Home

IO TECH 488, 80A User

1. Command Set Command Support Command Summary Command Reference A Bit Set B Bit Clear C Configuration D Data Output E F Data Format G Bus Input Output H Handshake 43 50 Query Error Status 53 58 59 P Port Select Q Inhibit R Data Ready S Save Configuration 68 U User Status V View Configuration V View Version X Execute 61 M Service Request Mask O Recall Configuration a 64 65 66 aan 69 T4 76 Introduction Control of the Digital488 80A is implemented with 23 commands described here in detail Examples are given for the commands using a PC functioning as an IEEE 488 controller by using the Personal488 PC IEEE 488 board and associated Driver488 software All examples are given using GW BASIC or BASICA Commands may be given using upper or lower case letters The Digital488 80A bus address should be set to 08 for all examples In order to establish communication with Driver488 from GW BASIC or BASICA the following sequence must be used OPEN DEV IEEEOUT FOR OUTPUT AS 1 IOCTL 1 BREAK PRINT 1 RESET OPEN DEV IEEEIN FOR INPUT AS 2 All of the command examples that follow assume that the driver has been properly opened and reset by the above sequence Most of the instructions offer a Query command extension This extension can be used to determine the present configuration or mode of a command previously executed Any number of th
2. Specifications CAUTION Please read this manual carefully If equipment is used in any manner not specified in this manual the protection provided by the equipment may be impaired Digital I O Terminal Installation Category Standard Not Applicable CE Category 1 Digital I O Capability Dual Channels each with five 8 bit ports programmable as inputs or outputs Also included per channel are programmable handshake lines data latching capability a Service Request SRQ input and Clear and Trigger outputs Logic Levels Outputs drive 2 TTL loads 3 2 mA Optional 12 24 48 volt logic support available with the HVCX1 High Voltage Current Interface option High Current Outputs With the HVCX1 option the outputs can be configured in groups of eight as high current outputs Each high current output is capable of sinking up to 200 mA at 50 VDC maximum Total current sinking capability is 8 A maximum Update Rate In binary mode the Digital488 80A can update one 40 bit I O channel at over 2 Kbytes per second I O Port Connections Two 50 pin male D shell connectors Mating solder tab connectors are supplied Input Ranges Nominal Logic Low High Voltages 410 and Input Resistances HVCX1 option only 0 5 Volt Range 0 8 volts low 2 4 volts high 15 Kohms 0 12 Volt Range 1 9 volts low 5 75 volts high 35 Kohms 0 24 Volt Range 4 2 volts low 11 5 volts high 61 Kohms 0 48 Volt Range 8 4 volts low 23 volts high 135
3. Command Support Returns present configuration or mode of the command preceding the One exception to this command description is the View Version V command which is not related to the View Configuration V command Command Reference Like the command summary the following detailed command reference presents all 23 of the Digital488 80A commands in alphabetical order according to their command syntax Support for these 23 commands including the Query command extension and the use of the Serial Poll Status Byte is also presented All examples are given using GW BASIC or BASICA 46 _ Digital488 80A Commands Digital488 80A User s Manual A Bit Set SYNTAX Set bit to logic 1 where bit bit value from 1 to 40 rc Returns bit of the last bit that w was set DESCRIPTION The Bit Set A command programs a logic 1 output to a bit described by the argument bit Setting a bit may represent either a 5 volt or a O volt output depending on whether an Invert command I16 has been sent If data is active high default condition then Bit Set outputs 5 volts If multiple bits are to be set within the same command string then an Execute X command must follow every Bit Set A command To be valid the bit being set must have been configured as an output bit by the Configuration C command The Data Strobe output line is not pulsed when the Bit Set A command is sent CAUTION Because the Configuration C command i
4. The following figure compares the Dual Primary and the Secondary addressing modes Single unit Dual Primary Addressing Channel 0 Channel Primary address of Channel 0 is 08 Primary Primary Primary Address of Channel 1 is 09 Address 08 Address 09 Multiple units Secondary Addressing AEE Channel 1 Primary address of both channels is 08 Address 0800 Address 0801 Secondary Address of Channel 0 is 00 Secondary Address of Channel 1 is 01 Multiple units Secondary Addressing Primary address of both channels is 08 Address 0802 Address 0803 Secondary Address of Channel 0 is 02 Secondary Address of Channel 1 is 03 Channel 0 Channel 1 Comparison of Dual Primary amp Secondary Addressing Modes Digital488 80A User s Manual Digital488 80A Setup 9 HVCX1 Option Setup CAUTION If you would like to experiment with the Digital488 80A unit and the example programs do not install the HVCX1 option until after experimenting with the unit to avoid software hardware configuration conflicts If the HVCX1 option is already installed replace it with the jumper board to run the example programs WARNING Never disassemble the Digital488 80A case while it is connected to the AC power line Internal voltage potentials exist which could cause bodily injury or death The HVCX1 High Voltage Current Interface option is a configurable daughter board that allows the Digital488 80A to be used with 10 20K 24K or 48K oh
5. 1 8A Replacement Fuse CN 18 50 Mating Connector for DB 50 2 196 4030 Jumper Board In addition if the High Voltage Current Interface Option HVCX1 is included you will have the following items e 196 4020 HVCX1 High Voltage Current Interface Option e 196 0801 Accessories Kit HVCX1 Option for Digital488 80A which includes the following Digital488 80A User s Manual RN 3 20K 20 Kohms Resistor DIP Pack 12 RN 3 56K 56 Kohms Resistor DIP Pack 12 RN 3 120K 120 Kohms Resistor DIP Pack 12 RN 9 27K 27 Kohms Pullup Resistor SIP Pack 12 Digital488 80A Setup 5 Hardware Setup WARNING Do not use the Digital488 80A unit outdoors This unit is intended for indoor use only Unexpected outdoor conditions could result in equipment failure bodily injury or death Front amp Rear Panel Layouts Digital488 80A 7 A a Ae Aa A i Honda TALK LISTEN SRQ ERROR TEST POWER Digital488 SOA Front Panel Indicators Six LED indicators on the Digital488 80A front panel display the unit status The following list describes the functions of these indicators e TALK ON when Digital488 80A is in the Talker state OFF when in the Idle or Listener state e LISTEN ON when Digital488 80A is in the Listener state OFF when in the Idle or Talker state e SRO ON when Digital488 80A generated a service request OFF when no SRQ is pending e ERROR ON when an error has occurred OFF when no error condition exists e TE
6. Line 3 This command string would have the same effect as the command string sent in the line above where M1X plus M4X equals M5X 62 Digital488 80A Commands Digital488 80A User s Manual O Recall Configuration SYNTAX Load configuration val where val value from 0 to 100 Returns currently loaded configuration val DESCRIPTION The Recall Configuration O command is used to load a previously saved configuration from Non Volatile RAM and use it as the present configuration The argument of the command val may range from 0 to 100 Configuration 0 is the power up configuration Any load of a configuration not previously saved with the Save Configuration S command configures the channel with the default setting for each command i e Data Format FO Bus Terminator YO etc Issuing an O query command returns the configuration number last recalled EXAMPLE PRINT 1 CLEARO8 Line 1 Reset the Digital488 80A PRINT 1 OUTPUTO8 O05X Line 2 Load Configuration 5 from Non Volatile RAM for use as the present configuration Digital488 80A User s Manual Digital488 80A Commands 63 P Port Select Pn Select port s n for data VO wheren valuefromOtoS Default Select all 5 ports P Select Port 1 P2 Select Port 2 P3 Select Port 3 Select Port 4 Select Port 5 Returns current port s selection n DESCRIPTION The Port Select P command determines which port is selected for data input output In the default
7. NDAC Not Data Accepted Handshake Line 3 Acceptor None All None All I ve Got It Accept Accept Accept Accept Controlled by Listeners E IEEE 488 Bus Handshaking The IEEE 488 interface uses three handshake lines in an I m ready Here s the data I ve got it sequence This handshake protocol assures reliable data transfer at the rate determined by the slowest Listener One line is controlled by the Talker while the other two are shared by all Active Listeners The handshake lines like the other IEEE 488 lines are active low e Data Valid DAV The DAV line is controlled by the Talker The Talker verifies that NDAC is asserted active low which indicates that all Listeners have accepted the previous data byte transferred The Talker then outputs data on the bus and waits until NRFD is unasserted high which indicates that all addressed Listeners are ready to accept the information When NRFD and NDAC are in the proper state the Talker asserts DAV active low to indicate that the data on the bus is valid e Not Ready for Data NRFD The NRFD line is used by the Listeners to inform the Talker when they are ready to accept new data The Talker must wait for each Listener to unassert this line high which they will do at their own rate when they are ready for more data This assures that all devices that are to accept the information are ready to receive it e Not Data Accepted NDAC The NDAC line is also controlled by the Listener
