Home

USER`S MANUAL - Poultry Technical Services

1. oF TO MODIFY 1 TO QUIT X KG A 2 Press Enter Enter aw The system changes for the alternate units Paa gt CELSIUS 1 FAHRENHEIT 2 J 3 Type 1 to use Celsius units or 2 to use Fahrenheit units The new units are dis played and the system returns to the Date Time display AA 800 AA 800T rev 05 25 2 6 16 VAC POWER FAILURE ALARM Definition This parameter defines the time the system waits before setting off an alarm in the case of a power failure on the system 16 5VAC input wall mount trans former It can be enabled or disabled and the delay ranges from 0 seconds to 59 minutes 59 seconds The default setting is ENABLED with a value of 30 minutes Setting Box 1 Press the Power Failure w failure key The system displays the current status of the Power Failure feature along with the current delay TO MODIFY 1 TO QUIT X NG A Enter Cancel 2 Type Enter to modify the current settings or Cancel to exit this function STATUS 1 DELAY 2 NG A To Activate Deactivate Alarm 3 Type 1 to modify the status ENABLE 1 DISABLE 2 N 4 4 Type 1 to activate or 2 to deactivate the alarm The new status is displayed and the system returns to the Date Time display To Adjust the D
2. 1 Press the On Off key o The system prompts for a password C S ENTER PASSWORD NG Z Enter 2 Type a four digit password and press Enter y If an incorrect password is en tered the system responds with the message WRONG PASSWORD and returns to the Date Time display Otherwise the system displays the current system status ON the system is running normally OFF the system is in standby mode OK STATUS ON TO MODIFY 1 TOQUIT X Enter Cancel 3 Press Enter to modify or Cancel x lt to quit 4 Type 1 to turn the system on or 2 to put the system in standby mode The new status is displayed and the system returns to the Date Time display AA 800 AA 800T rev 05 29 CHAPTER THREE COMMUNICATION PARAMETERS 3 1 INTRODUCTION This chapter explains the setup required for communicating alarm messages and status reports over the telephone lines For example the user can dial into the Agri Alert system and obtain status reports over the phone in the form of voice messages The system can also be programmed to dial a series of phone numbers and deliver a voice message when an alarm situation occurs In order for these features to work properly with your phone system care must be taken to assign the proper values to the communications parameters Dialout Sequence This is a sequence of t
3. X 3 Press Enter to modify the current settings or Cancel X to quit RANGE FROM 0 5 MIN O 59 SEC ENTER NEW DELAY OMN SEC 4 Enter the new delay and press Enter The new entry delay is displayed and the system returns to the Date Time display AA 800 AA 800T rev 05 59 4 9 EXIT DELAY Definition The time needed to exit the site before the system starts monitoring the alarm inputs This applies only to burglar zone and is common to all zones It ranges from O to 5 minutes 59 seconds The default is 30 seconds Setting 1 Press the Entry Exit Delay key Eyen ENTRY DELAY 1 EXIT DELAY 2 4 2 Type 2 to adjust the Exit Delay EXIT DELAY 0 MIN 30 SEC TO MODIFY 1 TO QUIT X Enter Cancel 3 Press Enter _ to modify the current settings or Cancel to quit RANGE FROM 0 5 MIN O 59 SEC ENTER NEW DELAY _ MIN SEC 4 Enter the new delay and press Enter The new exit delay is displayed and the system returns to the Date Time display 60 AA 800 AA 800T rev 05 4 10 SIREN DELAY Definition When an alarm condition is detected and if the siren is enabled for the zone in alarm the system activates the siren This parameter defines the time the siren will sound The value ranges from 1 to 20 minutes The default is 5 minutes Setting 1 Press
4. connect busy Phone number 3 Phone number 4 Phone number 4 is still busy Since Busy Line Tries 2 and only one try has been made another call will be made Phone number 4 Phone number 4 is still busy It is not redialed since two tries have been made and Busy Line Tries 2 Since of call repetitions 2 the entire process is repeated from the start busy START OF DIALOUT SEQUENCE 2 Phone number 1 busy Phone number 2 connect Phone number 3 gt busy Phone number 4 connect Phone number 5 connect Phone numbers 1 and 3 are busy They are placed at the end of the list and redialed since Busy Line Tries 2 connect connect Phone number 1 Phone number 3 END OF DIALOUT SEQUENCE Phone numbers 1 and 3 have been reached The dialout sequence ends since of call repetitions 2 and two passes have been made to reach all the phone numbers programmed in the system If the alarms that set off the dialout sequence have not been acknow ledged at the end of the dialout sequence they will automatically be acknow ledged AA 800 AA 800T rev 05 31 3 2 DIALING INFORMATION Definition These parameters are used to establish communications over the tele phone network when the dialout sequence is used 3 2 1 Busy Line Tries Definition The number of times a pho
5. 10 AA 800 AA 800T rev 05 1 7 BURGLAR ZONES These zones are armed or disarmed as a group using a password Two types of con figurations are possible depending on when alarms are to be declared In an instant burglar zone alarms are declared as soon as they are detected In a delay burglar zone alarms are declared only after an Entry Delay has elapsed In this way the authorized user has time to disarm the burglar zones before an alarm is declared This delay is common to all delay burglar zones Similarly all zones are armed after the Exit Delay has elapsed The key sequence for arming or disarming Is as follows Ki follow ed by the passw ord sequence KI Ki KI KI When the system is armed the system starts beeping and the screen immediately displays a countdown of the exit delay in minutes and seconds The keypad is locked at this point the only key sequence allowed is the disarming sequence After the exit delay has elapsed the system is armed and alarms are immediately declared as they are detected for all burglar zones The system displays the message BUR GLAR ZONES ARMED periodically on the screen When an alarm occurs in a burglar zone with an entry delay the screen displays a countdown of the entry delay During this time the piezoelectric loudspeaker beeps the loudspeaker stops when the key sequence is entered If no one has disarmed the system after the entry delay has elapsed an alarm is declared Disarming wi
6. the display backlight is turned on the reset time for low battery and system trouble alarms is always 45 minutes The table below describes these alarms BATTERY VOLTAGE IS LESS LOW BATTERY THAN 10 5 V FOR MORE THAN 2 MIN SIREN FUSE F8 BLOWN SIREN DEFECT SIREN WIRE TROUBLE SIREN MALFUNCTION 12VDC OUTPUT DEFECT on 800T models only FUSE F4 BLOWN WIRING TROUBLE ON ZONE SYSTEM TROUBLE INPUTS OR SYSTEM MALFUNCTION Table 2 System Alarms AA 800 AA 800T rev 05 43 4 3 OUTDOOR TEMPERATURE COMPENSATION ON TEMPERATURE ALARMS The outdoor temperature compensation feature is only available on lt gt AA 800T models Definition In situations w here the outdoor temperature is high the room temperature will rise as warm air enters the building through ventilation inlets If the high set point defined above is not adjusted to take this into account a high temperature alarm may be needlessly set off To avoid this situation the system can compensate for high outdoor temperatures when monitoring temperature alarms When this feature is activated and the outdoor temperature is close to the high set point the room tem perature is monitored with respect to the outdoor temperature An alarm is set off only if the room temperature rises above the outdoor temperature by a certain value called the offset In addition to this the system also uses a critical high temperature as an absolute limit on room temperature When room temp
7. 7 DIALOUT SEQUENCE The dialout sequence is launched AA 800 AA 800T rev 05 27 2 8 TROUBLE INFORMATION When the Trouble LED lights up on the front panel the user can query the system for more information Trouble 1 Press the Trouble key Information concerning the system trouble is dis played If no system trouble has been detected the message NO TROUBLE is displayed ZONE 3 SHORT PROBE TO ERASE 1 TO QUIT 2 2 Type 1 to reset the trouble flag Note that if the problem has not been corrected the trouble LED will remain on Type 2 to exit this function The system returns to the Date Time display 28 AA 800 AA 800T rev 05 2 9 STANDBY MODE Definition When the system is in standby mode no monitoring of alarm inputs is done The Standby LED on the display panel and the message SYSTEM ON STANDBY are used to indicate that the system is in Standby mode The system can automati cally switch to standby mode when a long power failure has drained the backup bat tery to a critical level A pager message code 8009 and a vocal message Low battery system deactivated are sent warning that the system is about to go into standby mode When normal voltage is restored to the battery the system automati cally returns to its normal mode of operations If the system is already in standby mode when the problem is detected no messages are sent Setting
