UPort 2000 Series User`s Manual
Contents
1. kiLz lt UPort COM Part il _ has not passed Windows Logo testing to very its compatibility with Windows P Tell me why this testing iz important Continuing your installation of this software may impair or destabilize the corect operation of your system either immediately or in the future Microsoft strongly recommends that you stop this installation now and contact the hardware vendor for software that has passed Windows Logo testing Continue Anyway 4 Wait while the driver is installed Found New Hardware Wizard Please wait while the wizard installs the software _y MoA UPort COM Part mizrmc sprrt dl To CAWINDOMW S systenms2 2 9 UPort 2000 Series Driver Installation 5 After all files have been copied to the system the Completing the Found New Hardware Wizard window will open to indicate that it has finished installing driver Click Finish to proceed with the rest of the installation Found New Hardware Wizard Completing the Found New Hardware Wizard The wizard has finished installing the software for F MOA UPort COM Port Click Finish to close the wizard Eancel 6 Repeat Step 1 through Step 5 for each of the remaining ports 1 port for the UPort 2210 and 3 ports for the UPort 2410 7 The Found New Hardware balloon will reappear to inform you that the hardware was installed successfully 1 Found New Hardware x Your new hardware is in2. cd moxa mxuport2000 make install Loading the Moxa Driver After installing the driver you will be able to load the Moxa driver The driver will be loaded automatically when you plug the UPort 2000 into your PC or you can load the driver manually by issuing the following command modprobe mxuport2000 If the driver has loaded successfully you should see a message such as the following _MOXA UPort 2000 series driver ver 1 0 loaded successfully You can verify that the driver has loaded by entering the following command 1smode For additional information please refer to readme txt file in the mxuport2000 directory UPort 2000 Series Driver Installation Unloading the Moxa Driver The driver will not unload automatically when you unplug the UPort 2000 from the PC To unload the Moxa driver you must remove it manually by issuing the following command rmmod mxuport2000 You can verify that the driver was unloaded by entering the following command 1smode For additional information please refer to readme txt file in the mxuport2000 directory Removing the Moxa Driver and Utility Files To remove the Moxa driver and utility files navigate to the path moxa mxuport2000 and then execute the following command make clean Both the driver and utility files will be removed Using the mxustty Utility To determine which UPort 2000 a particular serial device is connected to use the I option with the
3. mxustty utility General usage mxustty lt option gt device option h to activate the help file option I ell to locate a particular UPort device Use the following function call to locate the device ttyUSB3 mxustty 1 dev ttyUSB3 MAC OS X Driver The MAC OS X driver remains traditional in serial devices properties There are two serial ports Dial in port which waits for the carrier signal before opening and the Callout port Please check Moxa s website http www moxa com for the latest information and support for MAC OS X version 10 4 or later In this section we explain how to complete the following tasks 1 Installing the MAC OS X Driver 2 Verifying the Installation 3 Using the Utility 2 20 UPort 2000 Series Driver Installation Installing the MAC OS X Driver 1 Download the driver file from the Document and Software CD or from the Moxa website at http www moxa com 3 THAI dike p DEVICES Shared Folder amp Macintosh HD Mam man ol Dat Modified Size Kind driv_osx_uport2000_v1 0_build_12101919 dmg Oet 19 2012 7 20 PM 115KB Disk Image gt SHARED F PLACES E Desktop GE Developer CC Extensions tt P c C jason C upartznnd driver oy Applications i Documents SEARCH FOR 5 Today LL Yesterday E Past Week G All Images E A Movies B All Documents Ej Macintosh HD j Users f PVC E Desktop 5 disk copy 127 9
4. n Monitors E Network adapters FI Other devices Multimedia Audio Controller H Ports COM amp LPT EJ Processors H A Sound video and game controllers a3 System devices Universal Serial Bus controllers fil UPort 2000 Series Driver Installation The Ports Configuration page settings are described below MOXA UPort 2710 Series Properties E ajx General Fort Configuration Driver Details Basic Settings Intertace Friendly Hame h5 232 MOA LIPart COM AS 232 MOMMA UPort COM Reset Default Port Setting Help Locate Port Settings Auto Enumerating COM Number If the Auto Enumerating COM Number checkbox is checked COM numbers will be assigned automatically and in sequence to the ports E g COM3 to Port 1 COM4 to Port 2 etc If you do not enable this check box only the COM number for the selected port will be changed to the COM number listed in the drop down list box Enable this function if you want to configure the UPort s serial ports with sequential COM numbers Friendly Name Factory Default 1 to 20 characters Moxa UPort COM Optional E g UPort 2210 Users can assign a Friendly name to each of the UPort 2000 s serial ports The friendly name gives users an easy way to identify the serial devices connected to the UPort s serial ports If you enable set the change to all ports and then click OK the same friendly name will be assigned to all ports Fast Flush F
