battery Battery Charge Volts 12 93 volts 12 93 volts 12 93 volts E Absolute Current 96a at 12v battery 74a at 12v battery 60a at 12v battery I a 94a at 24v battery 70a at 24v battery 62a at 24v battery Output at 25 C 83a at 48v battery 65a at 48v battery 55a at 48v battery De rate current 40c to 40c Dimensions of Classic 14 87 X 5 95 X 4 00 378mm X 151mm X 102mm 19 00 X 8 50 X 5 70 483mm X 216mm xX145mm Shipping Weight 11 5lb 4 9 kg NOTE Current output ratings were measured with 75 of the PV array s VOC Open Circuit Voltage NOTE Calculated by adding battery voltage to the maximum input operating voltage 48V battery max NOTE Measurement Accuracies 0 12v offset calibration adjustment maybe necessary Table 10 80 Page 10 001 1 REV G Classic owner s manual RevG 2056 specifications Mechanical 6 00 3 94 15 53 14 91 01 38 2
99. port is NOT isolated from battery negative This is typically only an issue on positive ground systems or systems with a tripped ground fault protection device Care must be taken that a computer connected to the Classic s USB port is either isolated from ground and the Classic s negative or that the computer s USB negative is common with the Classic s negative and ground WARNING You cannot turn a Classic 150 into a Classic 200 for example using new software the internal components are also different 63 Page 10 001 1 REV G Classic owner s manual RevG 2056 gt ie Robin s Corner The engineers at MidNite Solar have been designing renewable energy disconned boxes for twenty years The majority of the existing disconnect boxes wero designed by us We Pink we have finally got right People in the industry have spent years teaching us what is important to them Our E Panels take care of the over current and disconnect requirements This allows you to devote more of your hard eamed money to he performance components such as PV panels power electronics and batteries Rahin MIDNITE SOLAR I P DOCUMENTS GALLERY PRODUCTS SCHEDULE FIRMWARE ARE SUPPORT PRICELIST FORUM EL i Figure 26 Prepare Classic charge controller for update 1 Goto your electrical panel and identify the input and output breakers for the Classic Turn them off Wait 3 minutes f
100. r input voltage battery voltage Charging Stage amps out and kW Hours A time and date stamp is associated with each data entry in both Daily and Hourly history logs The main time date stamp for each data logging mode is Date for daily history and Time for recent history although both time and date are stored and displayed for each logging mode 49 Page 102 0011 REV G Classic owner s manual RevG 2056 PNE x E DEL AN ds CES NDS YT Xx Y ex 8 a nm m a y nu z t dU emi MESA S o Ds err Ihre DC 7 ee wem T der CF TOU fi m GANT ry og y u 197 wide ye ae Ts gt Z o L r MM e Ur P z AT oh LM tet ss Jot Swat ER SEE OUS G A ewes fos CL CIS c B e 1 PPA Ss rion ag lee ma do C68 z k we r E ghe ar TA a T nce T 4 s sk k When entering the LOGS menu you will see two items displayed there The top line is lifetime kW Hours for the Classic and below that is time spent in float today Note Float Absorb Bulk and EQ time is also viewable in the TIMER VU sub menu of the ChgTime menu in the main CHARGE menu Pressing the SOFT LEFT key enters the DAILY history data viewing menu Similarly pressing the SOFT RIGHT key enters the HOURLY recent history data viewing menu In the DAILY menu the LEFT side category of information displayed can be changed by pressing the UP or DOWN arrow keys Switching over to the RIGHT side of the screen by pressing the RIGHT arrow key hi
101. r 48 volt batteries for specific information on this function 57 Page 10 001 1 REV G Classic owner s manual RevG 2056 Section 2 Switch settings explained DHCP or Static IP address Switch 1 Section 2 On Section 2 Switch 1 when on will enable DHCP This will allow the Router on the network to assign the Classic Lite an IP address When off it sets the Classic to a static IP address that will be determined by Switches 2 3 and 4 IP Address Switches 2 3 and 4 Section 2 On Section 2 Switches 2 3 and 4 will set the Static IP Address of the Classic Lite to the address shown in the table below 1f Switch 1 1s set to Off for Static IP ModBus Port Switches 5 6 and 7 Section 2 On Section 2 Switches 5 6 and 7 set the ModBus port of the Classic Lite The values that correspond to the switches are found in the table below The actual Labels that are on the inside of the MNLP LEGACY OFF ON 24V OFF HCE DOF STATICIP EE ofr orr OFF Billilor or or DHCP 192 168 1 223 OFF OFF ON 3900 OFF OFF ON 192 168 1 224 OFF ON OFF 3901 OFF ON OFF 192 168 2 223 OFF ON ON 3902 OFF ON ON _100 0 223 ON OFF DEFAULT Table 5 58 Page 1 SLIDE SWITCH UP TO TURN ON 4 iI 1 6 1 7 EQ SOLAR OFF OFF aav OFF OFF GEL OFF OFF OFF MANUAL OFF e OFF EE S IS NE oe oc ED SEALD2 OFF ON OFF CUSTOM ON ON CUSTOM ON O