8. 1 C Enter the low set point and press Enter To enter a negative value use the key either before or after the digits HI SET POINT RANGE FROM X F 149 0 F HI SET POINT oF 6 This is the upper value of the normal temperature range It ranges from the low set point to 149 F 65 C with an accuracy of 0 1 F 0 1 C Enter the high set point and press Enter To enter a negative value use the key either before or after the digits The high set point must be greater than the low set point a N CRITICAL TEMP RANGE FROM X F 149 0 F CRITICAL TEMP oF 7 The critical temperature is displayed only if the outdoor temperature compensation feature is activated see Section 4 3 on AA 800T model only It is the absolute temperature limit for room temperatures It is used in conjunction with the outdoor temperature compensation feature When the room temperature reaches this point and the outdoor temperature compensation feature is enabled an alarm is set off no 52 AA 800 AA 800T rev 05 matter what the outdoor temperature is It ranges from the high set point to 149 F 65 C with an accuracy of 0 1 F 0 1 C Enter the critical temperature and press Enter To enter a negative value use the key either before or after the digits The system displays the current zone temperature and retur
9. 2 NORMALLY CLOSED DEVICE A device that triggers an alarm by opening a closed circuit path NORMALLY OPEN DEVICE A device that triggers an alarm by closing an open circuit path PARTITION A group of zones used for activating or bypassing several zones at once see Section 4 6 SENSOR A device connected to the Agri Alert used to detect alarm conditions SIREN DELAY The duration of the siren when an alarm condition is reported see Section 4 10 ZONE An input configured to respond to the sensor connected to it 66 AA 800 AA 800T rev 05 WIRING DIAGRAMS Na k BOI HLM c04 G YVOS NIYIN maa ON me 008 VV L1008 VV x103 O M A NYYOIVIOG INIHIM LINDAID O N NZL aioa O M T104 HLIM HADAID O N LINDAID O N gow IVLIW 1401 N ZI UAG I YOS XVN Ea Ea L S S S ZE LE O 6Z TC 1Z 0Z OLSLLLOLSLVLELCLILOL 6 8 Z 8Z GND ZZ 9Z N9 SZ Z N9 Z CZ QNS IZ T 7t ar NIIS DGAGI SINANI INOZ SINdINO NO ros l LL JNN AINOHd YAOP IYAG 9 zHIAN2IO4JSNVuI Mld TIYM ZHO9 OYA OZ L NANIS JHL dO STIVNIARIAL JINIIVOIN ANY 3JAILISOd dH1 N3JML38 XOLSISIA MZ L OAS L V 1OIANNOO GSN LON SI Naas V dl GALOINNOO 34 OSIY ISNIN AMALIYA ANYOYA JHL GALOINNOO SI N32llS V d DYAN L AJALIYA CHU TG SINANI AlddNS ANNOYS IINVS JHL NO SINOZ OMI NVHL ION LOINNOO ION Od INdNI INOZ JHL OL LXAN ATALVIGSWIAI TYN ANIL ANNONS JHL AS
10. rev 05 the number you can use the Pause key feature Set the Pause Delay parameter to the smallest value needed for dialing pauses for example 1 second In the phone number definition press the pause Pe key as many times as needed for the length of the pause For example 9 Pause Pause Pause 1234567 will wait three sec onds before dialing the seven digit number note that the Pause key is displayed as P on the screen 5 Once all the digits have been entered press Enter The new phone number is displayed The system then prompts for the type of system associated with the number PHONE NUMBER OF HOME P4 The possible types are presented in a scrolling menu Use the arrow keys NG to select the type and press Enter Home When this type of number is called the system delivers a voice message describing the alarm condition to a home telephone Press Enter to select this option The system prompts for another phone number If you are finished press Cancel Cellular When this type of number is called the system delivers a voice message describing the alarm condition to a cellular telephone Press Enter to select this op tion The system prompts for another phone number If you are finished press Can cel Beeper This type of number is used with beeper systems When the number is dialed the beeper unit simply beeps Press Enter to select this option The system prompts for a
11. sent over the phone for on site listening if enabled Enter your password to acknow ledge alarm messages User enters four digit password on the phone keypad If an incorrect password is l entered the system responds with Wrong password The user has four tries in all to enter the correct password When the correct password is entered the system responds with OK gt To hang up press 0 For on site listening press 2 For a new selection press 8 AA 800 AA 800T rev 05 13 User enters selection on the phone keypad Status Reports You can dial into the Agri Alert system and obtain status reports over the phone A touch tone phone is needed to respond to the system prompts The following section outlines the dialogue session when the Agri Alert system answers the call The system automatically hangs up when the status report is finished Pa Hello this is Agri Alert User ID Message is played over the phone i Enter your password Ba kaa Td Quq C User enters four digit password on the phone keypad If an incorrect password is l entered the system responds with Wrong password The user has four tries in all to enter the correct password When the correct password is entered the system responds with OK Is Fora complete status report press 1 For a status report on a particular zone press 2 For on site listening press
12. status reports and alarm messages the system identifies itself with a voice recording provided by the user Setting 1 Press the ID message key Sber ID message The current ID message is played over the speaker on the front panel If no ID message has yet been recorded the system displays NONE 7 No ID MESSAGE PLAY TO MODIFY 1 TO QUIT X sA 2 To modify the current message press Enter To Modify ID Message 3 Type 2 to record a new ID message Enter A Na STATUS 1 MESSAGE 2 Pi 4 Press the ID message key microphone on the front panel FOR RECORDING PRESS 3 AND HOLD A Otherwise press Cancel Cancel X and hold while you speak the message into the 5 The screen will count down from a maximum of 7 seconds until the ID message key is released 7 RECORDING 07 SEC REMAINING 18 AA 800 AA 800T rev 05 PLAY Ne ID MESSAGE 2 5 The new message is played over the speaker and the system returns to the Date Time display To Activate Deactivate ID Message STATUS NG MESSAGE ENABLE DISABLE x 4 Type 1 to activate or 2 to deactivate ID message The new status is displayed and the system returns to the Date Time display AA 800 AA 8
13. system stores only the last ten alarms in memory It should be noted that if the zones are reconfigured at any time the alarm memory recorded up to that time is erased If the password feature is enabled the system requires a password before acknow l edging an alarm from the keypad acknow ledging over the phone always requires a password This password will appear in the alarm memory listing only if the master password is currently logged onto the system If a user is logged on the system will not identify the password that acknow ledged the alarm If at the time the alarm was acknow ledged the password feature was not enabled the alarm memory listing will not contain the password that acknow ledged the alarm Alarm To access alarm memory press the Alarm Memory Key If no alarm events are presently stored in memory the system returns the message NONE To step to the next alarm entry while the current entry is still scrolling on the display press the Cancel Cancel key x Examples In the first example the password of the user that acknowledged the alarm is not identified This means either no password was entered when the alarm was acknowledged or the current password is not the master password a N SIREN OUTPUT DEFECTED AT 12 47 PM ON AUG 14 2000 ACK AT 01 16 PM ON AUG14 2000 A In the second example the password is identified This means that a password was entered when
14. the Siren Delay key The current siren delay is displayed Siren delay 5 MIN TO MODIFY 1 TO QUIT X Enter 2 Press Enter a RANGE FROM 1 20 MIN ENTER NEW DELAY _ MIN 3 Enter the new delay and press Enter The system returns to the Date Time display AA 800 AA 800T rev 05 61 TROUBLESHOOTING GUIDE PROBLEM SOLUTIONS The ALARM LED always turns on 1 Check Alarm Memory to determine which fuse is blown Refer to the table in Appendix A for replacement specifications If the problem is with the siren fuse follow the steps below 2 Check the siren fuse F8 If fuse is blown try to determine why before replacing Do not increase fuse capacity this could be a fire hazard Remember that the reset time is 45 minutes if no one is present and 2 minutes if someone is present 3 If no siren is connected to the siren terminals a resistor must be connected in its place 1 5k Q 2W See the intallation manual section 1 3 3 1 4 lf the siren impendance is to high add a 1 5k Q 1 W resistor to the siren cicruit as close to the siren as possible 5 The siren wire or siren may be defective 6 If the problem persists contact your dealer The TROUBLE LED turns on 1 Press the TROUBLE key for more information Fix the problem if possible and choose ERASE in the menu to reset the trouble flag 2 If the problem pers
15. 00T rev 05 19 2 4 PASSWORD PROTECTION Definition The Agri Alert uses passwords to restrict access to the system If the system is locked and any key is pressed the system prompts for a password When a correct password is entered the system is temporarily unlocked The system locks itself automatically after one minute if during this time no keys are pressed Pass words are defined as four digit numbers and are divided into two types 1 The Master Password is used to enable or disable the password feature Only the master password has this capability In addition the master password is required in order to define or modify the user passwords 2 Up to ten User Passwords can be defined to allow different people access to the system A user password can temporarily unlock the system However a user pass word cannot add or change passwords or enable or disable the password feature When a password is used to acknowledge an alarm the system keeps track of the password in the alarm memory This information is displayed in the Alarm Memory function when the current password is the master password see Section 4 4 When you first turn the unit on the password feature is disabled and the master password is set to 0800 2 4 1 Modifying the Master Password 1 Press the Password key The system displays the status of the password feature STATUS DISABLE PASSWORD ENTER MASTER