5. Disable If you now enable Fixed base COM Mode all parameters will be reset to their default values Port Number COM3 Friendly Name MOXA UPort COM Fast Flush Enable At this point you can set the COM numbers and other serial parameters to the values needed for your application If you subsequently disable Fixed base COM Mode all parameters will be restored to the original settings Port Number COM5 Friendly Name POS Device 1 Fast Flush Disable In Fixed base COM Mode you can reset the COM numbers and configuration parameters of individual ports to the values needed for your application at any time UPort 2000 Series Driver Installation Uninstalling the Driver 1 To uninstall the driver open the Windows Control Panel and click Add Remove Programs I sox File Edit View Favorites Tools Help sack Me 3 Search Folders Ea Address l Contral Panel gt Go ee 4 lt Db UP amp Accessibility Add Hardware Add or Administrative Automatic Date and Time Display Options Remoy Tools Updates Vm Control Panel a E Switch to Category View 5 Fy if See lso a D a 7 4 cD D Folder Options Fonts Game Internet Keyboard Mail Mouse 3 Windows Update Controllers Options Help and Support Help and Suppor ki x se o s 3 Network Network Setup Phone and Power Options Printers and Regional and Scanners and Connections Wizard Modem Faxes La
6. make changes Name UserName b Details 9 The installation will start automatically 5 Installing MOXA UPort 2000 Series Mac Driver Introduction License Destinatic Installation ry 3 Installe Summ Registering updated components U b 4 SS TT GoBack Continue ae Sia 2 23 UPort 2000 Series Driver Installation 10 You will see a message saying that the installation is successful Click Close to finish the process w Install MOXA UPort 2000 Series Mac Driver The installation was completed successfully Introduction License Destination Se The installation was successful The software was installed Verifying the Installation 1 Open the Applications gt Utilities gt System Profiler EL mn Activity Monitor Adobe F anager AirPort Utility AppleScript Editor Audio MIDI Setup gt B Bluetoot xchange Boot Ca ssistant ColorSync Utility Console DigitalColor Meter a TF 8 Disk Utility Expos Grab R u S Keychain Access Migratio ssistant Network Utility Podcast Capture o oo m Remote ac OS X Spaces System Profiler Terminal VoiceOver Utility 2 24 UPort 2000 Series Driver Installation 2 Select USB under Hardware to open the USB Device Tree panel Select MOXA Uport Device to display the information PVC s MacBook Air 11 21 12 5 24 PM Conten
7. on the UPort 2000 Series Document and Software CD ROM Click Next to start installing the driver Welcome to the MOXA UPort 7000 Series Windows Driver Ver1 0 Setup Wizard This will install MOA UPort 2000 Seres Windows Driver verl on your computer Itiz recommended that you close all other applications before continuing Click Hest to continue or Cancel to esit Setup 2 Click Next to install the driver in the indicated folder T Setup MOXA UPort 2000 Series Windows Driver er1 0 Select Destination Location Where should MOA UPort 2000 Series Windows Driver verT L be installed J Setup wall install MOMMA UPort 2000 Seres Windows Driver Yer 0 into the following Folder To continue click Mest IF vou would like to select a different folder click Browse C Program Files Moxa UPortek Driver Browse Atleast 0 7 MB of free disk space i required lt Back Cancel 2 2 UPort 2000 Series Driver Installation 3 Click Next to create the program s shortcuts in the indicated folder ie Setup MOZA UPort 27000 Series Windows Driver er1 0 Select Start Menu Folder Where should Setup place the program s shortcuts EA Setup will create the program s shortcuts in the following Start Menu folder To continue click Nest IF you would like to select a different folder click Browse MOA UPort 2000 Series Driver Browse lt Back Cancel 4 Click Inst
8. you want to completely remove MOXA UPort 2000 Series Windows Driver Yer1 0 and all of its ni components 2 18 UPort 2000 Series Driver Installation 3 Click OK to proceed with the un installation procedure MOXA UPort 2000 Series Windows Driver er1 0 Uninstall Ee x Linux Kernel 2 6 x and 3 x The Linux driver for Moxa s UPort 2000 Series of USB to serial converters maps a Linux host s ttyUSBxx ports to the UPort s serial ports Once the mapping has been established Linux users and applications can connect to a device port as if it were a ttyUSBxx port The Linux drivers have been tested with the majority of Linux distributions including Linux kernel 2 6 x and 3 x Please check Moxa s website http www moxa com for the latest Linux kernel support information In this section we explain how to complete the following tasks Installing the Linux Driver Loading the Moxa Driver Unloading the Moxa Driver Removing the Moxa Driver and Utility files 1 YY Using the mxustty Utility Installing the Linux Driver Obtain the driver file from the Document and Software CD or from the Moxa website at http www moxa com To install and load the Linux drivers execute the following commands from the Linux prompt mount dev cdrom mnt cd mkdir moxa cd moxa cp mnt cdrom lt driver directory gt driv linux uport2000 vx x build xx tgz moxa tar xvfz driv_linux_uport2000 vx x build xx tgz