102. r com and a PC or a MidNite Solar MNGP Graphics Panel or the Graphics panel of another Standard Classic in the system If desired the Classic Lite can be used with an MNGP instead of the supplied MNLP controller LED explanations The Lite control panel MNLP has 6 status LEDs to indicate various modes of operation as well as faults There are three behind the small window on the upper left The top Orange status LED will light solid to indicate that the controller is in Bulk Charge mode The center Yellow status LED will light solid to indicate that the controller is in the absorption stage The lower Green LED will light solid to indicate that the controller is in Float and blink slowly to indicate the controller is Resting due to low light All 3 of these status LED s will blink slowly to indicate Wrong Code please see trouble shooting on page 71 for help with this There are also LED indicators for Current limit Ground Fault and Equalize All LEDs blinking slowly indicate a loss of communication with the Classic Check that the cable is plugged in to the top Jack on the Classic If error persists try another cable or call Tech support for assistance Status LED s Status LED definitions Equalize button MUD DIK CURRENT LIMIT GROUND FAULT Figure 23 54 Page 10 001 1 REV G Classic owner s manual RevG 2056 Programming There are four separate ways to program a Classic Lite 1 The programming is don
103. r set time in minutes and then park at a user set percentage of the VOC the Classic found on that sweep This mode is useful for testing or constant voltage sources Note Mode must be manually turned ON after changing the mode To turn the mode ON highlight the OFF under ON OFF and switch it to ON Press enter to save this change Configuring the Classic for Wind Input Source Wind If you selected Wind you will need to select a power curve from the list of pre loaded curves or build your own To access the list of power curves follow the steps below Push the Main Menu button Scroll left or right until Mode is highlighted and push the Enter button Set the status to OFF and then use the right soft key to select Graph Using the left soft key select MEM Now you can scroll up and down through the menu and select the curve that was designed for your turbine Once you find the correct power curve use the right soft key to select RECALL Now push the Enter button to save this power curve to the Classic s memory 36 Page 10 001 1 REV G Classic owner s manual RevG 2056 There are also 9 memory spaces for you to save a custom power curve To build custom power curves select a memory location between 1 and 9 and hit RECALL Use the right and left arrow buttons to scroll through the 16 steps in the custom curve On each step you can set the amperage by using the up and down buttons When you have the power curve
104. rature Sensor Installation 20 The Battery temperature menu appears as T Comp in the BATTERY MENU In this menu you can change the voltage compensation as needed If the BTS is disconnected or shorted the Classic will automatically default to 25C on the Battery temperature Also the Classic has the ability to change the neutral temperature typically 25C this setting can be found in the WBJr set up Follow ME Charging coordination Follow Me will allow Classics to share charge stages as well as Battery temperature info and Ground fault coordination Follow Me also allows you to program a single Classic for Equalize charging and it will instruct all the others to Equalize as well You do need to set the Equalize parameters in each Classic For the Battery Temp sensor you will need one BTS only and it can be on any of the Classics 17 Page 10 001 1 REV G Classic owner s manual RevG 2056 WARNING ALL FIRMWARE SHOULD MATCH ACROSS ALL CLASSICS WARNING REVERSED FOLLOW ME CABLES CAN DAMAGE THE CLASSIC IF LEDT IN PLACE FOR EXTENDED PERIODS OF TIME AND WILL NOT BE CONSIDERED UNDER WARRANTY PLEASE VERFY THE PROPER OPERATION OF FOLLOW ME ON THE INITIAL SET UP The Follow Me function basically is just what it is called The Classic will simply ask the Classic to its right What do I do now and this propagates around the loop continually Whoever goes to Float first for instance will simply tell everyone else it is time to go to float NOTE