16. 4 For a new selection press 8 To hang up press 0 If a complete status report is selected a status report is given for each zone with the following information BYPASSED DISABLED INCOMPLETE DATA ALARM if zone is in alarm ACTIVATED TEMPERATURE READING if zone is a temperature zone in C or F depending on current settings 14 AA 800 AA 800T rev 05 The status of the system is given with the follow ing possibilities LOW BATTERY BATTERY OK SYSTEM POWER OK SYSTEM POWER DOWN SYSTEM TROUBLE System returns to the main menu If a status report on a particular zone is selected the system prompts for the zone number Enter zone number and press star A status report is given for the selected zone with the following information BY PASSED DISABLED INCOMPLETE DATA ALARM if zone is in alarm ACTIVATED TEMPERATURE READING if zone is a temperature zone in C or F depending on current settings System returns to the main menu AA 800 AA 800T rev 05 15 CHAPTER TWO SYSTEM INITIALIZATION 2 1 POWER UP When the system is powered up for the first time the system displays the current revision number of the softw are program and the speaker plays the message Hello this is Agri Alert The default date and time are displayed If the date and time have never been adjusted the system will display the message ADJUST CLOCK periodically to rem
17. Agri Alert 800 amp 800T ALARM SYSTEM USER S MANUAL AgriAlert 800 Alarm On Line Standby 16VAC Failure Bypassed Low Battery Armed Trouble 00 BAT KON KO PS KOI Io u ke 2 ABG 3 DEF Phone Numbers Password ID Message 4 GHI 5 JKL MNO G Power Entry Exit Siren Delay Failure Delay 7 PRS 8 TUV 9 WXY Partition Contrast On site ears Listening C F ping Alarm On Oi Memory ee d Qa Cancel Activate Outdoor Clock Trouble System Pause Arm Disarm M 890 00013 rev 05 CD WIATRON ELECTRONIQUE ELECTRONICS Viatron Electronics 5200 Armand Frappier St Hubert Quebec Canada J3Z 1G5 WARNINGS The warranty can be void if this product is used in a manner not specified by the manufacturer Every effort has been made to ensure that this manual is complete accurate and up to date The information contained in it is however subject to change without notice due to further developments Table of Contents CHAPTER ONE USER INTERFACE 2min ANAN a 6 LL FRONT PANEL Gana E DAAN AA AA 6 1 2 MEANING OF STATUS LEDS rr AA DNA PINA DAT O AE nO NONA 7 1 3 DISPLAYING A PARAMETER u u uy u k as i AANO ayanku ante kka aaa 7 1 4 MODIFYINGA PARAMETER uuu u u u aaa akak aypana awqaman AAEE aiid 8 Lo HON TOU ETRHEMENUS eraser umasa umn usaspa AA EE 9 1 0 SL TEM ME AO maa ATON AA NANANA ee eee ee 10 1 7 BURGLAR ZONES cnasacsarnseesca DAGDAGAN AAAAEL ASIA DAN TANG DIAD
18. E 1 DISABLE 2 XN J 4 Type 1 to enable or 2 to disable outdoor compensation feature The new setting is displayed and the system returns to the Date Time display 46 AA 800 AA 800T rev 05 To Set the Offset Temperature AA 800T Model Only 1 Press the Outdoor key The system displays the current status outdoor Outdoor probe assignment and temperature offset value OUTDOOR PARAMETERS STATUS DISABLE OUTDOOR PROBE ZONE 8 OFFSET TEMP 5 0 F TO MODIFY I TO QUIT X Enter 2 Press Enter to modify the outdoor temperature compensation settings or Cancel Cancel to quit a N STATUS 1 OFFSET TEMP 2 x Bi 3 Type 2 to change the offset temperature By default the offset is 5 F 2 8 C RANGE FROM 0 F 36 F OFFSET TEMP F NG A 4 Enter the offset temperature and press Enter The system displays the new set ting and returns to the Date Time display AA 800 AA 800T rev 05 47 4 4 ALARM MEMORY Definition Each alarm condition detected by the Agri Alert system is recorded in memory for future reference The parameters stored in memory are the zone number the alarm type the time the date the user who acknow ledged the alarm if a user is defined and the time and date of acknowledgement The
19. LAA NA PAGGANA AE NANANA NIAA AA AA 11 1 8 ACKNOWLEDGING AN ALARM uu u JJ rr rrrrrrnrnnnrnrrnnnnrnnnnnnrnnnnnnnrnssrasasraa 12 L9 TELEERPHONEINTER NE NAA UA EGAY 13 CHAPTER TWO SYSTEM INITIALIZATION r 16 dal POWER 5 E E NAA 16 22 Sf STEM CLOCK mama AA NAA AA AA AA 16 2 3 USERID MESSAGE daan uaassaspakanaskhanamaanaenqa anqkuaka iasssapaqakashuqqakhanhunarayasanapupakaqta 18 2 4 PASSWORD PROTECTION uuu ua as asarasanaaa auayakua BAI AGA AA 20 2 4 1 Modifying the Master Password ccccsccccneccneeennteeneeeuneeenteenneenseenneennens 20 2 4 2 Enabling Disabling the Password Feature sssesseseesssssssssssrrrrrrrrrrrrrrnne 22 2 4 3 Modifying the User PasswordS ssssssssssesserrsrerrsrrnnsrrrrrrrrrrrrrrrrrrrrrereee 23 2 4 4 Erasing All User Passwords ssnsssnnrnrrrrrnrrrerrrrrerrrrrrrrrrrrrrrrrrrrrrrrrrrre 24 2 5 TEMPERATURE UNIT nA R ms E EEE E E I 25 2 6 16 VAC POWER FAILURE ALARM ccccececsseneetecseeseseaeeeesestsrseeaeetsrsaraeatarenranes 26 2 7 TEST PROCEDURE seaman ana E AN 2 220 TROUBLE INFORMATION uuu uuu uuu n numas AAEE A 28 229 SAND BC MODE u ANNA NANANA NN ANA SNANG 29 CHAPTER THREE COMMUNICATION PARAMETERS 30 Sd INTRODUCTION paaa AA AA AN AN 30 3 2 DIALING INFORMATION r KONDI DAGAD ANN NAGANA BANANA DAAN NA NGAGE 32 Saad DUY LISO p O rensar EEE E EEEE FRORA EIEREN ETI OESS 32 3 2 2 Message Repeti
20. N OBSERVAT LENGTH NG A 6 Enter the observation length and press Enter The system displays the new setting and returns to the Date Time display 54 AA 800 AA 800T rev 05 4 6 PARTITIONS Definition Zones can be grouped into partitions relating alarm systems located in the same area This makes it easy to activate or bypass several zones at once if they are physically located in the same area or if they are logically connected together Figure 5 below gives an example of this If for example the animals in Building 2 are evacuated the alarm systems for the entire building can be turned off at once Up to 8 different partitions can be programmed into the system If changes are made to a artition all zones associated with the partition are deactivated Note that burglar zones cannot be included in a partition If a zone belonging to a partition is redefined as a burglar zone it will be removed from the partition Figure 5 Example of Partitioning L BUILDING 1 Partition 1 Partition 2 Agri Alert 800t 800 Setting 1 Press the Partitions key Partin The partitions currently stored in memory are dis Cancel played To stop the display press the Cancel key x a y TO MODIFY 1 TO QUIT X S Z Enter 2 Press Enter y to modify ENTER PARTITION 1 8 _ KG A 3 Type the number of the partiti
21. N SNOIL OANNOD JNOZ NIAVIN NSHM dN GIANOOH LON SI ASALIVA AHL dl NABIS AHL dAMOOH ION Od INN AHL JO WOLLO4 JHL Iv SINO NOONNY ITAYIIYAY ASN IOULNOD LINN 3HL dO SAIS 3H1 TIRIG LON OG 67 AA 800 AA 800T rev 05 TECHNICAL SPECIFICATIONS TYPE SUPPLY Transformer Battery OUTPUTS Siren 12VDC Output OPERATING TEMPERATURE POLLUTION DEGREE INSTALLATION CATEGORY ALTITUDE HUMIDITY CLEANING 68 AA 800 AA 800T rev 05 AA800 amp AA800T 16 5 VAC 40 VA Fuse F6 5A fast blow Fuse F7 5A fast blow Rechargeable sealed lead acid 12V 7 5 AH Fuse F28 5A slow blow 12VDC 1 5A max Fuse F8 2A slow blow 750mA DC max Fuse F4 1A fast blow AA800T models only 32 TO 104 F 0 TO 40 C Indoor use only 2 2 7900 Ft Max 2000 Meters Max 95 max Gentle soap and water REGISTRATION CARD AGRI ALERT 800 amp AGRI ALERT 800T Please fill out the following form to receive information on future updates Name Address City Phone number Fax number E mail Purchased from Date purchased Serial Number Software Version Number Press the System key Fax this page to 450 926 2780
22. Otherwise the system displays the message PASSWORD UPDATED and the master password is updated to the new value AA 800 AA 800T rev 05 21 2 4 2 Enabling Disabling the Password Feature 1 Press the Password key The system displays the status of the password feature STATUS DISABLE PASSWORD ENTER MASTER PASSWORD __ 2 Enter the four digit number corresponding to the master password and press Enter If you do not enter the correct password at this point the message WRONG PASSWORD is displayed and the system returns to the Date Time display By default the master password is set to 0800 at the factory TO MODIFY I TO QUIT X N A Cancel 3 Type Enter pi to modify the status of the password feature or Cancel exit this function PASSWORD STATUS v S S 4 Press Enter T to select STATUS option ENABLE 1 DISABLE 2 5 Type 1 to enable or 2 to disable the password feature j N STATUS DISABLE Na Z 6 The system returns to the Date Time display 22 AA 800 AA 800T rev 05 2 4 3 Modifying the User Passwords 1 Press the Password key tl The system displays the status of the password feature STATUS DISABLE PASSWORD NG ENTER MASTER PASSWORD _ a 2 Ent
23. PASSWORD __ 2 Enter the four digit number corresponding to the master password and press Enter Enter aw f you do not enter the correct password at this point you cannot continue The system sends the message WRONG PASSWORD and returns to the Date Time display By default the master password is set to 0800 at the factory 20 AA 800 AA 800T rev 05 TO MODIFY I TO QUIT X NG Z Enter Cancel 3 Type Enter to modify the master password or Cancel to exit this func tion PASSWORD STATUS v Z 4 Using the up and down arrow keys NG scroll the menu until the item dis Enter played is MASTER and press Enter g a ENTER NEW PASSWORD _ N Enter 5 Enter a four digit number and press Enter g If the new password you enter is the same as the old value the system returns to the Date Time display If the new password is the same as one of the user passwords the message USER PASSWORD is displayed and the user is prompted for another password Otherwise the system asks to confirm the new definition ENTER AGAIN 6 Type the four digit number and press Enter If the number does not correspond to the value entered previously the system displays the message WRONG PASSWORD and returns to the Date Time display without changing the current password defini tion