8. Port 1 MSB Port 5 Bit 1 I O Port 5 LSB Co Ponzett V0 Pon2ise Port 2 Bit 8 I O Port 2 MSB Output only Port 4 Bit 1 I O Port 4 LSB I O Common Digital488 80A User s Manual Digital488 80A Setup 17 Using the HVCX1 Option for High Voltage Current Outputs CAUTION Never connect external high level devices to a Channel 0 port or to a Channel 1 port which has not first been configured for this purpose Failure to do so may result in damage to the Digital488 80A The HVCX1 option provides buffering for all the digital I O lines on the Digital488 80A This means that the HVCX1 option has 80 digital I O lines that are divided into two 40 bit channels Channel 0 and Channel 1 Each channel is divided into five eight bit ports Six high level ASCII commands configure the ports to be all inputs all outputs or combinations in between Thus a configuration can range from 80 input lines to 80 output lines or combinations in between in multiples of 8 bits Once the Channel port s are configured for high level operation they can be used to drive devices such as switching relays solenoids and displays For example a typical application may require a lamp and a relay to be driven by the Digital488 80A The relay is connected to data line 27 Port 4 and the lamp is connected to data line 37 Port 5 These two ports must be configured as high level outputs These devices would be connected as shown in the following figure Digital Grou
9. 83 84 Appendix A Rear Panel DB 50 Connector Pin Out Pin Description Pin Description i Pottery Ponaeit2 0 a Pontenaqoy Ponaens oy e Potters a Ponasi7 uo 7 Ponten7qoy Ponasrs oy 8 Pot ipitsio 33 Por spit 0 Ts onzo dS Pon 2 0 io Poazee2 ioy es Pot 53 wo _ rit Ponzmsw e Pon AIO 2 Ponzeeaqoy or Pons ets w0 is Ponzeesqoy Pons Ete wo ia Ponzo e Pot 5B 7 NO _ 15 enzz o Ponssen a cw mr enso dae oso 18 PotsBt2 00 43 Toerow 19 Pot3Bt3 wo a miwow f 20 Pot3Btawo 45 Service Input ny z Ponss ee eeren 22 Ponspitsvo a7 ouso J 23 Pot3Bt7 wo 48 HvoxtFiyback 24 Ponspita vo 4 veomma EE 0 woconmen Gn Digital488 80A User s Manual Appendix B B IEEE 488 Bus amp Serial Bus Lines 81 IEEE 488 Bus Commands 86 ASCII Codes 87 ASCII Code Summary 87 Decimal Values 00 to 63 ACG UCG amp LAG 87 Decimal Values 64 to 127 TAG amp SCG 88 ASCII Code Details 89 Decimal Values 00 to 31 ACG amp UCG Characteristics 89 Decimal Values 00 to 31 ACG amp UCG Descriptions 90 Decimal Values 32 to 63 LAG 91 Decimal Values 64 to 95 TAG 92 Decimal Values 96 to 127 SCG 93 IEEE 488 Bus amp Serial Bus Lines Bus State Bus Line Data Transfer DIO Lines 8 6 5 4 3 Bus Management Lines BusM
10. Kohms IEEE 488 CAUTION The IEEE 488 terminal must only be used to control a non isolated IEEE 488 system The common mode voltage cable shell to earth must be zero Terminal Installation Category Standard Not Applicable CE Category 1 Implementation SH1 AHI T4 TE8 L4 LE4 SR1 RLO PPO DC1 DT1 CO El Terminators Ignored on input Selectable CR LF LF CR or CR LF with or without EOI Programmable EEE Bus Terminators EOI Control SRQ Mask Port Data Active Levels Handshake Lines Format and Configuration Connector Standard IEEE 488 connector with metric studs General WARNING Service Fuse replacement and the changing of selected line voltage must be performed by qualified service personnel Never open the case while it is connected to the AC line Internal voltage potentials exist which could cause bodily injury or death Digital488 80A User s Manual Digital488 80A Overview 3 Terminal Installation Category Standard Not Applicable CE Category 2 for Line Voltage Input terminal All other terminals are Category 1 Dimensions 425 mm wide x 45 mm high x 203 mm deep 16 75 x 1 75 x 8 Weight 2 kg 4 5 Ibs Environment Standard Indoor use 0 to 50 C 0 to 95 RH non condensing CE Indoor use at altitudes below 2000 meters 0 to 40 C 0 to 80 RH up to 31 C decreasing linearly 4 RH C to 40 C Controls Power switch external line voltage selection switch internal a
11. P Lowercase Q Lowercase R Lowercase S Lowercase T Lowercase U Lowercase V Lowercase W Lowercase X Lowercase Y Lowercase Z Opening Brace Vertical Line Closing Brace Tilde Delete Command 00 Command 01 Command 02 Command 03 Command 04 Command 05 Command 06 Command 07 Command 08 Command 09 Command 10 Command 11 Command 12 Command 13 Command 14 Command 15 Command 16 Command 17 Command 18 Command 19 Command 20 Command 21 Command 22 Command 23 Command 24 Command 25 Command 26 Command 27 Command 28 Command 29 Command 30 Command 31 AppendixB 93 Notes 94 Appendix B Digital488 80A User s Manual Index command support 76 A command 47 abbreviations 98 accessories 2 addressing mode 1 7 ASCII codes 87 details 89 summary 87 B command 48 bench top 23 Bit Clear B command 48 Bit Set A command 47 buffer 2 Buffer L command 61 buffer overrun 80 bus address 7 34 bus command 32 36 86 bus command group 38 Bus Input Output G command 57 bus line 32 36 85 bus management line 36 bus terminator 34 Bus Terminator Y command 75 C command 49 CAUTION 3 4 20 21 22 24 25 47 48 49 50 52 55 57 61 66 67 79 Clear output line 30 command reference 46 command set 43 command summary 44 command support 43 command syntax 42 44 configuration 2 Configuration C command 49 control line 1 29 D
12. User s Manual Digital488 80A Commands 77 Notes 78 Digital488 80A Commands Digital488 80A User s Manual Troubleshooting T Radio Interference Problems 79 Electrostatic Discharge ESD Damage 79 Other Issues 79 Power Up Activation 19 Buffer Overrun 80 Query Error Status 80 Radio Interference Problems Digital488 80A hardware systems generate use and can radiate radio frequency energy and if not installed and not used correctly may cause harmful interference to radio communications However there is no guarantee that interference will not occur in a particular installation If this equipment does cause harmful interference to radio or television reception which can be determined by turning the equipment off and on you the user are encouraged to try to correct the interference by one or more of the following measures e Antenna Adjustment Reorient or relocate the receiving antenna e Spatial Separation Increase the separation between the equipment and receiver e Circuit Separation Connect the equipment to an outlet on a circuit different from that to which the receiver is connected Otherwise consult the dealer of an experienced radio television technician for help Electrostatic Discharge ESD Damage The discharge of static electricity can damage some electronic components Semiconductor devices are especially susceptible to ESD damage You should always handle components
13. Voltage Current Interface Option 2 Power Up amp Setup Configuration 2 Internal Buffer 2 Software Programmable Features 2 Accessories 2 Specifications 3 Digital I O 3 IEEE 488 3 General 3 Data Transfer Speeds 4 Introduction The Digital488 80A is a digital input and output interface to the IEEE 488 bus that enables an IEEE 488 controller to program 80 bits of TTL level signals as either inputs or outputs It includes six handshake control lines for each 40 bit channel and two addressing modes The unit is fully programmable including the power up configuration which is stored in non volatile RAM The internal data buffer in the Digital488 80A can store up to 2 000 40 byte words With the addition of the HVCX1 High Current High Voltage Interface option the I O lines can be configured as high voltage inputs or as high current high voltage outputs to allow interfacing with solenoids switching relays and other high voltage high current devices Addressing Modes Two addressing modes are available in the Digital488 80A Dual primary addressing permits two channels to reside at two consecutive primary IEEE 488 bus addresses Secondary addressing allows two channels to reside at the same primary IEEE 488 bus address with two consecutive secondary addresses When addressed to Talk the Digital488 80A outputs data from all forty bits of the selected channel or a selected eight bit
14. and power fuse must be changed to avoid damage to the unit The line voltage selection procedure is outlined in the following steps 20 _ Digital488 80A Power amp Assembly Digital488 80A User s Manual Note If disassembly or disconnections are necessary first turn off the power next disconnect the AC power line and then any other cables prior to disassembly To Select the Line Voltage 1 Turn off the power Next disconnect the AC power line cord and then all other test cables from the unit 2 Place the unit on a flat surface Remove the four screws on top of the case and remove the top cover 3 Located next to the main power supply transformer is the line voltage selection switch labelled S4 Using a small screwdriver insert the tip of the screwdriver into the slot of the switch and slide the switch to the left or right until it clicks into place with the desired line voltage selection visible Line Voltage Fuse Housing Power Power IEEE 488 Connector ON OFF Connector Switch Top View of Digital488 S0A Circuit Board CAUTION It is possible to place the line voltage switch S4 in a partial position which could cause equipment damage or malfunction When changing the position of the line voltage selection switch S4 make sure the switch is completely positioned to the 115 V or 220 V selection The switch will click into place when properly positioned 4 Install a power line fuse appropriate
15. cable is securely connected at both ends Otherwise there may be a problem with the fuse For more information see section Power Line amp Fuse Configuration earlier in this chapter For convenience you may want to program the Digital488 80A to power up with your configuration Refer to the Configuration C and Save Configuration S commands Input or output status is set using the Configuration C command To save the input output status as the new setting for the power up default it must be saved as part of the Recall Configuration 0 command To set the unit to a particular configuration upon power on the Save Configuration S command must be used once all the desired options have been selected 24 Digital488 80A Power amp Assembly Digital488 80A User s Manual Programming Examples The Digital488 80A programming examples use the Personal488 PC IEEE 488 controller interface and the BASIC Keyboard Controller KBC program This KBC program KYBDCTRL BAS is included on the disk and is listed below KYBDCTRL BAS Program 10 20 30 40 50 100 110 120 130 140 150 160 170 180 190 200 210 220 230 290 300 310 320 330 340 350 360 The Personal488 Keyboard Controller Program For use with the IOtech Personal488 IEEE 488 interface OPEN DEV IEEEOUT FOR OUTPUT AS 1 IOCTL 1 BREAK PRINT 1 RESET OPEN DEV IEEEIN FOR INPUT AS 2 I ON ERROR GOTO 300 PRINT 1 ERROR OFF LINE I