9. 2012 and Windows Vista are essentially the same We recommend installing the UPort 2000 Series driver first before connecting the UPort 2000 USB to serial converter to your computer s USB port The following topics are covered in this chapter O UPort s USB Usage Limitation O Installing the Windows Driver gt V Y Y Y Y Y Connecting the Hardware Installing the Driver for the Converter Installing the Driver for the Ports Configuring the Ports Uninstalling the UPort 2000 Advanced UPort 2000 Driver Functions Uninstalling the Driver O Linux Kernel 2 6 x and 3 x gt gt gt gt gt Installing the Linux Driver Loading the Moxa Driver Unloading the Moxa Driver Removing the Moxa Driver and Utility Files Using the mxustty Utility O MAC OS X Driver gt gt gt Installing the MAC OS X Driver Verifying the Installation Using the Utility UPort 2000 Series Driver Installation UPort s USB Usage Limitation 1 A maximum of 4 UPort 2000 converters can be connected to one PC host Connecting more than 4 UPort 2000 converters will put a strain on system resources and could cause the computer to become unstable 2 We recommend connecting the UPort 2000 directly to your PC s USB port 3 Although your UPort 2000 supports USB 1 1 we recommend using a USB 2 0 host controller or HUB to get the best and most stable performance Installing the Windows Driver 1 Run the Setup Wizard located
10. 7 C 2 Extract the files driv_osx_uport2000_vX Y_build_yymmddhh mpkg readme txt version txt Double click the mpkg file to start the installation Fa 3 items 9 MB available an w TkT TNT driv_osx_uport2000_v1 0_ readme txt versin txi build_12101919 _ disk M 3 Click Continue Welcome to the MOXA UPort 2000 Series Mac Driver Installer Introduction You will be guided through the steps necessary to install this software License Destination Installati n Type Installaf n t Summar wa Go Back 2 21 UPort 2000 Series Driver Installation 4 After reading the License Agreement click Continue Software License Agreement English a MOXA LICENSE Version 1 29 November 2007 Copyright c MOXA Inc All rights reserved The SOFTWARE is copyrighted and is protected by all applicable national laws Any duplication of the SOFTWARE other than for archival purposes is a violation of law i e redistribution of this SOFTWARE in source and binary form are prohibited You agree to prevent any unauthorized copying of the SOFTWARE LIMITED WARRANTY MOXA Inc or its distributors depending on which party sold the SOFTWARE warrants that the media on which the SOFTWARE is installed will be free from defects in materials under normal use MOXA or its distributor warrants tor your benefit alone that during the Warranty Period the SOFTWARE shall operate substanti
11. PYCs MacBook Air PVC screen dev cu USB0 8680 Type screen dev cu USB1 9600 to open 2 serial port ANO Terminal bash 80x24 PVCs MacBook Air PVC screen dev cu USB1 8688E Data entered in the terminal emulator for serial port 1 will be displayed on the terminal emulator for serial port 2 and vice versa The LEDs will blink as you type showing that data is being transmitted and received between the two serial ports 2 26 3 Pin Assignment The UPort 2210 has 2 ports RS 232 interface and UPort 2410 has 4 ports RS 232 interface DBS Male RS 232 Port for UPort 2210 2410
12. UPort 2000 Series User s Manual Third Edition January 2015 www moxa com product MOXA 2015 Moxa Inc All rights reserved UPort 2000 Series User s Manual The software described in this manual is furnished under a license agreement and may be used only in accordance with the terms of that agreement Copyright Notice Trademarks 2015 Moxa Inc All rights reserved The MOXA logo is a registered trademark of Moxa Inc All other trademarks or registered marks in this manual belong to their respective manufacturers Disclaimer Information in this document is subject to change without notice and does not represent a commitment on the part of Moxa Moxa provides this document as is without warranty of any kind either expressed or implied including but not limited to its particular purpose Moxa reserves the right to make improvements and or changes to this manual or to the products and or the programs described in this manual at any time Information provided in this manual is intended to be accurate and reliable However Moxa assumes no responsibility for its use or for any infringements on the rights of third parties that may result from its use This product might include unintentional technical or typographical errors Changes are periodically made to the information herein to correct such errors and these changes are incorporated into new editions of the publication Technical Support Contact Informati
13. a cea aia ea ec aac a via aon eae at ae EE E RA a A A EEA AAAA E EA EEEE AATE 1 5 ID ZATO rrer ndrritririndinrertritrixiniiaitvlu tui T a a 1 6 Des DAVE LVS Cell CRO Oy cess acc aaa cae a ewe wie ee wien ew eee seed a a a a sai tia weenie 2 1 UPOS USB VsSage Mla O Is cantata n6xcyekxbaasisebtassrseaeiesavbdertneboVielApose gt toasldrsicoibaoVgletodios285i00012 1006020508 3500600i 01 00005 s2gis2 2 2 Tstalling the WINGOWS DIVET vsss 666x064 xi0xxgw iglw halite tiedalata wseiivtu tua EE tute tote tats fies 2 2 Connecting UNS HardWare suiineesbeinintesesntsnnassvsmenhkebbbhbkhbhbbkkbithihthtkbkitoihtkbkhkeloklklloalwskiobifbisfaliboiskwkiljetA 2 4 Installing the Driver for the ConVer r ng eee nese een nn SOS Ee HARES OSES ORGS OSES ERR SSSE EEE EES 2 5 installing the Driver for CNC POFLS 1zecnenrernrernsoaribidrviniovttyicvinainiinianinieyimawdngndipidavinswingxiaxawamawoGulatudoeuilnaldieudaauas 2 8 COMFIGUFING Ce POMS Xui0sntimoxpbibie fa18652180 02 00632 865 0 M0 3 06 38 t11 288i52802 085 28 6i1i0 8 042 a658 8siAifolufirtatiEdfoBtirdieseiintfioag fniowftisge 2 11 Uninstalling the WPROR 200 Ors tr ra niet peck tied a Paadsaae uaa c tet 2 13 Advanced UPort 2000 Driver FUN CUOINS vaiccscccceaueteraieees te retain bate ieee bane ieee reer te rere ee nets ieee ede rei eae 2 14 MINS Cana Che DIVO i Mc i NNN SNt 2 18 LIU Kernel 236 ANG 2 2 nai trinrorinctbridnyrdrriniteritritrinrtvitrtritniovirrritnigtrimioytrintitmranriertrraur