24. and press Enter The system displays the new delay setting and returns to the Date Time display AA 800 AA 800T rev 05 39 3 6 RINGS ANSWERING MACHINE Definition The user can define the number of rings before an incoming call is an swered for example for a status report The values range from 1 to 20 rings The system can also be configured to connect a telephone answ ering device on the same phone line When this feature is enabled the Agri Alert system answers incoming calls only if a special ring sequence is followed Otherwise the telephone answ ering device takes the call after a preset number of rings The special ring sequence used to connect to the Agri Alert system is as follows dial the Agri Alert phone number and hang up after one ring redial the number after 30 seconds have elapsed after the first ring the Agri Alert system will answer the call If the answering machine is set to answer after one ring it must be set to more than one ring for this sequence to work If an answering machine is not used any calls made to the Agri Alert system are answered after the number of rings defined By default the number of rings is set to 8 and the answ ering machine feature is disabled Setting 1 Press the Ring key The current parameter setting is displayed Ring A N 8 RINGS TO MODIFY I TO QUIT X Enter Cancel 2 Press Enter _ to modify the
25. ature zone The state of the zone is displayed fol low ed by the status pa ZONE 6 75 0 F ZONE 6 STATUS ACTIVATED Na SET POINTS LO 55 0 PF HI 85 0 F 50 AA 800 AA 800T rev 05 NG CRITICAL TEMP 95 0 F TO MODIFY I TO QUIT X A 3 The critical temperature is displayed only if the outdoor temperature compensation feature is activated see Section 4 3 on AA 800T models only Press Enter 4 Cancel modify the current set points and or recognition time or press Cancel x 7 RECOGNITION SET POINTS 1 2 N Modifying Recognition Time 4 Press 1 to modify the recognition time Va RANGE FROM 0 59 HR 0 59 MIN 0 59 SEC BU RECOGNITION TIME Na a Z 5 Enter the recognition time and press Enter The system displays the new setting and returns to the Date Time display Modifying Temperature Set Points 4 Press 2 to modify the temperature set points Pa TEMPERATURE SET POINTS LO SET POINT RANGE FROM 40 0 F 149 0 F Enter to quit AA 800 AA 800T rev 05 to 51 LO SET POINT oF ng J 5 This is the lower value of the normal temperature range It ranges from 40 F to 149 F 40 C to 65 C with an accuracy of 0 1 F 0
26. e more changes or to end the session 7 TO END N TO CONTINUE 1 2 lt z4 Type 1 to make more changes Type 2 to exit this function the system returns to the Date Time display 4 7 BYPASS ACTIVATE FUNCTION Definition The Agri Alert system can activate or bypass individual zones and parti tions When a zone is bypassed no alarm detection is performed on the zone input When a zone becomes active the corresponding LED on the left hand side of the front panel turns on and the system monitors the alarm input connected to the zone When an alarm occurs the LED for the zone where an alarm was detected starts blinking rapidly The relevant data are recorded in alarm memory and the dialout sequence is launched Note that burglar zones cannot be activated in this way although they can be bypassed one at a time Burglar zones are activated with the dot key and a pass word AA 800 AA 800T rev 05 57 To change the status of a zone 1 Press the Bypass Activate key ZONE 1 PARTITION 2 NX 2 Type 1 to change the status of a zone Z ENTER ZONE 1 8 _ NG Pi 3 Type the number of the zone and press Enter If the zone is not properly config ured the system responds with the message INCOMPLETE DATA ACTIVATE BYPASS 4 Type 1 to activate or 2 to bypass the zone The new state of the zone
27. e ranges from 1 to 7 times The default is 7 3 2 7 Alarm Recall Time Definition This parameter is used to relaunch the dialout sequence when an alarm has been acknow ledged but has not been reset Alarm Recall Time is the length of time between the time the alarm is acknow ledged and the time the dialout sequence is relaunched as long as the zone has not returned to its normal state for the duration of reset time If the alarm is reset before the recall time has elapsed the planned dialout sequence is cancelled This parameter ranges from 0 to 12 hours 0 to 59 minutes The default value is 30 minutes 3 2 8 Pause Delay Definition This parameter is associated with the Pause key as This key is used to introduce a pause in a telephone number when dialing The Pause Delay is the length of the pause For example if you need to exit a local phone netw ork before reaching an outside line you can use the Pause key after entering the access code usually 9 see Section 3 3 The range is from 1 to 255 seconds The default is 4 seconds AA 800 AA 800T rev 05 33 3 3 PHONE NUMBERS Definition Phone numbers are used to report alarm conditions Various methods are available voice messages paging beeper calls and reporting to a central monitoring facility Each number can contain up to 20 digits A maximum of 8 phone numbers can be stored by the system The order of the numbers stored in memory defines the dialout sequ
28. elay a N STATUS 1 DELAY 2 N Z 3 Type 2 to adjust the delay d a RANGE FROM 0 59 MIN O 59 SEC NG J 26 AA 800 AA 800T rev 05 ENTER NEW DELAY _ MIN SEC Na J 4 Enter the new delay in minutes Press Enter Enter the new delay in seconds Press Enter The system displays the new delay values and returns to the Date Time display 2 7 TEST PROCEDURE The Agri Alert system has the capability of testing certain functions from the key board To start the test procedure press the Test ts key Outline of Test Procedure 1 TEST LEDS The front panel LEDs are turned on and turned off one by one in sequence from top to bottom and from left to right 2 TEST LCD The LCD display is tested The LCD backlight is turned off and the display contrast is tested in steps from maximum to minimum contrast Each charac ter matrix is turned on two by two in sequence from left to right Make sure all the pixels in each square light up 3 TEST BUZZER The internal buzzer is tested 4 buzzes 4 TEST SIREN Two short beeps are sent to the siren if a siren is hooked up 5 ID SYSTEM The Agri Alert ID message is played over the speaker Make sure the message is audible 6 ID MESSAGE The user ID message is played over the speaker Make sure the message is audible If no message has been recorded the system displays NONE
29. elay If this is an ordinary phone or cellular number a voice message is delivered The number of times the message is delivered depends on the value of Message Repetitions lf the mute function is disabled this message is also delivered on site For a pager number an alarm code is sent to the pager system For a beeper number the beeper unit is called Busy numbers are placed at the end of the dialout sequence and redialed according to Busy Tries Dialout continues until either the alarm is acknowledged or the dialout sequence has been executed according to the value of of Call Repetitions Dialout sequence is stopped If a siren is connected to the siren output it is stopped If the alarm was acknowledged over the phone and if On Site Listening is enabled the user can listen to on site sounds according to the delay defined for on site listening 42 AA 800 AA 800T rev 05 Recognition Time Mute Call Start Delay Time Between Calls Message Repetitions Busy Tries of Call Repetitions Dial Tone Detection Pause Delay Key Dial Speed On Site Listening 4 2 SYSTEM ALARMS Definition The Agri Alert system detects certain internal alarm conditions that be have in the same way as a zone alarm i e the siren is activated the dialout sequence is launched etc These alarms have a fixed recognition time of 2 minutes the reset time is set to 45 minutes if no one is present or 2 minutes if someone is present i e
30. elephone numbers that are called in a speci fied order when an alarm has been validated by the system When a phone number is called the Agri Alert can perform different functions deliver a voice message send a pager message etc The dialout sequence can be stopped at any time by acknowl edging the alarm see Section 1 8 Otherwise it will continue until all the phone numbers have been called and until the entire sequence has been called a set number of times equal to of call repetitions parameter When a busy signal is returned on a line the phone number is placed at the end of the sequence If the Busy Line Tries parameter is not zero the system redials the busy numbers once all of the other numbers have been called This is repeated according to the value of Busy Line Tries Once the sequence is finished the entire process is repeated until it has been com pleted a number of times equal to the of call repetitions parameter If new alarms are detected during a dialout sequence the entire dialout sequence is restarted Example Number of telephone numbers 5 of call repetitions 2 Busy Line Tries 2 START OF DIALOUT SEQUENCE 1 Phone number 1 connect Phone number 2 connect Phone number 3 x gt busy Phone number 4 busy Phone number 5 connect Phone numbers 3 and 4 are busy They are placed at the end of the list and redialed since Busy Line Tries 2 30 AA 800 AA 800T rev 05