105. recommend 100AH of battery per KW of solar modules Please consult the inverter manufacture for assistance with cable sizing etc 2 Page 10 001 1 REV G Classic owner s manual RevG 2056 Standard Classic Classic Lite This Manual covers models Classic 150 200 amp 250 as well as the Classic 150 200 amp 250 LITE 3 Page 10 001 1 REV G Classic owner s manual RevG 2056 Este manual tambi n est disponible en Espa ol La versi n en Espa ol puede encontrarse en nuestra pagina web en la ficha Documentos y haga clic en Manuales The MidNite Solar Classic charge controller conforms to UL 1741 Safety for Inverters Converters Controllers and Interconnection System Equipment for Use With Distributed Energy Resources Second Edition May 7 1999 with revisions through January 28 2010 and CAN CSA C22 2 No 107 1 2001 09 01 Ed 3 R2006 Notice of Copyright MidNite Solar s Classic charge controller User s Manual Copyright C 2010 all rights reserved MidNite Solar Inc reserves the right to revise this document and to periodically make changes to the content hereof without obligation or organization of such revisions or changes unless required to do so by prior arrangement Disclaimer Unless specifically agreed to in writing MidNite Solar Inc a Makes no warranty as to the accuracy sufficiency or suitability of any technical or other information provided in its manuals or other documentation b Assumes no responsi
106. rn the PV breaker and Battery breaker off What you don t have a breaker restore Get one asap and make sure the display has gone dark Do a hardware factory restore There are 4 sets of jumpers directly above the blue terminal block For the purpose of this we will call the left most jumper JP1 and the right most JP4 actually labeled Boot Step 1 Turn the PV and Battery power off to the Classic and remove the front cover Step 2 Locate the 2 jumpers JP1 and BOOT JP4 Take the actual jumpers and keep them in your hand Step 3 Turn the Battery power on to the classic Step 4 within 1 minute place jumper JP4 on its two pins and then place jumper JP1 on its two pins at this point the 3 leds on the top of the circuit board should flash back and forth for about 60 seconds Step 5 After the flashing stops power down the classic and remove JP1 and JP4 and stow them back on a single pin like they were Step 6 Put the front cover on and power up the Classic Lite If you have the MNLP set to Custom you will need to go to the local app and reset the battery voltage and setpoints etc What is a VMM It has become industry slang for our factory restore Vulcan Mind Meld from the 2 fingers needed to push the arrows 72 Page 10 001 1 REV G Classic will not power on No Fans or life on power up Classic Display is blank but the Classic is on Classic says Resting but the sun is out Classic switches between Re
107. se letters as well as numbers This name can be up to 8 characters This name will show up on the Display of the Classic instead of the word CLASSIC It will be shown in all upper case on the Classic s display The Naming process can be helpful for networked Classics that use one MNGP Display to view multiple Classics 18 Page 10 001 1 REV G Classic owner s manual RevG 2056 Addressing the Classics You can assign unique addresses to each networked Classic This is not necessary for Follow Me to work but it is necessary if you want to view multiple Classics from a single MNGP To address a Classic simply use the MNGP that 1s plugged into that Classic or plug the MNGP into that classic and hold the Left arrow button down and tap the up or down button The normal default address is 10 so going up will take you to 11 and down to 9 When you get to the unused address you want for that Classic hold the left and right arrows for a second until Data Sent and Saved shows up Now this Classic has been re addressed to the new address Do this for all the Classics or Classic Lites on the network To view other Classics on the network use the same button strokes Hold the left arrow down and tap the up or down arrow depending on which number you are looking for We suggest going from 10 up for clarity So if you had four Classics they would be 10 11 12 and 13 You would scroll up from the normal position to find the other three To Display To Display T
108. sic was outputting 1000 Watts and the Sweep Depth percentage was set for 20 200 Watts the sweep will bring the input voltage DOWN until the output power drops down to 800 Watts then will sweep UP in voltage until the power drops again down to 800 Watts and then go back to the newly found MPP Voltage waiting for the next sweep solar This 1s the default mode for PV systems and has a very fast sweep typically1 2 second or less that will re sweep at user adjustable sweep intervals unless the Classic finds that it needs to do a sweep on its own because of changing conditions The timed sweep interval is user adjustable and is in units of minutes SOLAR mode is typically best for PV systems especially if there is partial shading at times during the day SOLAR mode is best suited for shaded or un shaded PV arrays that are at least one nominal voltage above the battery voltage For severe partial shading or PV arrays with nominal voltage equal to battery voltage you may also want to try Legacy P amp O Perturb and Observe MPPT mode 35 Page 102 0011 REV G Classic owner s manual RevG 2056 Legacy P amp O Legacy P amp O Perturb and Observe mode is a slow tracking mode similar to the Micro Hydro mode but with the difference that it 1s slightly faster and will shut off if the power source goes off It has two settings that are user adjustable Sweep Interval 1s the time between mini sweeps in minutes and sweeps around the present 1 e the