16. firmware operating system and also drives the front panel LED indicators The digital I O ports are controlled through 6821 interface chips U7 U8 U9 U10 U11 U16 High voltage high current output capability is provided on both channels if the HVCX1 option is used Power is supplied by an on board transformer and full wave rectifier Regulation to the required 5 volts is provided by an 78TOSCT U15 The memory space allocation on the Digital488 80A is C mares Device Part Number Function Ure u4 Factory Service Chapter 7 Troubleshooting provides a troubleshooting reference for possible solutions to technical problems Before calling for technical assistance refer to this chapter However if problems in using the Digital488 80A still persist you should contact the factory Many problems can be resolved by discussing the problems with the appropriate applications department If the problem cannot be solved by this method you will be instructed as to the proper return procedure Digital488 80A User s Manual Digital488 80A Power amp Assembly 19 Power Line amp Fuse Configuration The power configuration of the Digital488 80A unit consists of selecting the line voltage and replacing the fuses Each Digital488 80A unit has a factory default to operate at 105 125 volts AC However each unit may be operated at either 105 125 or 210 250 VAC WARNING Do not use the Digital488 80A unit outdoors The unit is inten
17. is expected ina PORT5 PORT4 PORT3 PORT2 PORT1 sequence If only 2 bytes are received with EOI asserted on the second byte then the Digital488 80A updates PORT5 with the first byte received PORT4 with the second byte received and pulses the Data Strobe Since all received characters are treated as data no commands are recognized To place the Digital488 80A in format F5 the 3 character string F5X should be the last command sent to the interface without terminators Any characters appended to this command such as the carriage return CR or line feed LF are considered data and the output ports reflects those character values When the Digital488 80A is addressed to Talk in Data Ready R mode RO it asserts Inhibit reads the data from all 5 ports unasserts Inhibit and outputs the binary data to the bus with EOI asserted on the fifth byte When the last data byte is transferred the data is read again in anticipation of another data transfer If Inhibit is used to sequence external hardware this line pulses N 7 times where N is the number of total 5 byte data transfers In this format the Digital488 80A does not have to be readdressed to Talk to read the ports multiple times EDR cannot be used to capture data in this data format The only programmable method to exit Data Format F5 is Device Clear DCL or Selected Device Clear SDC When either channel or both channels are in format F5 a DCL or an SDC to either channel clears format F
18. mode PO all 5 ports are selected Modes P1 through P5 select a specific 8 bit port It is recommended that the Bus Input Output G command be used with mode PO to select which type of port data input or output is sent when the Digital488 80A is addressed to Talk Data in modes P1 through P5 are input or output in groups of 8 bits EXAMPLE PRINT 1 CLEARO8 Line 1 Reset the Digital488 80A PRINT 1 OUTPUTO8 P4X Line 2 Select Port 4 64 Digital488 80A Commands Digital488 80A User s Manual Q Inhibit Qn Define mode n of Inhibit output line where n 0 or 1 Q0 Clear the Inhibit line return to unasserted state Set the Inhibiti line place in the asserted state Returns current Inhibit output line mode n DESCRIPTION The Inhibit Q command allows software control of the Inhibit output line independent of any other I O activities To change the active state of the Inhibit line the Invert I command is used EXAMPLE PRINT 1 CLEARO8 Line 1 Reset the Digital488 80A PRINT 1 OUTPUTO8 Q1X Line 2 Set the Inhibit line on Channel 0 Digital488 80A User s Manual Digital488 80A Commands 65 R Data Ready Define mode n of digital input port data to be latched where n O 1 or 2 Default Define data to be not latched and to be read whenever the Digital488 80A is addressd RI z SYNTAX DESCRIPTION The Data Ready R command enables digital input port data to be latched When us
19. multiple bits are to be cleared within the same command string then an Execute X command must follow every Bit Clear B command To be valid the bit being cleared must have been configured as an output bit by the Configuration C command The Data Strobe output line is not pulsed when the Bit Clear B command is sent CAUTION Because the Configuration C command is used the following programming example s will not work properly if the HVCX1 option is installed with a conflicting hardware configuration To be safe remove the HVCX1 board and replace it with the jumper board to run the example s EXAMPLE PRINT 1 CLEARO8 i Reset the Digital488 80A PRINT 1 OUTPUT08 C5POX i Configure all 5 ports as output select all 5 ports PRINT 1 OUTPUT08 A7X A8X A9X i Set Bits 7 8 9 to a logic 1 5 volts PRINT 1 OUTPUTO8 B7X i Clear Bit 7 to a logic O 0 volts PRINT 1 OUTPUT08 B8X B9X i Clear Bits 8 and 9 to a logic O 0 volts 48 Digital488 80A Commands Digital488 80A User s Manual C Configuration C Default Define all 5 ports as input c z c3 c4 c Returns current port configuration moden Returns current port configuration mode n DESCRIPTION Ports 1 through 5 are configured as inputs or outputs with the Configuration C command Each port is 8 bits wide At power up all ports are initialized as inputs the Configuration command is usually the first comm
20. the Service Request SRQ conditions where 00 lt mask lt 31 as summed from the following states 0 Default SRQ is disabled 1 SRQ on Service input transition 2 SRQ on EDR input transition 4 SRQ on IEEE 488 bus error 16 SRQ on Ready The Service Request Mask commands are ORed together as received To delete any one command it is necessary to program the default mode MO then reprogram the desired commands DESCRIPTION The Service Request Mask M command is used by the Digital488 80A to alert the controller to one of several conditions described below Multiple Service Request SRQ conditions can be enabled simultaneously by issuing them separately or by combining them in one command string If multiple Service Request Mask commands are contained within the same command string each command must be followed by an Execute X command An alternative is to add up the values of each Service Request Mask command desired and send a single command with the sum of the desired commands The Service Request Mask commands are ORed together as received To delete any one command it is necessary to program the default mode MO then reprogram the desired commands The programmed SRQ modes will remain enabled until the MO command is sent or the controller sends a Device Clear DCL or Selected Device Clear SDC Default mode MO disables the SRQ function preventing the Digital488 80A from generating a Service Request Mode M
21. to capture data in this data format Data Format F1 ASCII Character In Data Format F1 the data are coded and transmitted in ASCII characters with the 4 least significant bits of each ASCII character representing 4 bits of data ASCII Character Decimal Equivalent ASCII Character Decimal Equivalent ue a oss ery o equals 13 sh S SE e A Ee G a Digital488 80A User s Manual Digital488 80A Commands 53 Data received for output to the digital ports must be contained within a D command prefix and a Z terminator suffix If the amount of data sent is less than the number of bits programmed as outputs then the least significant bits contain the data sent and the most significant bits are cleared to logic 0 If the data sent is greater than the number of bits programmed for output or selected by the Port Select P command then the Digital488 80A generates a Conflict Error E3 and ignores the entire command string up to the next Execute X command The Data Strobe output is pulsed for approximately 50 microseconds after new data is output on the selected port s When the Digital488 80A is addressed to Talk in Data Ready R mode RO it asserts Inhibit reads the data from all 5 ports unasserts Inhibit and outputs the number of characters determined by the Bus Input Output G and Port Select P commands Leading zeros are not suppressed and the bus terminators are appended to the output After output the Digital488 80A must be
22. 1 enables the Digital488 80A to generate a Service Request when the Service input line makes a transition Refer to the Invert I command for programming the polarity of the Service input line Mode M2 enables the Digital488 80A to generate a Service Request when the EDR input makes a transition Refer to the Invert I command for programming the polarity of the EDR input line Mode M4 enables the Digital488 80A to generate a Service Request when a bus error occurs The most common bus error is sending an invalid command to the Digital488 80A For example when mode M4 is selected selecting Data Format F6 which does not exist causes the Digital488 80A to generate a Service Request Mode M16 enables the Digital488 80A to generate a Service Request when it has completed the execution of a set of commands from the bus controller This may be used by the controller to assure the completion of a set of commands before sending a subsequent set of commands EXAMPLE 1 Invalid Command PRINT 1 CLEARO8 Line 1 Reset the Digital488 80A PRINT 1 OUTPUTO8 M4X Line 2 Select SRQ on bus error PRINT 1 OUTPUTO8 W7X Line 3 Send an invalid command no W command exists Note ERROR and SRQ LED indicators should illuminate EXAMPLE 2 Alternative command strings PRINT 1 CLEARO8 Line 1 Reset the Digital488 80A PRINT 1 OUTPUTO8 M1X M4X Line 2 Select SRQ on bus error and SRQ on Service input transition PRINT 1 OUTPUTO8 M5X