31. en a Zone configuration conflicts with the signal received from the sensor TROUBLE ee a wire short or open circuit is detected on a temperature or dry contact with EOLR input a sottware problem is detected 1 3 DISPLAYING A PARAMETER When you select a parameter to input or modify the system begins by displaying the current value or status of the parameter If the message to display is longer than the size of the window it will be scrolled to the left The display pauses at the end of each screen to allow time to read the message You can exit prematurely from a Cancel display sequence at any time by pressing the Cancel gt x key This will place you in program mode and allow you to modify the parameter values See next section To exit from this function as well press the Cancel key once again AA 800 AA 800T rev 05 7 If a parameter is not completely defined when you try to display it the message INCOMPLETE DATA appears on the screen This may be an indication that the sys tem will not behave as expected If for example a zone input is not completely configured the system will not monitor the zone for alarm conditions Before enabling the system for normal operation make sure all parameters are properly defined In the case of phone numbers and zones the system will display a message every 3 seconds telling the user which zones and phone numbers are incomplete To exit from the warning display p
32. ence used when an alarm is validated i e the first number stored is the first number called in an alarm Setting 1 Press the Phone numbers key nm The numbers currently stored in memory are numbers displayed along with their parameter definitions To stop the display and enter pro Cancel gramming mode press the Cancel key x a h TO MODIFY 1 TO QUIT X NG y Enter 2 Press Enter al to modify 3 SELECT PHONE NUMBER 1 8 _ Na J 3 Type the number of the phone number to modify and press Enter The current value for this phone number is displayed d N ENTER PHONE n kl P 4 Type the phone number Up to 20 digits can be entered If you press the Enter key without entering any digits the current phone number is erased from memory and the message PHONE NUMBER DELETED is displayed Special characters are available for use with tone dialing use the Asterisk 58 or Pound keys to enter Outdoor Trouble these characters in a phone number Each one of these characters counts as one digit in the number Press the Pause Pase key to enter a pause in the dialing This is useful when an access code is needed to reach an outside telephone line For ex ample if you dial 9 to access the telephone lines and wait 4 seconds before dialing 34 AA 800 AA 800T
33. enter a zero value you cannot simply press Enter you must type 0 Enter If you make a typing mistake you can backstep using the back arrow key O under neath the display window before pressing Enter The cursor will position itself accord ingly You can enter a negative value if this is allowed for example a negative tem perature value by pressing the key either before or after the digits After entering a value using the numerical keypad press Enter to register the value If the value entered falls outside the permissible range for that parameter the system will beep three times and wait for you to modify the input using the back arrow key 1 5 HOW TO USE THE MENUS Menus are used to select a parameter or to assign a predetermined value to a param eter If the menu is comprised of only two items they are displayed on the screen at once For example when you press the Clock key followed by Enter to modify ock the following menu appears You simply type the number of the item to select that item no need to press the Enter key When more than two menu items are involved the system will display one item at a time and allow the user to scroll through the menu using the up and down arrow keys NG Each menu item is follow ed by an arrow symbol to locate the current position in the menu Once a menu item is selected other sub menus may appear to further define the input For example if you pre
34. er the four digit number corresponding to the master password and press Enter If you do not enter the correct password at this point the message WRONG PASSWORD is displayed and the system returns to the Date Time display When you first turn the unit on the master password is 0800 7 TO MODIFY 1 TO QUIT X 3 Type Enter oi to modify user passwords or Cancel PASSWORD STATUS v 4 Press Enter y to select USER option TO MODIFY 1 ERASE ALL 2 Nga 5 Type 1 to modify the user passwords VA PASSWORD 01 5698 v z 6 The first user password is displayed in a menu Cancel X NG scroll the menu to the desired password and press Enter J to exit this function Using the up and dow n arrow keys Enter AA 800 AA 800T rev 05 23 PASSWORD i 03 v Ne Pi 7 Type the new four digit code If the new password already exists the message PASSWORD ALREADY EXISTS is displayed Otherwise the message PASSWORD UPDATED is displayed and the new password is displayed in the same menu C a PASSWORD 03 1234 v N J 8 Repeat the above sequence for each user password to modify or add When you Cancel are finished press the Cancel gt x key 2 4 4 Erasing All User Passwords 1 Press the Password key s The sy
35. er to toggle between pulse dialing and tone dialing The default setting is TONE 3 5 ON SITE LISTENING Definition This feature allows the user to listen to on site sounds during a status report or an alarm report The integrated microphone on the control panel is used for this purpose An external microphone can also be hooked up for on site listening Only one microphone can be used at a time The user can enable or disable on site listening and adjust the listening time The default setting is DISABLED with a listen ing time of 30 seconds Setting 1 Press the On site Listening key The status Enabled Disabled is displayed On site Listening followed by the current listening time STATUS ENABLE DELAY 10 SEC TO MODIFY 1 TO QUIT X Enter Cancel 2 Press Enter to modify or Cancel x to quit STATUS 1 DELAY 2 To Activate Deactivate On site Listening 3 Type 1 to modify the status of on site listening PF ENABLE DISABLE N 4 Type 1 to enable or 2 to disable on site listening The new status is displayed and the system returns to the Date Time display 38 AA 800 AA 800T rev 0 5 To Adjust Listening Time a N 3 Type 2 to adjust the listening time RANGE FROM 0 59 SEC ENTER NEW DELAY SEC NG A 4 Enter the new delay
36. erature reaches the criti cal high temperature an alarm is set off To use this feature an outdoor temperature probe must be connected to a temperature zone The probe must have a pale colored white or grey PVC casing and should be installed near an air intake Critical Temperature The absolute temperature limit for room temperatures When the room temperature reaches this point an alarm is set off no matter what the outdoor temperature is The default setting is 95 F 35 C Offset In general the room temperature is greater than the outdoor temperature by a certain number of degrees called the offset The offset determines when an alarm is set off It is the number of degrees the room temperature can rise above the outdoor temperature without setting off an alarm The default setting is 5 F 2 87 C The diagram below shows when the outdoor temperature compensation feature takes effect if it has been enabled by the user When the outdoor temperature is greater or equal to the high set point less the offset the system uses the outdoor temperature as the reference point for monitoring high temperature alarms Figure 2 Outdoor Temperature Compensation Temperature Normal Alarm Outdoor T M onitoring L Compensation High Set Point a OFFSET Outdoor T 44 AA 800 AA 800T rev 05 When outdoor temperature compensation is in effect the system monitors i t
37. he room temperature with respect to the critical temperature this check has the highest priority ii the room temperature with respect to the outdoor temperature The figure below illustrates the first case Figure 3 Critical Temperature Monitoring Temperature Critical T oe HELE a SAN EE NO ALARM ala 22 ENE ee NOE Time In the second case the system monitors the difference between the room and out door temperatures When this difference is greater than the offset an alarm is set off Figure 4 Monitoring the Indoor Outdoor Temperature Difference Temperature Room T or ET Outside T Time AA 800 AA 800T rev 05 45 To Activate Deactivate the Outdoor Temperature Compensation AA 800T Model Only 1 Press the Outdoor key The system displays the current status outdoor Outdoor probe assignment and temperature offset value OUTDOOR PARAMETERS STATUS DISABLE OUTDOOR PROBE ZONE 8 OFFSET TEMP 5 0 F TO MODIFY 1 TO QUIT X Enter 2 Press Enter 7 to modify the outdoor temperature compensation settings or Cancel Cancel x to quit The system displays a menu a N STATUS 1 OFFSET TEMP 2 XN A 3 Type 1 to change the status of the outdoor compensation feature N ENABL
38. ihu AG 61 TROUBLESHOOTING GUIDE uuu aaa AA NINANG AANO 62 APPENDIX A FUSE TYPES ssssamaaaanananaanaananaanaanaanaaanaan 64 APPENDIX B MAXIMUM WIRE LENGTHS ssssssnnnsnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn 64 APPENDIX C BACKUP BATTERY LIFE SPAN sssssssnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnan 64 GLOSSARY OF TERMS sasa ANNA AA AA 65 WIRING DIAGRAMS nssssnssnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn 67 TECHNICAL SPECIFICATIONS sssssasawnanaananaanananaanaaaaannan 68 REGISTRATION CARD ssssswasawmanaanaaanaaanaanaananannanaananaan 69 4 AA 800 AA 800T rev 05 Figure 1 Figure 2 Figure 3 Figure 4 Figure 5 Table 1 Table 2 LIST OF TABLES AND FIGURES Calling a Pager Number ssssssssnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn 37 Outdoor Temperature Compensation sssssssusssnnsssnnnunnnnnnnnnnnnunnnnnnnnnnn 44 Critical Temperature Monitoring ssssssnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn 45 Monitoring the Indoor Outdoor Temperature Difference 45 Example of Partitioning sssssssssnssnsnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn 55 Pager Codes Used by the Agri Alert System a a arwa 36 System AlarifiS AA AA AA 43 NOTICE Every effort has been made to ensure that this manual is complete accurate and up to date The informat