14. actory Default Enable Disable The Fast Flush setting is designed for applications that call the Win32 PurgeComm function before reading or writing data If Fast Flush is not enabled then instead of just flushing the local buffer the UPort s driver will query the UPort s firmware repeatedly in a short period of time to make sure that no data is queued in the UPort s firmware buffer For this reason you may find that your PC s native COM ports respond much more quickly when making PurgeComm function calls compared to the UPort s serial ports In this case enable Fast Flush enabled by default to speed up the reaction of the UPort s serial ports Interface Factory Default Necessity RS 232 RS 232 Required UPort 2000 Series Driver Installation Other Settings Reset default If you click the Reset default button all the settings will return to the factory default settings COM Number lt Assign available COM number automatically gt Fast Flush Enable Interface RS 232 Help Click on Help to open the UPort 2000 s online help utility Locate Use the Locate function to determine the location of a particular UPort 2000 This function is particularly useful when two or more UPorts are installed on the same PC The Locate function will cause the selected UPort 2000 s LED to flash and UPort 2410 will sound the buzzer Uninstalling the UPort 2000 To remove a particular UPort 2000 from you PC simply remove t
15. all to proceed with the installation ie Setup MOZA UPort 2000 Series Windows Driver er1 0 Ready to Install Setup is now ready to begin installing MOMMA UPort 2000 Seres Windows Driver Ver on your computer Click Install to continue with the installation or click Back if you want to review or change any settings Destination locators C Program Files MoxasUPortekOrniver Start Menu folder MOx4 UP ort 2000 Seres Driver nh Cancel 2 3 UPort 2000 Series Driver Installation 5 Click Finish to complete the driver installation Completing the MOXA UPort 7000 Series Windows Driver Verl D Setup Wizard Setup has finished installing MOMMA UPRort 2000 Series Windows Driver Yer 0 on your computer The application mau be launched by selecting the installed icons Click FInish to exit Setup Connecting the Hardware Please install the driver before connecting the UPort 2000 to your PC s USB port See the previous section for details Connecting to a Serial Device Use the proper serial cables to connect your serial devices to the UPort 2000 s serial ports which support the RS 232 interface The UPort 2000 s serial ports use DB9 male connectors with standard RS 232 pin assignment LED Indicators The UPort 2000 has LEDs on the front panel The Active LED indicates the power status and the TxD and RxD LEDs indicate the transmission status of each serial port In addition w
16. ally in accordance with the functional specifications in the User s Manual E during the Warranty Period a defect In the SOFTWARE appears you may obtain a replacement of the SOFTWARE Any ement SOFTWARE will be warranted for the IEmiine ie Ware E K af 5 Click Agree to continue the installation To continue installing the software you must agree to the terms of the software license agreement Click Agree to continue or click Disagree to cancel the installation and quit the Installer 6 The Select a Destination window will pop up Click Continue Select a Destination Select the disk where you want to install the MOXA UPort 2000 Series Mac Driver software Introduction B License Destination Se Installation ype Install E e Summ a el en You have chosen to install this software on the disk Macintosh HD 2 22 UPort 2000 Series Driver Installation 7 You will see a pop up window indicating how much space will be used for the installation Click Install to continue 8 Enter your password to allow Installer to make changes Click OK to continue Standard Install on Macintosh HD Introduction This will take 348 KB of space on your computer Click Install to perform a standard installation of this software on the disk Macintosh HD Change Install Location Type your password to allow Installer to
17. e At this point you can use the UPort utility to assign different COM numbers to these ports COM3 COM4 D1 COMS COMG D2 The UPort s Normal COM Mode has an added twist Your computer uses the serial number of each UPort to record which COM numbers are assigned to the UPort s serial ports If one or both of the UPorts are unplugged from the computer and then plugged back in the COM numbers of the UPorts serial ports will be the same as they were before the UPorts were unplugged For example if both D1 and D2 are unplugged and then D2 is plugged back in first your computer will assign COM5 and COM6 to D2 s serial ports When D1 is plugged back in your computer will assign COM3 and COM4 to D1 s serial ports COM3 COM4 D2 In Normal COM Mode you can reset the COM numbers and configuration parameters of individual ports to the values needed for your application at any time UPort 2000 Series Driver Installation Fixed base COM Mode Moxa s UPort 2000 series provides a unique fixed base COM function that allows users to set a specific initial COM port number Regardless of which UPort is plugged into the host the COM port numbers for the UPort s serial ports will be numbered sequentially starting with the initial COM port number 7 UPort 2000 Series Configuration Tool 1 Oj x Devices Configuration M Enable Fixed base COM Mode Select a beginning COM number wiew Set