23. 45 Command _____ Data Ready e Define mode n of digital input port data to be latched where n 0 1 or2 Default Define data to be not latched and to be read whenever the Digital488 80A is addressd Define data to be latched on an EDR transition Define data to be latched and buffered on an EDR transition Returns current Data Ready mode n EDR cannot be used to capture data in the F5 high speed binary format Save Configuration Sval Save current configuration as configuration val where Ss val value from 0 to 100 loaded configuration Define mode n to test Digital488 80A communication where n Oorl Turn off the TEST LED indicator on Digital488 80A front panel Turn on the TEST LED indicator on Digital488 80A front panel U Uval Define status message val to send when the Digital488 80A is next addressed to Talk where val O orbit and where ol bit bit value from 1 to 40 After the U0 status string is read by the controller any error _ a V View Configuration Vval View but not load configuration val where val value View Version v View the current firmware revision level of the ROM Lee V command is not related to the above View Configuration V command Execute X Execute the command string Bus Terminator Yn Define mode n of IEEE 488 bus terminator where n 0 1 2 o0r3 To save a bus terminator as the new default setting use the Save Configuration S command S0 Query
24. 488 80A PRINT 1 OUTPUT08 1I32X I64X Line 2 Select the EDR and Service input lines as falling edge sensitive EXAMPLE 2 PRINT 1 CLEARO8 Line 1 Reset the Digital488 80A PRINT 1 OUTPUTO8 I96X Line 2 Performs the same function as the Invert command string in Example 1 Digital488 80A User s Manual Digital488 80A Commands 59 K End Or Identify Kn Define mode n of EOI wheren Oorl KO Default EOI enabled assert EOT on last byte transferred EOI disabled do not assert EOI on last byte transferred Returns the current EOT selection DESCRIPTION The End Or Identify EOT line is one of five bus management lines on the IEEE 488 bus It is used by a Talker to indicate the end of a multiple byte transfer sequence Using the End Or Identify K command the controller can enable or disable the EOI mode by programming the Digital488 80A from the bus In mode KO the EOT line is asserted by the Digital488 80A on the last byte of every bus output string In mode K1 the EOT function is disabled except when using the binary Data Formats F4 and F5 EXAMPLE PRINT 1 OUTPUTO8 K1X Line 1 Disable EOT assertion on last byte PRINT 1 OUTPUTO8 K Line 2 Request EOT selection from Digital488 80A PRINT 1 ENTERO8 INPUT 2 AS PRINT AS Line 5 Display shows K1 60 Digital488 80A Commands Digital488 80A User s Manual L Buffer SYNTAX In Clear the internal data buffer where n 0 only L Return
25. 5 by enabling the command interpreter and changing the format to FO default ASCII hexadecimal A DCL or an SDC does not reset the Digital488 80A it only takes the unit out of format F5 and places it into format FO All other parameters remain unchanged In addition the Clear output line is not pulsed by DCL or SDC when the Digital488 80A is in format F5 CAUTION Because the Configuration C command is used the following programming example s will not work properly if the HVCX1 option is installed with a conflicting hardware configuration To be safe remove the HVCX1 board and replace it with the jumper board to run the example s EXAMPLE 1 Data Format FO ASCII Hexadecimal See next page Digital488 80A User s Manual Digital488 80A Commands 55 EXAMPLE 1 Data Format FO ASCII Hexadecimal PRINT 1 CLEARO8 PRINT 1 OUTPUT08 ROPOC2G2X PRINT 1 OUTPUTO8 FOX PRINT 1 OUTPUTO8 D4E6BZX PRINT 1 ENTERO8 INPUT 2 A PRINT AS Reset the Digital488 80A Configure Ports 1 and 2 as output Select ASCII hexadecimal format Output ASCII hexadecimal data 4E6B to Ports 1 and 2 Read data from the Digital488 80A Display shows 4E6B EXAMPLE 2 Data Format F1 ASCII Character PRINT 1 CLEARO8 PRINT 1 OUTPUTO8 C5G2ROPOX PRINT 1 OUTPUTO8 F1X PRINT 1 OUTPUT08 D4 gt 6ZX PRINT 1 ENTERO8 INPUT 2 A PRINT AS PRINT 1 OUTPUT08 D1 2ZxX PRINT 1 ENTERO8 INPUT 2 A PRINT AS PR
26. A main board Line up the J2 DIN 96 on the HVCX1 board with the J1 DIN 96 on the Digital488 80A main board Front J1 DIN 96 Connectors _ _ HVCX1 Board face down DIN 96 Connectors Digital488 80A Main Board J4 i he ie ae A HVCX1 Board Installation 7 Press down the HVCX1 board gently but firmly to plug together the DIN 96 connectors Be careful not to bend any DIN 96 connector pins 8 Carefully reassemble the unit Note For re assembly first reconnect the AC power line and then any other cables prior to reapplying power to the entire system 16 Digital488 80A Setup Digital488 80A User s Manual Digital I O Ports CAUTION When the HVCX1 option is used the I O lines are hardware configured as either inputs or outputs The hardware and software configurations for the input and output ports must agree The Digital488 80A unit is protected from configuration conflict but the I O lines will not respond properly The Digital488 80A has two DB 50 connectors Channel 0 and Channel 1 each of which provides 40 data lines programmable in groups of 8 bits as either input or output ports The following figure illustrates one of the digital I O DB 50 connectors as viewed from the rear panel of the Digital488 80A Both Channel 0 and Channel 1 DB 50 connectors are identical Rear Panel DB 50 Connector Pin Out Pin Description Comment Pin Description Comment ES Port 1 Bit 8 I O
27. B 87 Decimal Values 64 to 127 TAG amp SCG Box Items Hexadecimal Value 41 65 Decimal Value A Bus Message 01 in center ASCII Character Talk Address Group TAG 40 64 41 42 66 43 67 44 68 45 69 46 70 47 71 we et ek et ht et 00 02 03 06 07 48 72 4A 74 4B 75 6 4E 78 4F 79 H J K N O 08 10 11 14 15 50 80 52 82 53 83 4 56 86 57 87 P R S V W 16 18 19 22 23 58 88 5A 9 91 2 5E 94 5F 95 X Z 7 24 6 7 30 UNT 1 103 f g 06 07 6E 1 n 14 76 1 V 2 7E 12 30 9 D E 04 05 4C 76 4D 77 L M 12 13 54 84 55 85 T U 20 21 5C 92 5D 93 28 29 Secondary Command Group SCG 60 96 61 62 98 63 99 64 100 65 1 66 02 67 00 6F 111 O 15 77 119 Ww 23 2 7F 127 DEL 2 2 2 2 2 31 0 8 6 4 01 09 10 17 18 2 25 6 65 A 01 49 13 I 09 51 81 Q 17 59 89 0 5B Y 25 2 2 97 a 01 69 105 i 09 71 113 q 17 79 121 Y 5 8 9 b C d e 02 03 04 05 6A 106 6B 107 6C 108 6D 1 j k 1 m 10 11 12 13 72 1141 73 115 74 116 75 1 r S t u 18 19 20 21 7A 122 7B 123 7C 124 7D 1 z 6 7 8 9 68 104 08 70 112 16 78 120 x 24 88 Appendix B Digital488 80A User s Manual ASCII Code Details Decimal Values 00 to 31 ACG amp UCG Characteristics Dec Hex Character amp Bue MESSAGE Value Value Abbreviation g Addressed Command Group ACG Note Digital488 80A
28. CO CO O oiei oO OIL OL OI OI PIOIL OI HILO IRIO LRIO FPiPPO MIPIERIOINIERLO LO MiMiPigmio eiei Qie BAR OO OONA Mio AM io ikio Mo Or heihi Vaga oaao FPiPiO KR CO CO OB oh TK RO HO PiPIPID olRPiolaipin Zinpipipipipn 86 Appendix B Digital488 80A User s Manual ASCII Codes ASCII Code Summary Decimal Values 00 to 63 ACG UCG amp LAG Box Items Hexadecimal Value 41 65 Decimal Value A Bus Message 01 in center ASCII Character Addressed Command Group ACG 00 00 01 02 02 03 03 04 04 05 05 06 07 07 NUL STX ETX EOT ENQ AC BEL a ld a 08 08 09 0A 10 0B 11 0C 12 0D 13 0E 0F 15 BS LF VT FF CR S SI i e a S Universal Command Group UCG Listen Address Group LAG 20 32 21 22 34 23 35 24 36 25 37 26 a Ca a E let let 00 02 03 04 06 28 40 2A 42 2B 43 2C 44 2E j e 08 0 10 11 12 14 30 48 32 50 33 51 34 52 36 0 2 3 4 6 es De a es 38 56 3 3A 58 3B 59 3C 60 3E 8 A lt gt waa va Le e be he be 7 05 2D 45 35 53 5 3D 61 29 01 06 K G 9 14 17 18 19 22 C2 C3 L 18 24 19 5 1A 26 1B 27 1C 1D 1E 30 1F 31 CAN SUB ESC F G R US SPE S 3 38 0 2 1 46 9 54 1 57 62 SOH TL 0 HT O CT 10 16 11 12 13 14 20 15 21 16 17 23 DLE DC1 D D DC4 NAK YN ETB LO DCL PPU 2 28 29 EM S S S PD 3 l 1 9 4 9 31 4 1 7 9 9 5 Digital488 80A User s Manual Appendix
29. Commands are interpreted and processed as they are received but are not executed until the Execute X command is issued The exceptions to this rule are commands issued with the Query parameter which do not need to be followed by the Execute X command This command enable EOI will be executed immediately upon receipt of the X The command will be interpreted but not executed Upon receipt of the X the End Or Identify EOI command will be executed e ASCII data formats Fo through F3 specified to be output are preceded by the Data D command character and followed by the Z suffix The ASCII data output specified is 55 e Commands may be entered in upper or lower case These 2 commands are interpreted the same way e Spaces between commands and parameters are ignored This is interpreted the same way as F 5 S100xX This is interpreted the sameas S 1 0 0 X e Commands may be sent individually or in a string with other commands PRINT 1 OUTPUTO8 COX These three lines of a program would have the same effect as PRINT 1 OUTPUTO8 P1X the single line below PRINT 1 OUTPUT08 S2xX PRINT 1 OUTPUT08 CO P1 S2 x e Due to the structure of the command interpreter each command may be issued only once within a string However the same command may be issued more than once in a string if each usage of the command is followed by the Execute x command PRINT H1 On Channel 0 you can save Port 3 as Config