39. ind the user that the date and time are not correct 2 2 SYSTEM CLOCK Definition The system has an internal clock that must be set when you first turn the unit on The time can be displayed in AM PM format or 24 hour time As a default the system clock is set to 12 00 PM JANUARY 1 2001 in AM PM format The bat tery backup used by the Agri Alert will keep the time and date in case of a power failure The system displays the message ADJ UST CLOCK periodically if the date and time have not been set Setting 1 Press the Clock key sal Clock The current date and time are displayed TO MODIFY 1 TO QUIT X 2 Type Enter Y to modify the current settings DATE 1 TIME 2 3 Type 1 to change the date a gt ENTER NEW DATE _ __ __ _ M D Y or 2 to change the time 12 HR AM amp PM 1 24 HOUR 2 4 Type 1 for AM PM time or 2 for 24 hour time 16 AA 800 AA 800T rev 05 ENTER NEW TIME _ HR MIN NG Note that you must press Enter after typing each value to step to the next one For example to enter the time 9 14 the sequence is 9 Enter 14 Enter If you selected AM PM time an additional screen appears Z 5 Typelor2 The system updates the Date Time display AA 800 AA 800T rev 05 17 2 3 USERID M ESSAGE Definition When giving
40. ion contained in it is subject to change without notice due to further developments AA 800 AA 800T rev 05 5 CHAPTER ONE USER INTERFACE The system displays and prompts for information by using the alphanumeric screen The keypad is used for data entry and for enabling and disabling the various system functions The speaker on the front panel delivers voice messages A built in piezo electric warns of illegal entries 3 short beeps and beeps once when a valid key is pressed The integrated microphone on the front panel is used to record the user ID message and provide on site listening The status of some subsystems is displayed using LEDs on the front panel 1 1 FRONT PANEL 1 Display Screen An alphanu meric display used to provide infor mation and prompt for inputs eM MCT BETI Mant eB Low Baten EE lt Trouble 2 Cursor Keys Used to step through menu items during data en o or a E try and for deleting the last charac ASS ss ma ter entered 3 Zone Status LEDs Off DIS ABLED On ACTIVATED Slow Blink ing BYPASSED Fast Blinking ALARM 4 Speaker Vocal system identifi cation and alarm messages 5 Integrated Microphone Records the ID message and provides on site listening input 6 Keypad User inputs and information requests 7 System LEDs Status of various subsystems see table on following page KEYS TO SYMBOLS IN THE MANUAL Caution Carefu
41. is dis played If you have just activated a zone the LED associated with the zone will turn on To change the status of a partition 1 Press the Bypass Activate gt key ZONE 1 PARTITION 2 N 2 Type 2 to change the status of a partition 7a ENTER PARTITION 1 8 _ N EB 3 Type the number of the partition and press Enter If the partition does not exist the system responds with the message PARTITION NONE Pa ENABLE DISABLE Na 58 AA 800 AA 800T rev 05 4 Type 1 to enable or 2 to disable the partition The new state of the zone is dis played and the system returns to the Date Time display If you have activated a partition all the LEDs associated with the zones in the partition turn on 4 8 ENTRY DELAY Definition The time needed to disarm the burglar zones when entering the site before an alarm is set off This applies to all delay burglar zones and ranges from 0 to 5 minutes 59 seconds The default is 30 seconds The entry delay countdown begins when an alarm is detected in a burglar zone with an entry delay Setting 1 Press the Entry Exit Delay key enyzat a N ENTRY DELAY 1 EXIT DELAY 2 Ne A 2 Type 1 to adjust the Entry Delay ENTRY DELAY 0 MIN 30 SEC TO MODIFY 1 TO QUIT
42. ists contact your dealer The 16 VAC FAILURE LED turns on 1 Check fuses F6 and F7 If fuse is blown try to determine and electrical power is OK why before replacing Do not increase fuse capacity this could be a fire hazard 2 Check the wall transformer and wiring 3 Use a voltmeter to check voltage at the 16 VAC input terminals 16VAC minimum 4 If the problem persists contact your dealer 62 AA 800 AA 800T rev 05 PROBLEM SOLUTIONS The LOW BATTERY LED turns on 1 Remember that the reset time is 45 minutes the counter is and electrical power is OK started only once the display backlight turns off 2 Check battery voltage by pressing the System key and selecting BACKUP BATTERY from the Program Aux s menu Normal voltage should read from 12V to 14V 3 Check fuse F28 If fuse is blown try to determine why before replacing Do not increase fuse capacity this could be a fire hazard 4 Check the wall transformer and wiring 5 Use a voltmeter to check voltage at the 16VAC input terminals 16VAC minimum 5 Check the wiring to the battery 6 If the problem persists contact your dealer System goes into Standby mode by Disable standby mode using the On Off key Check battery itself voltage by pressing the System key and selecting BACKUP BATTERY from the Program Aux s menu Normal voltage should read from 12V to 14V If the voltage is low follow instructions above for 16 VAC failure led The me
43. its All burglar zones are armed or disarmed as a group using a special key sequence see Section 1 7 BUSY TRIES In the dialout sequence the number of times the system will retry a number when the line is busy see Section 3 2 1 CALL START DELAY The time betw een the validation of an alarm and the beginning of the dialout sequence see Section 3 2 3 CALL REPETITIONS In the dialout sequence the number of times the phone numbers in memory are called for a given alarm See Section 3 2 6 DEFAULT A value permanently stored in memory and used to define a parameter in the absence of a user defined value DIALOUT SEQUENCE Upon validation of an alarm the calling of the phone numbers in memory according to a specified order until each number is reached a specified number of times see Section 3 1 ENTRY DELAY The time delay for entering the site without setting off an alarm see Section 4 8 This applies to delay burglar zones only EXIT DELAY The time delay for exiting the site without setting off an alarm see Section 4 9 This applies to burglar zones only LED Light Emitting Diode An electronic device used to indicate the status of various functions on the front panel MAIN BOARD The electronic card located at the bottom of the Agri Alert enclosure marked V 101 AA 800 AA 800T rev 05 65 MESSAGE REPETITIONS The number of times a voice message is delivered when an alarm condition is reported See Section 3 2
44. ivered on site through the speaker on the front panel and the siren is sounded if it is enabled for the zone in alarm Call Start Delay allows someone on site to acknow ledge an alarm before the dialout sequence is launched Note that if MUTE is enabled no message is delivered on site before dialout The value ranges from O to 59 minutes The default is 1 minute 3 2 4 Time Between Calls Definition The delay after a phone number has been called before proceeding with the next number in the dialout sequence If someone who has received a voice mes sage is unable to acknow ledge the alarm at the time of the call this delay will allow time to stop the dialout sequence between calls If the system is continuously dialing 32 AA 800 AA 800T rev 05 out no calls can be made to the system to acknowledge an alarm An intercall time that is greater than zero makes this possible The value ranges from 0 to 59 minutes The default is 1 minute 3 2 5 Restore Calls Definition This feature launches the dialout sequence when a zone in alarm returns to its normal state to advise of the change It can be enabled or disabled and the default setting is DISABLED 3 2 6 of Call Repetitions Definition When an alarm is validated the system starts calling the phone numbers stored in memory to deliver the alarm message The of Call Repetitions determines the number of times this procedure is accomplished within one alarm dialout se quence The valu
45. ll affect all currently active burglar zones The system displays the message BUR GLAR ZONES DISARMED on the screen AA 800 AA 800T rev 05 11 1 8 ACKNOWLEDGING AN ALARM In order to notify the Agri Alert system that an alarm message has been received the alarm must be acknowledged There are several ways of doing this If you are on site when an alarm is detected enter your password if the password feature is en abled or simply press lt 1 gt key on the front panel to acknowledge You can also acknowledge an alarm over the phone when the Agri Alert system reports the alarm see below or by calling the Agri Alert system yourself between phone dialouts if the intercall time is greater than zero Acknow ledging from the keyboard When an alarm is detected the following message is displayed N ACK ALARMS PRESS lt 1 gt 1 Press 1 to acknowledge If the alarm is not acknow ledged from the keyboard within 15 seconds and the dialout sequence is enabled for the zone in alarm the dialout sequence will be launched If the password feature is enabled the system prompts for a password before acknow ledging ENTER PASSWORD J 2 When a user acknowledges an alarm the siren stops ringing If the dialout se quence is completed and no acknowledgment has been received the alarms are automatically acknowledged but the siren continues to ring it must be acknowledged separately from