109. sting and Bulk MPPT repeatedly but produces 0 watts The Display shows 0 volts in or real close but shows battery voltage correctly The Display is showing all Os and or Got Comm The Display 1s showing Mode is OFF Stuck in the Quick Start or VMM The MNGP Display is fuzzy or has odd characters Multiple charge controllers and one or more is showing 0 watts and absorb or float Multiple Classics in Follow Me and they are not all making the same amount of power 73 Page Classic owner s manual RevG 2056 Check for reverse polarity on the Battery positive and negative terminals on the blue terminal block Check for voltage on the Battery positive and negative terminals on the blue terminal block if less than 10v charge the battery or find the bad connection Check that the blue display cable is plugged into the top jack on the main circuit board and the display Iry the middle jack on the circuit board Try a different 4 conductor phone cable Resting indicates a lack of power available to the Classic Verify you have voltage on the display under the IN that is at least 130 of the actual battery voltage at that time Verify the charging mode is correct for the source as well as the Mode is on This can be normal under low light conditions Watch the input voltage 1f 1t drops down close to battery voltage and then the Classic goes to Resting this 1s usually a sign of a bad connection If it
110. te Not Hi This mode will turn Aux 1 on when the Classic gets within a certain range of the voltage set points for each charging stage V High and turn Aux 1 off when it gets to a low set point V Low These set points are user adjustable and will allow the Absorb Float and EQ timers to continue to run You will adjust these set points to negative numbers and the numbers are an offset from the voltage set point For example a 0 2 would turn Aux 1 on 2 tenths of a volt below your set points This mode will allow you maximum diversion while maintaining your 3 stage charging It also allows you to set a delay time in seconds the Classic will wait before turning Aux 1 on after reaching the V High set point It also allows you to set a hold time in seconds the Classic will wait before turning Aux 1 off after reaching the V Low set point Low bat disc This mode will turn Aux 1 off when it reaches a set point based on battery voltage V High and turn it on at another set point based on battery voltage V Low It also allows you to set a delay time in seconds the Classic will wait before turning Aux 1 off after reaching the V High set point It also allows you to set a hold time in seconds the Classic will wait before turning Aux 1 on after reaching the V Low set point This can be used with a NC relay when the battery gets to the set point the Classic will send 12vdc to the relay holding it open and disconnecting the load Diversion This mode will turn
111. tem for Hydro or Wind Pv V on High This Mode will turn Aux 1 on above a user set voltage based on the input voltage to the Classic V High and turn Aux 1 off when it hits a low voltage set point V Low It also allows you to set a delay time in seconds the Classic will wait before turning Aux 1 on after reaching the V High set point It also allows you to set a hold time in seconds the Classic will wait before turning Aux 1 off after reaching the V Low set point This mode can be useful for controlling a failsafe stopping system for Hydro or Wind 39 Page 100014 REV G Classic owner s manual RevG 2056 Waste Not Lo This mode will turn Aux 1 off when the Classic gets within a certain range of the voltage set points for each charging stage V High and turn Aux 1 on when it gets to a low set point V Low These set points are user adjustable and will allow the Absorb Float and EQ timers to continue to run You will adjust these set points to negative numbers and the numbers are an offset from the voltage set point For example a 0 2 would turn Aux 1 off 2 tenths of a volt below your set points This mode will allow you maximum diversion while maintaining your 3 stage charging It also allows you to set a delay time in seconds the Classic will wait before turning Aux 1 off after reaching the V High set point It also allows you to set a hold time in seconds the Classic will wait before turning Aux 1 on after reaching the V Low set point Was