30. Digital488 80A User s Manual 80 Bit IEEE 488 Digital I O Interface g s L the smart approach to instrumentation IOtech Inc 25971 Cannon Road Cleveland OH 44146 1833 Phone 440 439 4091 Fax 440 439 4093 E mail sales iotech com Internet www iotech com Digital488 80A User s Manual 80 Bit IEEE 488 Digital I O Interface p n 196 0901 Rev 1 0 Released Per EO 1587R2 1998 by lOtech Inc June 1998 Printed in the United States of America Warranty Your Otech warranty is as stated on the product warranty card You may contact IOtech by phone fax machine or e mail in regard to warranty related issues Phone 440 439 4091 fax 440 439 4093 email sales iotech com Limitation of Liability IOtech Inc cannot be held liable for any damages resulting from the use or misuse of this product Copyright Trademark and Licensing Notice All IOtech documentation software and hardware are copyright with all rights reserved No part of this product may be copied reproduced or transmitted by any mechanical photographic electronic or other method without Otech s prior written consent IOtech product names are trademarked other product names as applicable are trademarks of their respective holders All supplied IOtech software including miscellaneous support files drivers and sample programs may only be used on one installation You may make archival backup copies FCC Statement IOtech dev
31. Digital488 80A User s Manual To Set Up Handshaking Input Lines To Front of Digital488 80A Unit CH1 CONTROL CHO CONTROL _ 5 Ld CH1 mr CHO JP1 m0 Sog JP2 mo Fc svpbc UH VDC VDC CH1 PORT 5 CHO PORT 5 2596 INPUT J DIP Pack DIP Pack INPUT 2596 2596 OUTPUT CHO CH1 PORT 4 EDR SERVICE CHO PORT 4 2596 INPUT J DIP Pack DIP R Pack DIP Pack INPUT 2596 CH1 CH1 PORT 3 EDR SERVICE CHO PORT 3 2596 INPUT J DIP Pack DIP R Pack DIP Pack INPUT 2596 Se CH1 PORT 2 CHO PORT 2 2596 INPUT J DIP Pack DIP Pack INPUT 2596 OUTPUT ae E m SIP Pack ooo J2 O DIN 96 Connector a CH1 PORT 1 CHO PORT 1 2596 2596 INPUT J DIP Pack DIP Pack INPUT 2596 el QUTPUT OUTPUT m SIP Pack m SIP Pack OUTPUT OUTPUT To Rear of Digital488 80A Unit HVCX1 High Voltage Current Interface Option Handshaking Input Lines Section Highlighted Note All of the components mentioned below are for the central section of the HVCX1 board labelled EDR SERVICE 1 Locate the center of the HVCX1 board labelled CHO EDR SERVICE and CH1 EDR SERVICE 2 Install the DIP dual in line pack for the input handshaking voltage desired See the chart below for the DIP pack labeling The notched end of the DIP pack must be to the left see above figure for the proper orientation inpats O DIP Resistor Values Label of DIP Pack Supplied with HVCX1 Option 4116R 001 100 0 12 V 20K ohms 4116R 001 203 0 24 V 56K o
32. Digital488 80A to turn off its TEST LED indicator The TEST LED indicator should turn off e Line 4 Reset the Digital488 80A e Line 5 Retrieve the Channel 0 status IEEE 488 bus address 08 e Line 6 The status message shows that all default options are in use e Line 7 Retrieve the Channel 1 status IEEE 488 bus address 09 e Line 8 The status message shows that all default options are in use e Line 9 Retrieve the status of the port configuration mode for Channel 0 e Line 10 The status message shows that the default port configuration CO is in use e Line 11 Program all the Channel 0 Ports as outputs e Line 12 Retrieve the status of the port configuration mode for Channel 0 e Line 13 The status message shows that the Configuration C command C5 was executed e Line 14 Retrieve the status of the port configuration mode for Channel 1 e Line 15 The status message shows that the default port configuration CO is in use e Line 16 Program the Digital488 80A Channel 0 to send output data when addressed to Talk e Line 17 Send the data 123 to Channel 0 e Line 18 Read the data from Channel 0 The message shows the data 123 e Line 19 Program the Digital488 80A to set Bit 37 on Channel 0 e Line 20 Read the data from Channel 0 The message shows that Bit 37 is set and also the previous data 123 The above examples may also be repeated using Secondary addressing mode To do this turn off the Digital488 80A and set t
33. INT 1 CLEARO8 PRINT 1 OUTPUTO8 C5G2ROP1X PRINT 1 OUTPUTO8 F2X PRINT 1 OUTPUT0O8 D1 10112ZX PRINT 1 ENTERO8 INPUT 2 A PRINT AS Line 1 Line 2 Line 3 Line 4 Line 6 Line 7 Line 8 Reset the Digital488 80A Configure all 5 ports as output select all 5 ports Select ASCII character format Send ASCII character data 4 gt 6 to the Digital488 80A Read data from the Digital488 80A Display shows 00000004 gt 6 Send ASCII character data 1 2 to the Digital488 80A Line 10 Read data from the Digital488 80A Line 11 Display shows 0000001 2 EXAMPLE 3 Data Format F2 ASCII Binary Reset the Digital488 80A Configure all 5 ports as output select Port 1 only Select ASCII binary format Send ASCII binary data 1 1011 to the Digital488 80A Read data from the Digital488 80A Display shows 0001 1011 EXAMPLE 4 Data Format F3 ASCII Decimal PRINT 1 CLEARO8 PRINT 1 OUTPUTO8 C5G2ROPOX PRINT 1 OUTPUTO8 F3X PRINT 1 OUTPUT08 D240 165ZxX PRINT 1 ENTERO8 INPUT 2 A PRINT AS Reset the Digital488 80A Configure all 5 ports as output select all 5 ports Select ASCII decimal format Send ASCII decimal data to the Digital488 80A Read data from the Digital488 80A Display shows 000 000 000 240 165 EXAMPLE 5 Data Format F5 High Speed Binary PRINT 1 OUTPUTO8 3F5X PRINT 1 CHRS 255 CHRS 125 Line 1 Note Line 2 Select high speed binary for
34. LASHING FLASHING FLASHING FLASHING ON NV RAM Checksum Error Off Off Off ON Off ON No Power Off Off Off Off Off With the power cord plugged in and connected to the Digital488 80A turn on the unit by depressing the rear panel power switch All of the front panel LED indicators should light up for approximately one second while the Digital488 80A performs an internal ROM and RAM self check At the end of this self check all of the LED indicators should turn off except for POWER Otherwise the Digital488 80A may be in an error condition according to the one of the four following LED patterns e Ifallofthe LED indicators remain on Then a ROM error has occurred e Ifthe POWER LED indicator remains on while the rest of the LED indicators flash continuously Then a RAM error has occurred Try cycling the power to the Digital488 80A to determine that the error is repeatable e Ifthe POWER and ERROR LED indicator remain on while the rest of the LED indicators are off Then a checksum error on Non Volatile RAM occurred and the saved configurations may be lost The checksum error condition may be cleared by doing a save of a configuration using the Save Configuration S command Note The error condition cannot be cleared by using the Query Error Status E command o Ifallofthe LED indicators are off Then there may not be any power being supplied to the Digital488 80A In this event check to make sure that the AC power
35. NPUT CMD gt CMD PRINT 1 CMD I IF IOCTL 2 lt gt 1 THEN 180 PRINT INPUTS 1 2 GOTO 210 Error Handler I IOCTL 1 BREAK PRINTH 1 STATUS INPUT 2 ST PRINT CHRS 7 Error MID ST 15 2 MID ST 27 RESUME NEXT Keyboard Controller KBC program allows direct communication with the Digital488 80A or any IEEE 488 device on the bus via the keyboard and displays any responses on the screen This program is a convenient method of exercising the Digital488 80A and becoming familiar with the commands and their actions To Run the Keyboard Controller Program CAUTION This programming example will not work properly if the HVCX1 option is installed Remove the HVCX1 board and replace it with the jumper board to run this example First verify that the rear panel DIP switch S1 is set for Dual Primary addressing mode factory default and for IEEE 488 bus primary address 8 factory default Connect an IEEE 488 cable from the IEEE 488 connector on the Digital488 80A to the IEEE 488 connector on the Personal488 PC IEEE 488 controller interface card Turn on the Digital488 80A by depressing the rear panel power switch All of the front panel LED indicators should light up for approximately one second while the Digital488 80A performs an internal ROM and RAM self check At the end of this self check all of the LED indicators should turn off except for POWER From the MS DOS prompt on your computer scre
36. PRINT A Line 6 Display shows 55 PRINT 1 OUTPUTO8 POX Line 7 Select all 5 ports PRINT 1 OUTPUT08 D1234567890ZX Line 8 Send data to all 40 data lines 4 bits per character PRINT 1 ENTERO8 INPUT 2 A Line 10 Read data from the Digital488 80A PRINT A Line 11 Display shows 1234567890 EXAMPLE 2 PRINT 1 CLEARO8 Line 1 Reset the Digital488 80A PRINT 1 OUTPUTO8 CSP1G2ROX Line 2 Configure all 5 ports as output select Port 1 only PRINT 1 OUTPUTO8 D123ZX Line 3 Send 12 bits of data to the least significant bits 4 bits per character PRINT 1 ENTERO8 INPUT 2 AS Line 5 Read data from the Digital488 80A PRINT A Line 6 Display shows 0000000123 PRINT 1 OUTPUTO8 P5D21ZxX Line 7 Select Port 5 only send data 21 to Port 5 PRINT 1 OUTPUTO8 POX Line 8 Select all 5 ports PRINT 1 ENTERO8 INPUT 2 AS Line 10 Read data from the Digital488 80A PRINT A Line 11 Display shows 2100000123 50 Digital488 80A Commands Digital488 80A User s Manual E i sz BP_ Query Error Status Error Status SYNTAX Returns error status code which indicates the last error encountered It returns EO if No Error has occurred E1 if Unrecognized Command E2 if Invalid Command Parameter E3 if Command Conflict Error E5 if Non Volatile RAM Checksum Failure E6 if Internal Data Buffer Overrun ss Note eat for E5 error is cleared upon reading error status DESCRIPTION The Q
37. Pack DIP Pack INPUT 2596 fe CH1 PORT 2 CHO PORT 2 2596 INPUT J DIP Pack DIP Pack INPUT 2596 OUTPUT O o y m SIP Pack ae J2 O DIN 96 Connector ia CH1 PORT 1 CHO PORT 1 2596 2596 INPUT J DIP Pack DIP Pack INPUT 2596 QUTPUT OUTPUT m SIP Pack m SIP Pack OUTPUT OUTPUT To Rear of Digital488 80A Unit HVCX1 High Voltage Current Interface Option Input Ports Section Highlighted Note All of the components mentioned below are for the port section of the HVCX1 board labelled INPUT 1 Locate the two 5 port sections one in the right half one in the left half of the HVCX1 board labelled INPUT 2 Place the 2596 IC chip into the IC input socket of the port being configured The notched end of the IC must be to the left see above figure for the proper orientation 3 Install the DIP dual in line pack for the voltage desired See the chart below for the DIP pack labeling The notched end of the DIP pack must be to the left see above figure for the proper orientation Inputs O DIP Resistor Values Label of DIP Pack Supplied with HVCX1 Option 4116R 001 100 0 12 V 20K ohms 4116R 001 203 0 24 V 56K ohms 4116R 001 563 0 48 V 120K ohms 4116R 001 124 4 Verify that no components the 2596 and SIP pack are in the OUTPUT section of a port being configured as an input Having components for the output and input installed in the same port will cause damage to the unit 12 Digital488 80A Setup