46. lly read the following text for it contains important infor WARNING mation which if ignored may cause the controller to operate improperly lt gt Pay attention The following text contains very useful information 6 AA 800 AA 800T rev 05 1 2 MEANING OF STATUS LEDS This LED is activated when one or more alarm conditions are detected The individual zone LEDs on the left side of the panel ALARM corresponding to the zones in alarm start blinking at high speed The LED is turned off when the alarm is acknowledged as long as the alarm condition no longer exists the reset time has elapsed and no other alarms are active This LED is activated when the Agri Alert system is in standby mode STANDBY In this mode the system stops monitoring the sensor inputs for alarm conditions The LED is turned off when normal monitoring is resumed This LED is activated when one or more zones are bypassed The BYPASSED individual zone LEDS on the left side of the panel corresponding to the bypassed zones start blinking at low speed The LED is turned off when no zones are currently bypassed ARMED This LED is activated when the burglar zones are armed ON LINE This LED is activated when the system uses the phone line 16 VAC This LED is activated when a power failure is detected on the 16VAC FAILURE supply circuit wall mount transformer LOW BATTERY This LED is activated when the back up battery voltage is low This LED is activated wh
47. n is performed on the zone input The LED on the front panel blinks slowly To change the state to ACTIVATED use the Bypass Activate key 4 5 1 Viewing and Modifying Dry Contact Zones The recognition time of a dry contact zone can be modified using the Zone key as follows Refer to section 3 2 of the installation manual for further information about dry contact zones and recognition time 1 Press the Zone key Zone a N SELECT ZONE 1 8 _ 2 Enter the number of the zone The state of the zone is displayed followed by the status a A ZONE 1 75 0 F AA 800 AA 800T rev 05 49 ZONE 5 STATUS ACTIVATED TO MODIFY 1 TO QUIT X J 3 Press Enter to modify the recognition time of the dry contact zone 7 RANGE FROM 0 59 HR 0 59 MIN 0 59 SEC N A Na RECOGNITION TIME N A 4 Enter the recognition time and press Enter The system displays the new setting and returns to the Date Time display 4 5 2 Viewing and Modifying Temperature Zones The Zone key allows to modify the set points of temperature zones and their recogni tion time Refer to section 3 2 of the installation manual for further information about temperature zones and recognition time 1 Press the Zone key Zone 7 N SELECT ZONE 1 8 _ Pi 2 Enter the number of a temper
48. ne number is called when the line is busy This parameter applies equally to all the phone numbers in the dialout sequence The value ranges from O to 3 tries The default is 1 try When a line is busy and Busy Line Tries is greater than zero the busy number is placed at the end of the dialout sequence Once all the other numbers have been dialed the system returns to the busy numbers and tries again etc If the number is reached before all the tries defined in Busy Line Tries have been done it is not redialed Note If you have not configured the phone hookup to provide line seizure capability and someone is using the phone when the dialout sequence is launched the system counts this as a try as if all the phone numbers in the dialout sequence were busy If the Busy Line Tries parameter is set to zero no other tries will be made in this case and the alarms that set off the dialout sequence will automatically be acknow ledged 3 2 2 Message Repetitions Definition The number of times a voice message is delivered by the system when an alarm condition is reported This applies to the messages given over the phone and on the unit speaker The value ranges from 2 to 15 times The default is 3 3 2 3 Call Start Delay Definition The time betw een the validation of an alarm and the beginning of the dialout sequence A zero value means the dialout sequence begins immediately after an alarm validation When an alarm is validated a message is del
49. nother phone number If you are finished press Cancel Pager This type of number is used to access a numeric pager system When a pager device is paged a code number is displayed on the pager screen The Agri Alert uses this number to transmit information to the user The code is in the form of a tele phone number and contains the follow ing information 15S AAAA AAAA is the four digit code describing the type of alarm SS is the tw o digit code of the site where the alarm occurred 1 is a place holder AA 800 AA 800T rev 05 35 SS is the site where the Agri Alert is installed AAAA is an alarm code generated by the Agri Alert The site number is defined by the user For example if two Agri Alerts are installed on separate sites the user can identify each site with a unique code number In the example below alarm code 3000 is used as a test code Number displayed on the pager device Site 01 Site 02 Table 1 below defines the codes used RESTORE ZONE means the zone returns to its normal state Table 1 Pager Codes Used by the Agri Alert System 1001 1002 1008 2001 2002 2008 8001 LOW BATTERY PROBLEM na ENCOUNTERED 8006 12VDC OUTPUT DEFECT 8008 SYSTEM TROUBLE 3009 SYSTEM AUTO STANDBY 9001 BATTERY OK 9002 16VAC OK PROBLEM RESTORED 9005 SIREN OK 9006 12VDC O K 36 AA 800 AA 800T rev 05 Figure 1 below shows the sequence of events The Agri Alert first dials the number
50. ns to the Date Time dis play 4 5 3 Viewing and Modifying Pulse Count Zones The Zone key allows to modify the lo and hi set points of pulse count zones It is also possible to change the observation length Refer to section 3 2 of the installer manual for further information about pulse count zones 1 Press the Zone key Zone 7 S SELECT ZONE 1 8 _ A 2 Enter the number of a pulse count zone The state of the zone is displayed fol lowed by the status Z ZONE 7 10 PULSES N ZONE 7 STATUS ACTIVATED SET POINTS LO 3 PULSES HI 15 PULSES OBSERVATION LENGTH 00 05 30 NX TO MODIFY TO QUIT X 3 Press Enter to modify the pulse count zone set point and observation length Pa PULSE COUNT PULSE SET POINT N AA 800 AA 800T rev 05 53 RANGE FROM 0 254 LO SET POINT PULSES XN 7 4 This is the lower number of pulses allowable during the observation length It ranges from 0 to 254 Enter the low set point and press Enter d gt HI SET POINT PULSES NG A 5 This is the highest number of pulses allow able during the observation length It ranges from 0 to 254 Enter the high set point and press Enter A N OBSERVAT LENGTH RANGE FROM 0 59HR O 59MIN O 59 SEC Na Pi
51. of the pager device When the pager system responds the Agri Alert waits for the voice message from the pager system to finish In the diagram this is called the message delay The diagram shows an additional delay used to ensure that the pager system is ready to receive the code number from the Agri Alert system This is up to the system usually 3 seconds Following this the Agri Alert dials the seven digit code number or numbers to be displayed on the pager device When configuring a number as a pager number the user enters the value Message Delay when the system prompts for the Delay for Pager Figure 1 Calling a Pager Number DIALING MESSAGE ADDITIONAL DIALING PAGER DELAY DELAY CODE NUMBER NUMBER Fr Time AGRI ALERT DIALS PAGER SYSTEM ANSWERS AGRI ALERT TRANSMITS 6 To configure a phone number as a pager number use the arrow keys to scroll to the Pager item in the menu N PHONE NUMBER OF PAGER N A 7 Press Enter to select this option N ENTER CODE TO PAGE 0 99 Na Z 8 Enter the two digit code used to identify the site and press Enter N DELAY FOR PAGER 0 59 SEC Na Z 9 Enter the total delay Message Delay used to walt for the end of the pager mes sage and press Enter The system prompts for another phone number If you are finished press Cancel AA 800 AA 800T rev 05 37 3 4 PULSE TONE The system allows the us
52. on to modify and press Enter AA 800 AA 800T rev 05 55 To Add a Zone PARTITION 1 ADD ZONE v Ni J 3 The different options are presented in a scrolling menu Use the up and down arrow keys NG to select ADD ZONE and press Enter 1 1 2 3 ADD ZONE _ W s4 4 The zones currently included in the partition are displayed on the first line Enter the number of the zone to add to the partition and press Enter If you choose a zone that is already assigned to another partition the system responds with the message ZONE IS ALREADY SELECTED The system displays the new partition definition PARTITION 1 ZONE 1 2 3 4 A To Delete a Zone a N PARTITION 1 DEL ZONE KG 58 3 The different options are presented in a scrolling menu Use the up and down arrow keys NG to select DEL ZONE and press Enter 1 1 2 3 4 DEL ZONE 4 Enter the number of the zone to delete from the partition and press Enter The system displays the new partition definition fe N PARTITION 1 ZONE 1 2 3 56 AA 800 AA 800T rev 05 To Delete a Partition S lt PARTITION 1 DEL PARTITION A A 3 The different options are presented in a scrolling menu Use the up and down arrow keys NG to select DEL PARTITION and press Enter The system displays the message PARTITION DELETED After Making a Change The system prompts to mak
53. ress the Cancel key 1 4 MODIFYING A PARAMETER If you have selected a parameter and the display sequence is now finished you can begin modifying the parameter values The following screen appears on the display g a TO MODIFY 1 TO QUIT X A This screen is also displayed if the display sequence described above was cancelled prematurely If you want to modify the parameter values at this point press the Enter Enter key _ to modify the parameter The system will prompt for the information re quired to define the parameter When the parameter is defined by a numerical value a range of possible values is displayed For example if you select the Exit Delay parameter followed by MODIFY the system responds N RANGE FROM 0 5 MIN O 59 SEC ENTER NEW DELAY MIN SEC The number of spaces provided for input corresponds to the maximum number of digits allowed In this example one space is provided for the minutes and 2 spaces are provided for the seconds The cursor positions itself on the first space and blinks 8 AA 800 AA 800T rev 05 until a digit is entered If no response is given within 2 minutes the system will can cel the input session and return to the Date Time display If more than one value is required in the same screen in this example hours and minutes press Enter after entering the first value to step to the following one To