18. e covered in this chapter O Overview Package Checklist Product Features Product Specifications n n n Panel Layout gt UPort 2210 gt UPort 2410 O Dimensions gt UPort 2210 gt UPort 2410 UPort 2000 Series Introduction Overview UPort 2000 Series products are easy to install and use After installing the drivers on your PC connect the UPort to your computer plug in your serial devices and you re ready to go Programming is NOT required and you do not need to worry about IRQs configuring a board power requirements or connection schemes UPort 2000 Series products are compliant with USB 1 1 and 2 0 specifications and meet the 480 Mbps high speed requirement of Hi Speed USB 2 0 Using your computer s USB ports to connect serial devices reduces the total cost of ownership investment in hardware and long term management and integration costs Package Checklist Moxa s UPort 2000 Series products are shipped with the following items e UPort 2210 or 2410 USB to serial converter e 1 USB cable e Document and Software CD ROM e UPort 2000 Series Quick Installation Guide printed NOTE Notify your sales representative if any of the above items are missing or damaged Product Features UPort 2000 Series products have the following features e Hi Speed USB 2 0 supported for up to 480 Mbps transmission through the USB port e Additional I O or IRQ not required e Serial transmission rate up to 921 6 Kbp
19. ecommends that you stop this installation now and contact the hardware vendor for software that has passed Windows Logo testing Continue Anyway 2 6 UPort 2000 Series Driver Installation 5 The next window shows the model name of the board and indicates that Windows has completed the driver installation Click Finish to proceed with the rest of the installation procedure Found New Hardware Wizard Completing the Found New Hardware Wizard The wizard has finished installing the software for val MOA UPort 2210 Series Click Finish to close the wizard Eancel 6 Open the Windows Device Manager to check that the installation was successful The UPort USB to serial converter should appear under Multi port serial adapters O Device Manager F x File Action View Help fe gt mlzlzja og MARKETING EN E sj Computer E Disk drives m 8 Display adapters Fe DYD CD ROM drives Ae Floppy disk controllers cae Floppy disk drives H a Human Interface Devices HE IDE ATAJATAPI controllers H Keyboards ae Mice and other pointing devices f Sl Monitors 3 Multi port serial adapters Eg Network adapters E Other devices Y Ports COM amp LPT af Communications Pork COM1 B y Communications Port COM2 ow Jf ECP Printer Port LPT1 ow nh USB Serial Port Processors 2 7 UPort 2000 Series Driver Installation Installing the Driver for the Ports 1 T
20. ed from the list of Multi port serial adapters Advanced UPort 2000 Driver Functions Moxa s UPort 2000 Series Utility gives users a convenient tool for configuring and maintaining products from the UPort 2000 Series In this section we introduce the difference between Normal COM Mode and Fixed base COM Mode The Default Setting is Normal COM Mode Each of Moxa s UPort 2000 products comes with a unique serial number to register with the Windows OS If your UPort is reconnected to a different USB port the host will recognize that it s the same UPort and then utilize the same COM port numbers A UPort 2000 Series Configuration Tool 4 x Devices Configuration Enable Fixed base COM Mode Select a beginning COM number come wiew Settings UPort 2000 Series Driver Installation To use Normal COM Mode be sure to the leave Enable Fixed base COM Mode unchecked For the sake of argument assume that we are using two UPort 2210 USB to serial converters configured for Normal COM Mode Each UPort 2210 has two serial ports When you plug UPort D1 please refer to the figure below into your computer your computer s operating system assigns the first two available COM numbers COM3 and COM4 in this example to the UPort s serial ports If you now plug UPort D2 into another of your computer s USB ports your computer will again assign the first two available COM numbers COM5 and COM6 in this exampl
21. em Profiler File Edit View Window Help w gt mO E E TueDec4 16 47 Q 12 4 12 4 46 PM Extension Version Last Modified Kind 64 Bit Intel OUUSBL0IfID SItEUFIV 9 0 IL767 1U 2 4u PM Intel yes IOUSBFamily 4 2 4 11 6 10 2 25 PM Intel Yes IOUSBHIDDriver 4 2 0 11 6 10 2 40 PM Intel Yes IOUSBUserClient 4 2 4 11 6 10 2 40 PM Intel Yes Libkern 10 8 0 3 26 12 10 41PM Universal Yes Libkern6 0 7 9 9 3 26 12 10 41 PM Intel No MACFramework 10 8 0 3 26 12 10 41PM Universal Yes Mach 10 8 0 3 26 12 10 41PM Universal Yes Mach6 0 7 9 9 3 26 12 10 41 PM Intel No mxuport2000 1 0 11 28 12 5 31 PM Universal Yes NVDANVSOHal 1 6 36 11 6 10 3 13 PM Intel Yes NVDAResman 1 6 36 11 6 10 3 13 PM Intel Yes NVSMU 2 2 7 11 6 10 2 33 PM Intel Yes 0 OSvKernDSPLib 1 3 11 6 10 2 32 PM Intel Yes Private 10 8 0 3 26 12 10 41PM Universal Yes a Quarantine 0 11 6 10 2 36 PM Intel Yes y mxuport2000 Version 1 0 Last Modified 11 28 12 5 31 PM Kind Universal Architectures i386 ppc x86_64 64 Bit Intel Yes Location System Library Extensions mxuport2000 kext Kext Version 1 0 Load Address 0x30a6d000 Valid Yes Authentic Yes Dependencies Satisfied 2 25 UPort 2000 Series Driver Installation Using the Utility The MAC OS system has a built in terminal emulator like the Linux system Use the loopback cable to connect serial port 1 and serial port 2 Type screen dev cu USBO 9600 to open 1 serial port Terminal bash 80x24