38. Pay special attention to cautions and warnings formatted like this one Digital488 80A User s Manual i Table of Contents 1 Digital488 80A Overview Introduction 1 Addressing Modes 1 Digital I O Lines 1 Handshaking Control Lines 1 HVCX1 High Voltage Current Interface Option 2 Power Up amp Setup Configuration 2 Internal Buffer 2 Software Programmable Features 2 Accessories 2 Specifications 3 Digital I O 3 IEEE 488 3 General 3 Data Transfer Speeds 4 2 Digital488 80A Setup The Package 5 Hardware Setup 6 Front amp Rear Panel Layouts 6 Default DIP Switch Settings 7 IEEE 488 Bus Address Selection T Addressing Mode Selection 7 Dual Primary Addressing Mode 8 Secondary Addressing Mode 8 HVCX1 Option Setup 10 Determining Ports Setup 11 To Set Up Input Ports 12 To Set Up Handshaking Input Lines 13 To Set Up Output Ports 14 To Set Up Handshaking Output Lines 14 To Install the HVCX1 Option 16 Digital I O Ports 17 Using the HVCX1 Option for High Voltage Current Options 18 3 Digital488 80A Power amp Assembly Introduction 19 Internal Components 19 Factory Service 19 Power Line amp Fuse Configuration 20 Line Voltage Selection 20 To Select the Line Voltage 21 Fuse Rep
39. ROM error has occurred o Ifthe POWER LED indicator remains on while the rest of the LED indicators flash continuously Then a RAM error has occurred Try cycling the power to the Digital488 80A to determine that the error is repeatable e Ifthe POWER and ERROR LED indicator remain on while the rest of the LED indicators are off Then a checksum error on Non Volatile RAM occurred and the saved configurations may be lost The checksum error condition may be cleared by doing a save of a configuration using the Save Configuration S command Note The error condition cannot be cleared by using the Query Error Status E command o 6 Ifall of the LED indicators are off Then there may not be any power being supplied to the Digital488 80A In this event check to make sure that the AC power cable is securely connected at both ends Otherwise there may be a problem with the fuse For more information see section Power Line amp Fuse Configuration in Chapter 3 Buffer Overrun In Data Ready R mode R1 the Digital488 80A waits for an EDR transition on the selected channel before latching the data and formatting it for output If the EDR line has changed state prior to being addressed to Talk the data read at the time of EDR is buffered for output when next addressed to Talk If EDR changes again before the previous EDR buffered data has been output the Digital488 80A generates an Internal Data Buffer Overrun E6 error and ignores the EDR read r
40. S Line 5 Read data from the Digital488 80A input ports PRINT AS Line 6 Display shows FFFFFFFF Data is dependent upon what is connected Digital488 80A User s Manual Digital488 80A Commands 57 H Handshake mn Define handshake line n to be pulsed wheren 0 Lor 7 Returns the last Handshake command executed DESCRIPTION The Handshake H command enables software control of three handshaking control lines Clear Data Strobe and Trigger independent of any other I O operations When the Digital488 80A receives a Handshake command the respective handshaking control line is pulsed for approximately 50 microseconds The line returns to its steady state condition after pulsing The Invert 1 command may be used to change the active state of any of these handshaking control lines For information on the Inhibit output line refer to the Inhibit Q command For information on the Service input line refer to the Service Request Mask M command For information on the External Data Ready EDR input line refer to the Data Ready R command The Invert I command may be used to change the active state of any of these handshaking control lines as well EXAMPLE PRINT 1 OUTPUT08 H1X Line 1 Pulse the Data Strobe line on Digital488 80A Channel 0 58 Digital488 80A Commands Digital488 80A User s Manual I Ee overt SYNTAX Ival Define the polarity of the handshake and data lines where 000 lt val lt 127 as
41. ST ON when used in conjunction with the Test T command to verify that communication has been established with the Digital488 80A e POWER ON when power is being applied while the power switch is in the ON position OFF when power is not present IEEE 488 Saar R r I amp i CHANNEL 0 CHANNEL 1 Power Power IEEE 488 DIP Switch Digital I O Channels 0 amp 1 Connector Switch Connector S1 DB50 Connectors Digital488 80A Rear Panel Layout 6 Digital488 80A Setup Digital488 80A User s Manual Default DIP Switch Settings The Digital488 80A unit may be operated from either 110 VAC or 220 124 816x YDIS VAC The operating voltage is set by an internal switch The factory set operating voltage appears on the label placed over the power jack on the rear panel To change the operating voltage see section Line Voltage Selection in Chapter 3 Digital488 80A Power amp Assembly The Digital488 80A unit has one 8 microswitch DIP switch S1 IEEE Used only in accessible from the rear panel This DIP switch determines the IEEE Address Secondary 488 bus address and its addressing mode The switch is read only when 8 Address Mode the unit is powered on and should be set prior to applying power The Dual Primary Addressing Mode figure illustrates the factory default for the DIP microswitch settings IEEE 488 bus address 8 and Addressing Mode Dual Primary In the Dual Primary addressing mode DIP micr
42. The Package 5 Hardware Setup 6 Front amp Rear Panel Layouts 6 Default DIP Switch Settings 7 IEEE 488 Bus Address Selection 7 Addressing Mode Selection T Dual Primary Addressing Mode 8 Secondary Addressing Mode 8 HVCX1 Option Setup 10 Determining Ports Setup 11 To Set Up Input Ports 12 To Set Up Handshaking Input Lines 13 To Set Up Output Ports 14 To Set Up Handshaking Output Lines 14 To Install the HVCX1 Option 16 Digital I O Ports 17 The Package Using the HVCX1 Option for High Voltage Current Options 18 All Digital488 80A components are carefully inspected prior to shipment When you receive your IEEE 488 digital I O interface carefully unpack all items from the shipping carton and check for any damage which may have occurred during shipment Promptly report the damage to the shipping agent and your sales representative Retain all shipping materials in case you must return the unit to the factory Every Digital488 80A package includes the following items listed by part number e 6 Digital488 80A 80 Bit IEEE 488 Digital I O Interface e 196 0901 Digital488 S0A User s Manual e PR 2 Warranty Card e 196 0800 Accessories Kit for Digital488 80A which includes the following CA 1 Power Cable HA 41 6 Rack Screws 4 FE 1 Rubber Feet 4 EN 6 Rack Ears 2 FU 1 25 1 4A Replacement Fuse FU 1 125
43. User s Manual None NUL A SOH B STX C ETX EOT ENQ ACK BEL BS HT LF VT FF CR A gt si 2i 2i 2i gt gt i gt i gt i gt i gt oN eiA S G Hn jO SINNI TS NISIN N NI NN NNS G iw Qiy Nin NIN Null Start of Header Start of Text End of Text End of Transmission Inquiry Acknowledgement Bell Backspace Horizontal Tab Line Feed Vertical Tab Form Feed Carriage Return Shift Out Shift In Data Link Escape Device Control 1 Device Control 2 Device Control 3 Device Control 4 Negative Acknowledgement Synchronous Idle End of Transmission Block Cancel End of Medium Substitute Escape File Separator Group Separator Record Separator Unit Separator None Go To Local GTL None None Selected Device Clear SDC None None Parallel Poll Disable PPD Group Execute Trigger GET Take Control TCT None None None None None None None Local Lockout LLO None None Device Clear DCL Parallel Poll Unconfig PPU None None Serial Poll Enable SPE Serial Poll Disable SPD None None None None None None 1 ASCII control codes are sometimes used to formalize a communications session between communication devices 2 DC1 DC2 DC3 DC4 FS GS RS and US all have user defined meanings and may vary in use between sessions or devices 3 DC4 is often used as a general stop transmission character 4 Codes used to control cursor position m
44. al Poll Enable bus command Unlisten bus command Service Request Enable Register Untalk bus command Service Request line Unit Separator ASCII Code Status Byte Register Virtual DOS Machine Start of Text ASCII Code Vertical Tab ASCII Code Digital488 80A User s Manual Abbreviations 99 Notes 100 Abbreviations Digital488 80A User s Manual
45. alog to Digital Converter Application Program Interface Go To Local bus command Graphical User Interface Hardware American Standard Code for Info Interchange Attention line Bell ASCII Code Horizontal Tab ASCII Code Invalid Device Dependent Command Invalid Device Dependent Command Option Backspace ASCII Code Controller Active mode Cancel ASCII Code Institute of Electrical amp Electronic Engineers Interface Clear line Input Output Control Character Command Language Cold Junction Compensation Bus Command interpretation Industry Standard Architecture bus Interrupt Service Routine Bus Device Individual Status Carriage Return ASCII Code Calibration Status Register Clear To Send line Listen Address Group bus command Light Emitting Diode Line Feed ASCII Code Data Valid line Device Control 1 ASCII Code Device Control 2 ASCII Code Local Lock Out bus command Least Significant Bit Message Available bit Device Control 3 ASCII Code Device Control 4 ASCII Code Data Carrier Detect line My Listen Address Most Significant Bit Master Summary Status bit Device Clear bus command Dynamic Data Exchange Delete ASCII Code My Talk Address Not Used Negative Acknowledgement ASCII Code Data Transfer I O line Data Link Escape ASCII Code Dynamic Link Library Not Data Accepted line Not Ready For Data line Null ASCII Code DMA DMM DSR DTR EEPROM EM Direct Memory Access Digital Mul