54. ss the Password key After having entered the master s password the following sub menu appears N PASSWORD STATUS v AA 800 AA 800T rev 05 9 The first menu item is STATUS The arrow following the item means you are at the top of the menu If you press the dow n arrow O the second item appears The arrows indicate that menu items are to be found above and below the current item When you reach the end of the menu the last item will have an up arrow A To select a menu item press Enter PASSWORD MASTER lt gt 1 6 SYSTEM MESSAGES When the display is not being used by the user the system periodically scrolls various status messages If temperature zones are defined the temperatures for those zones are displayed as well as the low set point L the high set point H the critical tem perature C is also displayed if the outdoor compensation feature is enabled When alarms are detected they are displayed as well including system alarms such as a battery failure or an unusual system temperature When a zone or phone number is improperly configured it is identified along with the message INCOMPLETE DATA When burglar zones are armed the message BURGLAR ZONES ARMED is displayed If the system clock has never been adjusted the message ADJ UST CLOCK is dis played Pressing any key will stop the display sequence ZONE 3 75 0 F L50 H90 C104
55. ssage DISTURBED LINE is If your system has not been wired for line seizure try enabling the displayed when the system dials out line seizure function by pressing the System key and selecting LINE SEIZURE from the menu section 4 1 2 of the installation manual This will deactivate the off hook monitor test Phone line does not behave as Unplug the Agri Alert system phone plug from the wall jack and expected contact your dealer AA 800 AA 800T rev 05 63 APPENDIX A FUSE TYPES APPENDIX B MAXIMUM WIRE LENGTHS TEMPERATURE BEN n APPENDIX C BACKUP BATTERY LIFE SPAN TEMPERATURE CURRENT mA 0 C 32 F 20 C 68 F 350mA minimum charge 3500mA maximum charge Siren 1500mA 1 2 hour 1 hour 12VCD 750mA 61 AA 800 AA 800T rev 05 GLOSSARY OF TERMS ACKNOWLEDGEMENT The indication to the system that an alarm message has been received The alarm acknow ledgement stops the dialout sequence and the siren and can be executed over the phone or from the keypad ALARM MEMORY A record of the ten last alarms stored by the system see Section 4 4 ALARM RECALL TIME Alarm recall time is the length of time betw een the time the alarm is acknowledged and the time the dialout sequence is relaunched as long as the zone has not returned to its normal state for the duration of reset time see Section 3 2 7 BURGLAR ZONE A zone used for detecting break ins Delays are provided to allow authorized entries and ex
56. stem displays the status of the password feature STATUS DISABLE PASSWORD ENTER MASTER PASSWORD __ x Z 2 Enter the four digit number corresponding to the master password and press Enter Enter wd f you do not enter the correct password at this point the message WRONG PASSWORD is displayed and the system returns to the Date Time display By default the master password is set to 0800 at the factory N TO MODIFY I TO QUIT X Z Enter 3 Type Enter _ to modify user passwords or Cancel Cancel to exit this function 24 AA 800 AA 800T rev 05 Pa PASSWORD STATUS v A 4 Using the up and down arrow keys NG scroll the menu until the item dis played is USER and press Enter 4 Enter 7 NG TO MODIFY 1 ERASE ALL 2 5 Type 2 to erase all user passwords Z N TO ERASE 1 TO QUIT 2 6 Type 1 to erase or 2 to exit without erasing The message PASSWORDS DELETED is displayed and the system returns to the Date Time display 2 5 TEMPERATURE UNITS Definition Temperatures can be displayed either in Fahrenheit or Celsius units All temperatures will be displayed according to this definition The default is Fahrenheit Setting 1 Press the C F key Bia The current value is displayed
57. the alarm was acknow ledged and the current password is the master password N ZONE 1 HI TEMPERATURE AT 12 47 PM ON AUG 14 2000 ACK BY 1234 AT 01 16 PM ON AUG14 2000 NG A 48 AA 800 AA 800T rev 05 4 5 ZONE STATUS DISPLAY Definition You can display zone status information at any time by using the Zone key This key also allows you to modify certain zone parameters such as set points without having to reconfigure the zone The current zone definition and data readings are displayed along with the zone status The information displayed depends on the type of zone 1 Dry contact zones OPEN CLOSE recognition time 2 Temperature zones temperature reading set points critical temperature and recognition time 3 Pulse count zones pulse count set points and observation length When using the outdoor temperature compensation feature the zone assigned to the outdoor probe is identified by the message OUTDOOR PROBE See Section 4 3 The different zone states are summarized below 1 DISABLED When a zone is first configured it is in disabled state until the user activates it using the Activate key When a zone Is disabled no alarms are detected on the zone input The zone LED on the front panel is turned off 2 ACTIVATED Alarm detection is enabled on the zone input The zone LED on the front panel is turned on To change the state to BYPASSED use the Bypass Activate key 3 BYPASSED No alarm detectio
58. the keypad In this case the following message is displayed a N ACK SIREN PRESS lt 1 gt J 3 Press 1 to acknowledge or 2 to exit without acknowledging If the password feature is enabled the system prompts for a password before acknow ledging h ENTER PASSWORD a J If passwords are enabled and an incorrect password is entered the keypad will lock after 4 such tries The keypad will unlock only after the alarm is acknow ledged by phone or at the end of the dialout sequence 12 AA 800 AA 800T rev 05 1 9 TELEPHONE INTERFACE The Agri Alert system reports alarms over the phone It can also be accessed over the phone to obtain status reports When calling the Agri Alert make sure the Ring Until Answer and Answering Machine parameters are set properly see Section 3 6 Alarms When an alarm occurs the Agri Alert system reports the alarm over the phone to all the numbers programmed in its dialout sequence see Chapter 3 The follow ing section outlines the dialogue session when a number is reached A touch tone phone must be used to respond to the system prompts When an alarm is ac know ledged the Agri Alert system stops dialing out The system will hang up when the session is Over Hello this is Agri Alert User ID Message is played over the phone Description of the alarm condition for example Alarm Zone 1 7 On site Listening Microphone input is
59. tions kaaa AA AA APA ANA AAO 32 Sisi KALSADA AA NA GA ANA T 32 3 2 4 Time Between CONG secret BEDA P DAYAN LRT ANA AA AA AA 32 Sisid TES Ole LANG am AG AA A E AAP cides 33 3 2 6 of Call Repetitions aaa GIA NEA AA 33 Sisi Alarm RECA TIME sprr rss AA ANAN 33 3 2 0 Pause DON Pina AA E RETIER E ETIA ESTEET IDAT ENEE eevee 33 Jao PRONE NUMBERS uuu asasanaypuanaaaqamanapuqmuaqmaqananannahaqnaykappaawananawmqwtawsnananaqqumka 34 Jud PULSE TONG u O ANA AA E E E 38 30 ON SITELISTENING uuu u u MANGA NGA GLEN a NAGA TANAN AA 38 3 6 RINGS ANSWERING MACHINE anna NUNG u ann nane Tanda 40 AA 800 AA 800T rev 05 3 CHAPTER FOUR ALARM PARAMETERS sssssssnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn 42 4 1 ALARM VALIDATION SUMMARY OF EVENTS u 000011 42 AZ asa a ALARM G 52 E E E AE E TT 43 4 3 OUTDOOR TEMPERATURE COMPENSATION ON TEMPERATURE ALARMS 44 4 4 ALARM MEMORY ccccececsceseseetecueegeseeneeesestseseeeesterseeaesterensaeeestsrsaraeaeareniaees 48 4 5 ZONE STATUS DISPLAY uuu uuu NAYAN ANG AA AA 49 4 5 1 Viewing and Modifying Dry Contact Zones rr rr 49 4 5 2 Viewing and Modifying Temperature Zones rr 50 4 5 3 Viewing and Modifying Pulse Count ZONES rr 53 do PARIITIONO u m ana E E NE 55 4 7 BYPASS ACTIVATE FUNCTION u s 57 AO ENTRY DELAY uu ireti a AEE EAE E 59 AS PIP AY u u AA E 2 60 ALO SIREN DELAY uy asss usnu AAP AA NA AA r
60. value or Cancel gt to quit N DO YOU HAVE ANS WERING MACHINE YES z Sui ee ma 1 NOS ee taenaee 2 To Enable Disable Answering Machine 3 Type 1 to use an answering machine with the Agri Alert system The system returns to the Date Time display 40 AA 800 AA 800T rev 05 To Set Number of Rings 3 Type2 to disable the answ ering machine feature and set the number of rings before the Agri Alert system answers a call RANGE FROM 1 20 ENTER NEW NUMBER OF RINGS __ N J 4 Type the new number of rings and press Enter The system displays the new value and returns to the Date Time display AA 800 AA 800T rev 05 41 CHAPTER FOUR ALARM PARAMETERS 4 1 ALARM VALIDATION SUMMARY OF EVENTS ACTION RESPONSE PARAMETERS 1 AN ALARM IS DETECTED 2 AN ALARM IS VALIDATED 3 DIALOUT BEGINS 4 ALARM IS ACKNOWLEDGED The system measures the time elapsed since the detection of the alarm until Recognition Time is reached When Recognition Time has elapsed A voice message is delivered on site to report the alarm unless MUTE is enabled The system measures the time elapsed since validation until Call Start Delay is reached If a siren is connected to the siren output it is activated When Call Start Delay has elapsed each phone number in the dialout sequence is called each call is separated by Time between calls d

USER`S MANUAL - Poultry Technical Services

Contents

Download Pdf Manuals

Related Search

Related Contents