22. evinrirlAoudAtuddudAaud daukAnsdadaubAaukblaoddsaa 2 19 NM avcters lars the LNUX Drvene TC C eee eee ee er eo ee are 2 19 Loading the MOxa Driver iscsi ince inact hited heen ube bhi heh emaeeeeuneureeuMuKeUNeILMMUNeCauamuntes 2 19 Unloading the Moxa Driver eee ee ee ee ere mn 2 20 Removing the Moxa Driver and Utility Files HH HH HH nh km nh HH 2 20 Using the MxUSttYy UUV rrenean e6 unfutiatfubindf0xitfeeadfusietfiuaixtfioeinfeietfueingfoeieibagfefeioasositbdbelal0642006040a0u12440400 4 2 20 MACOS ADIV E a E E EE E en en aa a 2 20 Installing the MAC OS X DHVOP siriene pr ENSEN EE E RE ERE EEE E RE TE N 2 21 VEEIRY ING The ENS ca latio Mases E E E E E E E E uote anaen teem aeE Nanton 2 24 WSING THe UEIT ciate Eeee EE EE eS NNS SNOS nS c 2 26 Si PIN ASSIGNING sssaaa aaa aaa aa aA ERARA A 3 1 1 Introduction Moxa s UPort 2000 Series of entry level USB to serial converters are used to add 2 or 4 serial ports to a PC through the PC s USB port The UPort 2000 converters are compatible with both new and legacy RS 232 devices and are a perfect solution for mobile instrumentation and point of sale applications The UPort 2000 Series includes two models e UPort 2210 2 port RS 232 USB to serial converter e UPort 2410 4 port RS 232 USB to serial converter In this manual UPort 2000 is used in examples and explanations to represent either the UPort 2210 or the UPort 2410 The following topics ar
23. hat UPort 2000 from the Device Manager However the UPort driver will NOT be removed so that other UPort 2000 converters connected to the PC will continue to work properly 1 To uninstall the UPort 2000 click Start gt Settings gt Control Panel gt System select the Hardware tab and then click Device Manager System Properties E k x System Restore Automatic Updates Remote General Computer Name Hardware Advanced Device Manager The Device Manager lists all the hardware devices installed on your computer Use the Device Manager to change the properties of any device Driver Signing lets you make sure that installed drivers are compatible with Windows Windows Update lets you set up how Windows connects to Windows Update for drivers Driver Signing Windows Update Hardware Profiles eos Hardware profiles provide a way for you to set up and store different hardware configurations Hardware Protiles HE Cancel Apply UPort 2000 Series Driver Installation 2 Expand the Multi port serial adapters tab right click MOXA UPort 2210 Series and then click Remove to uninstall this UPort 2000 A window will pop up to confirm that you want to remove this UPort Confirm Device Removal E a x Sat MOA UFort 2210 Series Wearing You are about to uninstall this device from your system Cancel 3 Click OK to continue uninstalling the UPort device The UPort device will be remov
24. he Found New Hardware Wizard window will open to help you install the driver This window will offer to connect to the Windows update site to search for a driver Select No not at this time and then click Next to continue Found New Hardware Wizard Welcome to the Found New Hardware Wizard Windows will search for current and updated software by looking on Your computer on the hardware installation CD or on the Windows Update Web site with pour permission Read our privacy policy Lan Windows connect to Windows Update to search for software amp Yes this time only Yes now and every time connect a device This wizard helps vou install software for MOA UFort COM Part IF your hardware came with an installation CD Ee or floppy disk insert it now What do you want the wizard to do Install from a list or specific location Advanced Click Next to continue lt Back Cancel 2 8 UPort 2000 Series Driver Installation 3 Wait while the installation wizard searches for the correct drivers The next window that opens cautions you that although this software has not passed Windows logo testing this driver has already been tested and shown that it can support the Windows operating system Click Continue Anyway to proceed Found New Hardware Wi Please wait while the wizard installs the software Hardware Installation The software you are installing for this hardware
25. hen you click Locate for a particular UPort that UPort s Active LED will blink to indicate its location LED Name LED Color LED Function Active Off TxD RxD Off UPort 2000 Series Driver Installation Installing the Driver for the Converter 1 After connecting the USB cable from UPort to host the PC Windows XP will automatically detect the new UPort and the Found New Hardware balloon will open in the bottom right corner of the Windows desktop 1 Found New Hardware x Mosa UPort Device 2 Case 1 The UPort Driver is Certified If the UPort driver that you installed has been certified by Microsoft the UPort and the UPort s serial ports will be installed automatically when you plug the UPort into your computer s USB port Case 2 The UPort Driver is NOT Certified If the UPort driver that you installed has not been certified by Microsoft then plugging the driver into your computer s USB port will activate the UPort installation program The first part of the installation procedure installs the software for the UPort itself the second part of the procedure installs the serial ports Select No not at this time Click Next to start the installation Found New Hardware Wizard Welcome to the Found New Hardware Wizard Windows will search for current and updated software by looking on your computer on the hardware installation CO or on the Windows Update Web site with your perrnssiori Read our pri