46. amount of data sent is less than the number of bits programmed as outputs then the least significant bits contain the data sent and the most significant bits are cleared to logic 0 If a single port is selected with the Port Select P command only 8 bits may be sent with the Data Output D command The Data Strobe output of the selected channel is pulsed for approximately 50 microseconds after new data is output on the selected ports of that channel For Data Formats FO through F3 data sent by the controller are contained within a D command prefix and a Z terminator suffix In Data Format F4 binary the 5 bytes immediately following the D prefix are interpreted as data and the Z suffix is not used In Data Format F5 high speed binary all bytes received are treated as data and the prefix and suffix are not used For more information refer to the Data Format F command CAUTION Because the Configuration C command is used the following programming example s will not work properly if the HVCX1 option is installed with a conflicting hardware configuration To be safe remove the HVCX1 board and replace it with the jumper board to run the example s EXAMPLE 1 PRINT 1 CLEARO8 Line 1 Reset the Digital488 80A PRINT 1 OUTPUTO8 CSP1G2ROX Line 2 Configure all 5 ports as output select Port 1 only PRINT 1 OUTPUTO8 D55Zx Line 3 Send data 55 to Port 1 PRINT 1 ENTERO8 INPUT 2 A Line 5 Read data from Port 1
47. anagementLines Interface Clear ATN Attention 04 0 0 0 0 0 1 0 0 EOI End Or Identify 80 1 0 0 0 0 0 0 0 SRQ Service Request 40 0 1 0 0 0 0 0 0 DAV Data Valid 08 0 0 0 0 1 0 0 0 NDAC Not Data Accepted 10 0 0 0 1 0 0 0 0 NRFD Not Ready For Data 20 0 0 1 0 0 0 0 0 DTR Data Terminal Ready 02 0 0 0 0 0 0 1 0 RI Ring Indicator 10 0 0 1 0 0 0 0 RTS Request To Send 01 0 0 0 0 0 0 0 1 Clear To Send 04 0 0 0 0 0 1 0 0 Data Carrier Detect 08 0 0 0 Data Set Ready 20 0 0 1 0 0 0 0 0 Hexadecimal amp Decimal Values Hexadecimal Value 80 40 20 10 08 04 02 01 Decimal Value 128 064 032 016 008 004 002 001 Digital488 80A User s Manual Appendix B 85 IEEE 488 Bus Commands Bus State IEEE 488 Bus Command Data Transfer DIO Lines ATN is asserted 1 5 4 3 Device Clear ojs ojlo ro O N o _ oO oO oO oO H O O O Group Execute Trigger 08 Go To Local 01 Listen Address Group 20 3F Local Lock Out 11 My Listen Address My Talk Address Parallel Poll Config Parallel Poll Disable 07 Parallel Poll Unconfig 15 Second Cmd Group 60 7F Selected Device Clear 04 Serial Poll Disable 19 Serial Poll Enable 18 Talker Address Group 40 5F Take Control 09 Unlisten 3F Untalk 5F Hexadecimal amp Decimal Values Hexadecimal Value Decimal Value OoOo O O DIDI DI DIDI DI DIO CO CO OiO Fi DIO RPIDI OI OI HI OI CO PRI HPIOCO
48. and to be sent after power up All ports programmed as outputs are set to a logic 0 after receiving the Configuration command The actual output level is dependent upon the Invert command I16 Configuration Command Port5 Port4 Port3 Port2 Port1 Output Output Output Output Output CAUTION Because the Configuration C command is used the following programming example s will not work properly if the HVCX1 option is installed with a conflicting hardware configuration To be safe remove the HVCX1 board and replace it with the jumper board to run the example s EXAMPLE PRINT 1 CLEARO8 Line 1 Reset the Digital488 80A PRINT 1 OUTPUT08 C1X Line 2 Configure Port 1 as output Ports 2 through 5 as inputs PRINT 1 OUTPUT08 C Line 3 Query current port configuration PRINT 1 ENTERO8 INPUT 2 AS PRINT A Line 6 Display shows C1 Digital488 80A User s Manual Digital488 80A Commands 49 D Data Output SYNTAX Define data to be outputted where val data value terminated by Z In the Format F4 mode the Z terminator suffix is not used In the Format F5 mode both the D command prefix and the Z terminator suffix are not used DESCRIPTION The Data Output D command outputs up to 40 bits of data to the output ports on a selected channel The number of bits that can be sent with the Data Output command is limited by the number of bits programmed as outputs For Data Formats FO through F3 if the
49. and updates the checksum to a known value and clears the E5 error condition For more information see the Query Error Status E and User Status U commands in Chapter 6 Digital488 80A Commands 80 Troubleshooting Digital488 80A User s Manual Appendix A A Digital488 80A HVCX1 Configuration Record 81 Hardware Setup 81 Software Setup 82 DB 50 Connector Wiring Reference 83 Digital488 80A HVCX1 Configuration Record To use this Configuration Record check the boxes for the options configured Where appropriate write in the voltage value selected A wiring reference chart for each channel is provided for recording the equipment wired to the DB 50 connectors Make a copy of this blank form or write in pencil so future changes can be recorded Hardware Setup Refer to the section Hardware Setup in Chapter 2 Digital488 SOA Setup Channel 0 Pin 48 Flyback Pull Up Control Output Handshaking Lines p 5 VDC or _p User Defined V Pin 48 Flyback Pull Up Control Output Handshaking Lines p 5 VDC or p User Defined V CAUTION The hardware and software configurations for the input and output ports must agree The Digital488 80A unit is protected from configuration conflict but the I O lines will not respond properly Digital488 80A User s Manual Appendix A 81 Software Setup Refer to the Configure C command in Chapter 6 Digital488 80A Commands Channel 1 eran CAUTION The hardwar
50. are not suppressed and the bus terminators are appended to the output After output the Digital488 80A must be readdressed to Talk to perform subsequent reads In Data Ready R mode R1 or R2 EDR may also be used to capture data in this data format Data Format F4 Binary In Data Format F4 no error checking is performed and caution must be exercised when using this mode to avoid locking the IEEE 488 bus When addressed to Listen the Digital488 80A expects the D command prefix followed by 5 bytes of data beginning with PORTS without the Z terminator suffix If any digital I O port is configured as an input then the data to that input port is ignored When the Digital488 80A is addressed to Talk in Data Ready R mode RO it asserts Inhibit reads the data from all 5 ports unasserts Inhibit and outputs 5 bytes beginning with PORT5 with EOT asserted on the last byte Bus terminators with the exception of EOI are not appended to the output After output the Digital488 80A must be readdressed to Talk to perform subsequent reads In Data Ready R mode R1 or R2 EDR may also be used to capture data in this data format Data Format F5 High Speed Binary In Data Format F5 the command interpreter is disabled When addressed to Listen the Digital488 80A treats all bytes received as data to be output to the digital I O ports Each time it receives 5 bytes or detects EOI asserted it pulses the Data Strobe for approximately 15 microseconds Data
51. as IEEE 488 bus support are provided Chapter 5 IEEE 488 Background describes the history and the basic concepts of IEEE 488 operation including the various IEEE 488 bus lines and bus commands Chapter 6 Digital488 80A Commands discusses the entire command set covering the Digital488 80A unit The command syntax groups and reference are provided The description format of the individual commands includes the command type syntax description and an example program excerpt Chapter 7 Troubleshooting provides a reference for possible solutions to technical problems Before calling for technical assistance refer to this chapter Appendix A provides the Digital488 SOA HVCX1 Configuration Record for recording hardware and software settings and recording DB 50 connector wiring information Appendix B provides background information concerning the IEEE 488 bus the serial bus and ASCII controls The Index provides a comprehensive alphabetical listing of the main terms and topics in this manual Also the Abbreviations on the last pages of this manual provides an overall list of abbreviations including acronyms and ASCII control codes as an additional reference for this manual and for other related literature CAUTION Using this equipment in ways other than described in this manual can cause personal injury or equipment damage Before setting up and using your equipment you should read all documentation that covers your system
52. ata Ready R command The EDR signal must be at least 1 microsecond wide and must have a rise and fall time of less than one microsecond The EDR line is normally rising edge sensitive but can be programmed with the nvert I command to be falling edge sensitive 132 When using the EDR line with the Data Ready R command R1 data is not read when the Digital488 80A is addressed to talk as it is read with command RO The Digital488 80A only outputs data when the EDR line transitions When using the EDR line with the R2 command data is read and stored in an internal data buffer each time the EDR line transitions The Digital488 80A only outputs data when there is data in the buffer to output EDR is not functional in the high speed binary F5 format Digital488 80A User s Manual Digital488 80A Operation 31 IEEE 488 Bus Support The Digital488 80A implements many of the capabilities defined by the IEEE 488 1978 specification These capabilities are discussed in the following text However the bus lines uniline and bus commands multiline that the Digital488 80A does not support or respond to include the following REN Remote Enable uniline PPC Parallel Poll Configure GTL Go to Local PPD Parallel Poll Disable LLO Local Lock Out PPU Parallel Poll Unconfigure PP Parallel Poll TCT Take Control Bus Lines The following IEEE 488 bus management lines are supported by Digital488 80A e Interface Clear IFC IFC p