112. ter the Absorb cycle 1s completed Float is displayed on the screen Battery voltage 1s held at the float voltage set point Equalize The Equalization function can be manually initiated or can be set up to Auto Equalize The intent of an Equalization charge 1s to bring all battery cells to an equal voltage by a controller deliberate overcharge The goal 1s to return each battery cell to its optimum condition through a series of voltage controlled chemical reactions inside the batteries Resting Resting will show on the display when the Classic 1s not charging the batteries this 1s typically due to low light If the Classic is resting and should not be make sure Aux2 is not set to a logic input that is forcing it into resting 32 Page 10 001 1 REV G Classic owner s manual RevG 2056 Mode is OFF The Classic is unique in that it has multiple charging algorithms for just about any DC input Because we support such a wide variety of DC inputs we have also added a software ON and OFF feature This software Switch basically turns the relay off effectively disconnecting the input source so the Classic will not charge the battery If you see Mode is Off in the bottom right corner of the display then the Mode may have been turned off To turn the mode back ON push the Main Menu button several times until Charge is highlighted Scroll to the right until Mode is highlighted and press Enter On this screen OFF
113. ter the date time is drawn on the bottom of that graph log screen If for some reason the graphic log screen display shows bogus data or dots that look like they should not be shown simply press the Enter button and the screen will be quickly erased and re drawn without the extra lines or dots There may or may not be any valid data past a certain point to the left if the unit is fairly new The data shown in unused spots may be zero or it may be off the screen and not viewable As time goes on and new data is acquired those unused data points will start to appear and be valid Of course the Daily history will take many days to fill in where the Recent hourly minutes really data will fill in after a few hours or maybe a day or two depending on how long the Classic is on and running for that day Remember the Classic does not normally log data while it is in Resting mode CAUTION Attempting to download the Logs using the Local app while viewing the Logs on the Display will cause the Classic to reboot 53 Page 10 001 1 REV G Classic owner s manual RevG 2056 Classic Lite Programming The Classic Lite 1s based on our Classic charge controller It has all of the same features Power and versatility minus only the Graphic Display and arc fault detection It can be used in all of the same applications For the advanced features to be accessed and programmed you will need to use the Local Application software available at www midnitesola
114. the right and highlight the current Mode than use the up and down arrows to set the mode you want Take note of the Right soft key most modes have some set points that can be adjusted Press the Main Menu button until you get back to the Mode Menu set the ON OFF to ON and press Enter MA gt MA MA e The following Modes will appear in this order in the MODE Menu Micro Hydro This mode is intended for use with hydro systems but can be used with other sources as well When the Classic first turns on after the input voltage goes above battery voltage it will sweep from that open circuit voltage down to battery voltage finding the maximum power point voltage MPP Voltage Then it will return to that newly found voltage After the original turn on sweep the Classic will do mini sweeps at user adjustable time intervals If the time interval is set to 0 the Classic will not do any mini sweeps but will stay on this first found MPP V until the user goes to the mode menu and turns it off and back on again Micro Hydro mode sweeps slightly slower than Solar mode and has two user adjustable settings Sweep Interval 1s the time between mini sweeps in minutes and sweeps around the present 1 e the last found MPP Voltage The range of this sweep is determined by the Sweep Depth user adjustment and is expressed as a percentage of Watts that the sweep started from For example if in Micro Hydro mode the Clas
115. this data and press Main Menu until you get back to the Aux 1 and Aux 2 screen Set the Text under Aux 2 to say Clipper Control and press Enter Press Status to return to the home screen 2 i 3 Phase AC from turbine r i l ief irc d Aux PWM Signal to Clipper from Classic AUX2 DC to Classic S Earth Ground Drawn by Rvan S 1 26 2012 Diagram 1 29 Page 10 001 1 REV G Classic owner s manual RevG 2056 Maximum and Minimum Wire Size The Classic s Blue DC terminal connector will accept wire from 214 24 AWG The Classic s Aux 1 and 2 terminal connector will accept wire up to 18 AWG Equalization Manual and Auto Equalization with the Classic Late S1 S2 5 6 7 1 2 3 4 5 6 7 8 1 2 3 4 Mode System Battery EQ DHCP IP Address MODBUS G Voltage Type port S Auto Equalize Switch 8 Equalize Manual Off Auto On By setting Auto Equalize to Manual the Equalize intervals in the Battery Settings table are effectively disabled and Equalization stages will have to be started manually Please note that not all manufacturers recommend Equalizing AGM batteries Check with your manufacturer and make sure to DISABLE Auto Equalization on the Lite if your manufacturer does not recommend equalizing your AGM batteries Equalize Button The Equalize button serves two purposes the first is to begin an Equalize stage the second is to clear faults Equalizatio