26. n Environmental Limits Operating Temperature 0 to 55 C 32 to 131 F Storage Temperature 20 to 75 C 4 to 167 F Ambient Relative Humidity 5 to 95 non condensing Altitude Up to 2000 m Note Please contact Moxa if you require products guaranteed to function properly at higher altitudes 1 3 UPort 2000 Series Introduction Standards and Certifications Safety UL 60950 1 EMC CE FCC EMI EN 55022 Class B EN 61000 3 2 EN 61000 3 3 FCC Part 15 Subpart B Class B EMS EN 55024 IEC 61000 4 2 IEC 61000 4 3 IEC 61000 4 4 IEC 61000 4 5 IEC 61000 4 6 IEC 61000 4 8 IEC 61000 4 11 Green Product RoHS CRoHS WEEE Power Requirements Power Consumption UPort 2210 140 mA 5 VDC UPort 2410 240 mA 5 VDC MTBF mean time between failures Time UPort 2210 4 221 778 hrs UPort 2410 3 901 775 hrs Database Telcordia Bellcore GB Warranty Warranty Period 5 years Details See www moxa com warranty Panel Layout UPort 2210 UPort 2000 Series Dimensions UPort 2210 Introduction O 1 2 x O O rt 2210 O USB to 2 Port RS 232 Serial Hub 120 mm 4 72 in 1 5 UPort 2000 Series Introduction UPort 2410 u 2G ww Op 120 mm 4 72 in Ul ge ww GE 185 mm 7 28 in 80 mm 3 15 in 2 Driver Installation In this chapter we use Windows XP to illustrate how to install the UPort 2000 USB to serial converters The procedures for Windows 2000 2003 2008
27. nguage Cameras 2 9 BSB m 8 Scheduled Security Sounds and Speech System Taskbar and User Accounts Tasks Center Audio Devices Start Menu lt ets Windows Wireless Firewall Network Set 2 Select Moxa UPort 2000 Series Windows Driver Ver1 0 and then click the Remove button Wait while the driver software is uninstalled 23 Add or Remove Programs amp Currently installed programs T Show updates Sort by Name v Change or Remove Programs Adobe Captivate 2 Size 133 00MB _ 5 Adobe Flash Player 9 Activex T Adobe Reader 7 0 8 Size 65 11MB Add New 4 FastStone Capture 5 3 Size 1 41MB P a c l d Macromedia Dreamweaver Mx 2004 Size 145 00MB Ta Macromedia Extension Manager Size 3 751B e Add Remove A Microsoft Office XP Standard Size 387 00MB windows Components 5 Moxa ioLogik Size 13 13MB amp MOXA UPort 1110 1130 Windows Driver Ver1 4 Size 0 87MB _ MOXA UPort 2000 Series Windows Driver er1 0 Size 1 78MB Set Program Access and ae Last Used On 5 21 2008 To remove this program From your computer click Remove Remove fey MOXA UPort Windows Driver Yer1 3 9 1 23MB Click here for support information Used occasionally e Network Enabler Administrator 2 8 0 2 35MB EL NPort Administration Suite Ver 1 7 2 84MB NPort Search Utility Yer1 3 1 02MB amp NPort Windows Driver Manager 1 52MB MOXA UPort 2000 Series Windows Driver Yer 1 0 Uninstall E xj 4 Are you sure
28. on Moxa Americas Toll free 1 888 669 2872 Tel 1 714 528 6777 Fax 1 714 528 6778 Moxa Europe Tel 49 89 3 70 03 99 0 Fax 49 89 3 70 03 99 99 Moxa India Tel 91 80 4172 9088 Fax 91 80 4132 1045 www moxa com su ort Moxa China Shanghai office Toll free 800 820 5036 Tel 86 21 5258 9955 Fax 86 21 5258 5505 Moxa Asia Pacific Tel 886 2 8919 1230 Fax 886 2 8919 1231 Table of Contents Di THIFEOUOLIELIO Tai v2222120 6xLx005x62141501602vEkvW004Xk6V6cvevivvvelgesvvrvivwsdevesstveeseilctiotfsxigtswaisxoWsyxiyrptflsxeXsynfskslsgpifsasisuiattiretisei 1 1 OVOP N a 0060 1 lt 2 PACE Ic c2 sa 2 ii ga 1 2 Product EESGLLUIfTE 5 sect2ztrrbiruidedddddddtoecddoddeoddoddderbiddeddttdddddisdodddetdrtdttdderbidbrfld S a0 b n t n A ng b d 25A h l n ng n i n t n A ng h d 2 an 1 2 PFO IUGLSDGGIEICGDIOIIS ca sce sie ng assay tie a ev b 8g 068g EEEE ee we tie cede ce 860 tllooee6i2 euteeuieentitsle6tgntfswnbteroeisiegiteui2rgmtbit 1 3 eye gt Wel Ors 20 W Ogre ects ae ee tee ee eee ee ee ee eer creer rere eer Tre cee Terre reer rr rer re Cr rrr re renee 1 4 WIP OTE 2 2 10 0a enue eee enon E 0161 28i6fE20046126i26 200106001E20006 0166 26i0fe10 46123 1 4 3 edo gee LA 0 Perera ee eee ne RTE eer Cee aE TOL ee een Tern eT OT Ce mtr a ee tT On cat eet AN Gr tee On ao oe Pen ar A ge Air 1 4 OWS DI IS cuc cau ttt een aaa eta 1 5 PP TL acerca aac a
29. s e Windows 2000 XP 2003 Vista 2008 2012 Linux Kernel 2 6 x and 3 x drivers supported e Easy maintenance with LED display and management software e COM port assignments maintained across different PCs 1 2 UPort 2000 Series Introduction Product Specifications USB Interface Compliance USB 1 1 2 0 compliant Connector USB type B Speed 480 Mbps Hi Speed USB and 12 Mbps Full Speed USB Serial Interface Number of Ports UPort 2210 2 UPort 2410 4 Serial Standards RS 232 Connector DB9 male Performance Baudrate 50 bps to 921 6 kbps Serial Communication Parameters Data Bits 5 6 7 8 Stop Bits 1 1 5 2 Parity None Even Odd Mark Space Flow Control RTS CTS XON XOFF I O Address Assigned by BIOS IRQ Assigned by BIOS FIFO 16 bytes Serial Signals RS 232 TxD RxD RTS CTS DTR DSR DCD GND Operating Systems Windows Real COM Drivers Windows 2000 Windows XP 2003 Vista 2008 7 8 8 1 x86 x64 Windows 2012 x64 Android Driver Mac Driver Mac OS X Linux Real TTY Drivers Linux 2 6 x 3 x Note Please refer to Moxa s website for the latest driver support information Physical Characteristics Housing Polycarbonate PC Weight Product only UPort 2210 120 g 0 26 Ib UPort 2410 210 g 0 46 Ib Packaged UPort 2210 325 g 0 72 Ib UPort 2410 455 g 1 Ib Dimensions UPort 2210 70 x 35 x 120 mm 2 76 x 1 38 x 4 72 in UPort 2410 80 x 35 x 185 mm 3 15 x 1 38 x 7 28 i
30. stalled and ready to use i 2 Device Manager E d UPort 2000 Series Driver Installation Configuring the Ports After the driver has been installed use Windows Device Manager to configure the UPort serial ports 1 With the System Properties window open click on the Hardware tab and then click on Device Manager System Properties e System Restore Automatic Updates Remote General Computer Mame Hardware Advanced Device Manager The Device Manager lists all the hardware devices installed on your computer Use the Device Manager to change the properties of any device Device Manager Driver Signing lets you make sure that installed drivers are compatible with Windows Windows Update lets you set up how Windows connects to Windows Update for drivers Driver Signing Windows Update Hardware Profiles Hardware profiles provide a way for you to set up and store different hardware configurations Hardware Protiles 2 Expand the Multi port serial adapters tab right click MOXA UPort 2210 or 2410 and then click Properties to open the UPort s configuration panel lan Device Manager Eile Action View Help e HES PA RA MARKETIMG EM H Computer H Disk drives i B Display adapters HAA DYDICD ROM drives i f Floppy disk controllers E A Floppy disk drives ely Human Interface Devices Fy IDE ATA ATAPI controllers Hg Keyboards aT Mice and other pointing devices
31. tings Cancel To use Fixed base COM Mode be sure to check the Enable Fixed base COM Mode check box Fixed base COM Mode allows users to specify which COM number will be assigned first In addition COM numbers are assigned sequentially and are not tied to specific UPort converters For example assume that you have set COM10 as the first COM number that will be assigned If UPort D1 is plugged into your computer first your computer will assign COM10 and COM11 to the UPort s serial ports When UPort D2 is plugged in the computer will assign COM numbers COM12 and COM13 COM10 COM11 D1 COM12 COM13 UPort 2000 Series Driver Installation If both UPorts are unplugged from the computer and then UPort D2 is plugged back in the computer will now assign COM10 and COM11 to the UPort s serial ports When UPort D1 is plugged back in COM numbers COM12 and COM13 will be assigned the UPort s serial ports COM12 COM13 D1 amp COM10 COM11 D2 When Fixed base COM Mode is enabled for the first time all COM port numbers and serial port parameters will be reset to their default values You can then set the COM numbers and configuration parameters to the values needed for your application For example let s assume that before you enable Fixed base COM Mode you set the parameters of the UPort 2000 as follows Port Number COM5 Friendly Name POS Device 1 Fast Flush
32. ts Y Hardware USB Bus ATA Y USB Bus Audio Built In Y BRCM2070 Hub Bluetooth Bluetooth USB Host Controller Card Reader Apple Internal Keyboard Trackpad Diagnostics Y USB High Speed Bus Disc Burning MOXA UPort Device Ethernet Cards Y USB High Speed Bus Fibre Channel MOXA UPort Device FireWire FaceTime Camera Built in Graphics Displays Hardware RAID Memory MOXA UPort Device PCI Cards Product ID 0x2410 Parallel SCSI Vendor ID 0x110a MOXA Technologies Co Ltd Power Version 0 01 Printers Serial Number 00000885 SAS Speed Up to 480 Mb sec Serial ATA Manufacturer Moxa Inc Location ID 0x26200000 2 Thunderbolt Current Available mA 500 USB Current Required mA 500 Y Network AirPort Firewall Locations Modems Volumes WWAN Y Software l Annliratians y 3 Select Extensions under Software to open content panel Select mxuport2000 to display the information PVC s MacBook Air Contents Y Hardware ATA Audio Built In Bluetooth Card Reader Diagnostics Disc Burning Ethernet Cards Fibre Channel FireWire Graphics Displays Hardware RAID Memory PCI Cards Parallel SCSI Power Printers SAS Serial ATA Thunderbolt USB VW Network AirPort Firewall Locations Modems Volumes WWAN Y Software Applications Developer Extensions Fonts Frameworks Logs Managed Client Preference Panes Startup Items Sync Services Universal Access E gt E ka 46 E v a v Syst
33. vacy policy Can Windows connect to Windows Update to search for software Yes this time only Yes now and every time connect a device Click Next to continue 4 Back Cancel 2 5 UPort 2000 Series Driver Installation 3 Select Install the software automatically Recommended and then click Next to continue Found New Hardware Wizard ng This wizard helps you install software for MOA UPRort 2210 Series If your hardware came with an installation CD Ee or floppy disk insert it now What do you want the wizard to do Install from a list or specific location Advanced Click Next to continue lt Back Cancel 4 Wait while the installation wizard searches for the correct drivers The next window that opens cautions you that although this software has not passed Windows logo testing this driver has already been tested and shown that it can support the Windows operating system Click Continue Anyway to proceed Found New Hardware Wizard Please wait while the wizard installs the software Hardware Installation The software you are installing for this hardware MO 4 UPort 2210 Series has not passed Windows Logo testing to verity its compatibility with Windows P Tellme why this testing is important Continuing your installation of this software may impair or destabilize the corect operation of your system either immediately or in the future Microsoft strongly r
Download Pdf Manuals
Related Search