116. tton Scroll to LIMITS and press the Enter Button Press the right arrow key to highlight Out Amps or In Amps column Use the up and down arrow keys to change the current limit then press the Enter Button to save this data 33 Page 102 0011 REV G Classic owner s manual RevG 2056 LED Modes and the Blinking Red LED Below we will explain the different LED Modes To change the LED Mode press the Main Menu button repeatedly until Charge 1s highlighted Scroll to the right until Misc is highlighted and press Enter Now scroll to LED Mode and press Enter Here you can use the up and down arrows to select the mode you prefer After selecting the appropriate LED Mode press Enter to save this data to the Classic Pressing Status will now bring you back to the home screen OFF No LED activity no matter what Rick Mode LED Activity for Errors and Warnings only Over current Arc Fault Etc Blinky basically cycles all the LEDs in a Disco fashion Useful for Parties LED 1 LED activity for Warnings and Errors as well as info A green LED on the display indicates the Classic is in Float A yellow LED on the display indicates a warning Over Temp over current etc A red LED on the Display indicates an Error Arc Fault etc There is also 3 LEDS inside the Classic that can be viewed through the upper vents The red LED indicates Auxiliary 1 is active The yellow LED indicates Auxiliary 2 1s active The blu
117. ver the Classic is in Float Aux will stay off until the Classic falls 3 tenths of a volt below the float voltage set point Float High This mode will turn Aux 1 on whenever the Classic is in Float Aux 1 will stay on until the Classic falls 3 tenths of a volt below the float voltage set point Clipper Control This mode was intended to control the MidNite Clipper It will send out a PWM signal whenever the controller is unloading the turbine because the battery is full or close to it There are no adjustment in this mode the Classic 1s preprogrammed with the best parameters to control turbine RPM Day Light This mode will turn Aux 1 on at sunrise and turn it off at sunset based on the PV input voltage Nite Light This mode will turn Aux 1 on at sunset and turn it off at sunrise based on the PV input voltage Toggle Test This mode will cycle Aux 1 for 1 second off and 1 second on repeatedly This mode is mostly for testing purposes Pv V on Low This Mode will turn Aux 1 off above a user set voltage based on the input voltage to the Classic V High and turn Aux on when it hits a low voltage set point V Low It also allows you to set a delay time in seconds the Classic will wait before turning Aux 1 off after reaching the V High set point It also allows you to set a hold time in seconds the Classic will wait before turning Aux 1 on after reaching the V Low set point This mode can be useful for controlling a failsafe stopping sys
118. work address of the Classic The Subnet or address class specifier Gateway Address The address of the network s gateway device Primary DNS Address Primary Address lookup device Secondary DNS Address Secondary Address lookup device optional Web Enables or disables the Classic s online web service feature Access MAC Address The hardware or Ethernet address of the Classic DI DevcelD The unique MidNite Solar address of the Classic Table 9 DHCP The Classic supports Dynamic Host Configuration Protocol DHCP in which all networking settings are derived from a DHCP enabled router This is the simplest configuration method and recommended unless you explicitly need a statically allocated IP address for your Classic In this mode all other settings are automatically configured and are read only informational with the exception of the Web Access feature e Press Main Menu e Scroll to NET menu and press the Enter button e Highlight and select DCHP Please note that the Classic s DHCP protocol implementation usually takes a few seconds up to a minute to update e8 Page 10 001 1 REV G Classic owner s manual RevG 2056 the network settings If the network settings do not update within a minute please consult the troubleshooting section Static IP The Classic supports static IP address allocation In this mode you can assign the Classic a specific IP address This lets you set up things like port forwarding from your router or for

Manual - MidNite Solar

Contents

Download Pdf Manuals

Related Search

Related Contents