53. atus U command UO and reads the status string from the Digital488 80A DIO4 DIO4 is not used and is always a logic 0 DIO5 The DIOS bit is set after an entire command string has been received and processed by the Digital488 80A The bit is cleared while the Digital488 80A is processing commands which have been received from the controller When used with the ML6 command a Service Request SRQ is also generated when the DIO5 bit is set An Execute X command must be received before the DIO5 bit can be cleared DIO6 DIO6 is not used and is always a logic 0 DIO7 The DIO7 bit is set when the Digital488 80A generates a Service Request SRQ This is used by the controller to determine that the Service Request was indeed generated by the Digital488 80A DIO8 DIO8 is not used and is always a logic 0 EXAMPLE PRINT 1 CLEARO8 Line 1 Reset the Digital488 80A PRINT 1 OUTPUTO8 M4X Line 2 Select SRQ on IEEE 488 bus error PRINT 1 OUTPUTO8 F7X Line 3 Send an invalid bus command The ERROR and SRQ LED indicators should light up PRINT 1 SPOLLO8 Line 4 The Serial Poll Status byte returned should be 84 64 16 04 The interpretation of this Serial Poll Status byte is as follows e 64 The Digital488 80A was the source of the SRQ e 16 The Digital488 80A is ready for more commands e 04 There is an IEEE 488 bus error When the Digital488 80A is Serial Polled the SRQ LED indicator turns off Digital488 80A
54. ay be used to control print devices and move the print head accordingly However not all devices support the full set of positioning codes AppendixB 89 Decimal Values 00 to 31 ACG amp UCG Descriptions ASCII Control Codes 00 to 31 Dec Name Cis Description S O Addressed Command Group ACG Null NUL Space filler character Used in output timing for some device drivers Start of Header SOH Marks beginning of message header Start of Text STX Marks beginning of data block text End of Text ETX Marks end of data block text End of Transmission EOT Marks end of transmission session Inquiry ENQ Request for identification or information Acknowledgement ACK Yes answer to questions or ready for next transmission Used in asynchronous protocols for timing Bell BEL Rings bell or audible alarm on terminal Backspace BS Moves cursor position back one character Horizontal Tab HT Moves cursor position to next tab stop on line Line Feed LF Moves cursor position down one line Vertical Tab VT Moves cursor position down to next tab line Form Feed FF Moves cursor position to top of next page Carriage Return CR Moves cursor to left margin Shift Out SO Next characters do not follow ASCII definitions Shift In SI Next characters revert to ASCII meaning Universal Command Group UCG Data Link Escape DLE Used to control transmissions using escape sequences Device Co
55. carefully and you should never touch connector pins or circuit components unless you are following ESD guidelines in an appropriate ESD controlled area Such guidelines include the use of properly grounded mats and wrist straps ESD bags and cartons and related procedures Other Issues Power Up Activation CAUTION Line Voltage The protective conductor terminal on the AC line connector must be connected to an external protective earthing system Failure to make such a connection will impair protection from shock LED Patterns for Error Conditions D LED Indicators Condition TALK LISTEN SRQ ERROR TEST POWER Normal No Errors Off Off Off Off Off ON ROM Error ON ON ON ON ON ON RAM Error FLASHING FLASHING FLASHING FLASHING FLASHING ON NV RAM Checksum Error Off Off Off ON Off ON No Power Off Off Off Off Off Digital488 80A User s Manual Troubleshooting 79 With the power cord plugged in and connected to the Digital488 80A turn on the unit by depressing the rear panel power switch All of the front panel LED indicators should light up for approximately one second while the Digital488 80A performs an internal ROM and RAM self check At the end of this self check all of the LED indicators should turn off except for POWER Otherwise the Digital488 80A may be in an error condition according to the one of the four following LED patterns e I fall of the LED indicators remain on Then a
56. command 50 Data Format F command 53 Data Output D command 50 Data Ready R command 66 Data Strobe output line 30 data transfer 4 37 Digital488 80A User s Manual data transfer line 37 default settings 7 digital I O 1 17 DIP switch 7 dual primary addressing mode 8 E command 51 80 EDR 31 electrostatic discharge ESD 79 End Or Identify K command 60 examples programming 25 Execute X command 74 External Data Ready EDR input line 31 F command 53 factory service 19 front panel layout 6 fuse replacement 22 G command 57 H command 58 Handshake H command 58 handshaking line 1 13 14 29 37 high current 18 high voltage 18 history IEEE 488 bus 35 HVCX1 Configuration Record 81 HVCX1 option 2 10 16 I command 59 IEEE 488 bus address 34 command 32 36 86 command group 38 general structure 35 history 35 line 32 36 85 support 32 terminator 34 IEEE 488 bus address 7 index 95 Inhibit Q command 65 Inhibit output line 31 input port 12 internal buffer 2 internal components 19 Invert I command 59 K command 60 Keyboard Controller KBC Program 25 L command 61 line voltage 20 selection 21 M command 62 mode addressing 1 7 O command 63 output port 14 overrun 80 P command 64 port 11 17 Port Select P command 64 power configuration 20 power up activation 24 79 progra
57. d The notched end of the IC must be to the left see above figure for the proper orientation 3 When configuring the option for high voltage install the 27K SIP single in line pack pull up resistor network labeled 9X 1 273 in the SIP socket in the OUTPUT section Make sure Pin 1 of the SIP pack as denoted by the square dot is toward the left see above figure for the proper orientation This pin must be connected to an external voltage supply in order to achieve the desired logic level 4 Verify that no components the 2596 and DIP pack are in the INPUT section of a port being configured as an output Having components for the output and input installed in the same port will cause damage to the unit To Set Up Handshaking Output Lines With the HVCX1 option the Digital488 80A handshaking outputs Trigger Inhibit Strobe and Clear can be set The user defined voltage is the voltage supplied through Pin 48 of the channel voltage is the same as the data lines for ports configured as outputs Handshaking output lines are changed as a group and cannot have their sense reconfigured handshaking inputs are always inputs and handshaking outputs are always outputs There is one group of handshaking output lines per channel 1 e CHO has handshaking set and CH1 has handshaking set Handshaking may be done at TTL levels even if digital I O is set for a higher range 14 Digital488 80A Setup Digital488 80A User s Manual To Front of D
58. d as part of the Recall Configuration 0 command To set the unit to a particular configuration upon power on the Save Configuration S command must be used once all the desired options have been selected To Front of Digital488 80A Unit CH1 CONTROL CHO CONTROL cca ae CH1 rr CHO JP 1m0 5c JP2 mol 5c 5VDC H CH1 PORT 5 CHO PORT 5 2596 INPUT J DIP Pack DIP Pack INPUT 2596 2596 OUTPUT CHO CH1 PORT 4 EDR SERVICE CHO PORT 4 2596 INPUT J DIP Pack DIP R Pack DIP Pack INPUT 2596 CH1 OUTPUT CH1 PORT 3 EDR SERVICE CHO PORT 3 2596 INPUT J DIP Pack DIP R Pack DIP Pack INPUT 2596 a Se OUTPUT CH1 PORT 2 CHO PORT 2 2596 INPUT J DIP Pack DIP Pack INPUT 2596 OUTPUT Seen o y m SIP Pack T J21C DIN 96 Connector a CH1 PORT 1 CHO PORT 1 2596 2596 INPUT J DIP Pack DIP Pack INPUT 2596 he QUTPUT OUTPUT m SIP Pack m SIP Pack To Rear of Digital488 80A Unit HVCXI High Voltage Current Interface Option Digital488 80A User s Manual Digital488 80A Setup 11 To Set Up Input Ports To Front of Digital488 80A Unit CH1 CONTROL CHO CONTROL _ e Ld Ld CH1 mr CHO JP 1m0 5c JP2 molo Fc OVD G ee VDC VDC CH1 PORT 5 CHO PORT 5 2596 INPUT J DIP Pack DIP Pack INPUT 2596 2596 OUTPUT CHO CH1 PORT 4 EDR SERVICE CHO PORT 4 2596 INPUT J DIP Pack DIP R Pack DIP Pack INPUT 2596 CH1 CH1 PORT 3 EDR SERVICE CHO PORT 3 2596 INPUT J DIP Pack DIP R
59. d fall time of less than 1 0 microsecond The EDR line defaults to rising edge sensitive but can be changed to falling edge sensitive with the Invert IL command I32 The EDR line cannot be used to capture data in the Data Format F mode F5 CAUTION Because the Configuration C command is used the following programming example s will not work properly if the HVCX1 option is installed with a conflicting hardware configuration To be safe remove the HVCX1 board and replace it with the jumper board to run the example s EXAMPLE 1 PRINT 1 CLEARO8 Line 1 Reset the Digital488 80A PRINT 1 OUTPUTO8 R1X Line 2 Data is read only after a rising edge signal is applied to the EDR line only one reading is stored in the buffer and must be read before another reading can be taken EXAMPLE 2 PRINT 1 CLEARO8 Line 1 Reset the Digital488 80A DIM BS 100 Line 2 Dimension an array to store buffered data PRINT 1 OUTPUT08 COPOX Line 3 Configure all 5 ports as inputs select all 5 ports PRINT 1 OUTPUT08 R2X Line 4 Data is latched and buffered on an EDR transition PRINT 1 OUTPUTO8 G3X Line 5 Buffered I O data is sent when unit is addressed to Talk FOR I 1 TO 50 Line 6 Fifty readings one reading per EDR transition are taken and stored in the internal buffer PRINT 1 ENTERO8 Line 7 Read the internal buffer and store the data in the array INPUT 2 BS I NEXT I 66 Digital488 80A Commands Di
60. d in the following text Data Format FO ASCII Hexadecimal In the default Data Format FO the data are described in ASCII hexadecimal with each character having a value from 0 through 9 or A through F Each ASCII character describes 4 bits of data ASCII Hexadecimal Decimal Equivalent ASCII Hexadecimal Decimal Equivalent Data received for output to the digital ports must be contained within a D command prefix and a Z terminator suffix If the amount of data sent is less than the number of bits programmed as outputs then the least significant bits contain the data sent and the most significant bits are cleared to logic 0 If the data sent is greater than the number of bits programmed for output or selected by the Port Select P command then the Digital488 80A generates a Conflict Error E3 and ignores the entire command string up to the next Execute X command The Data Strobe output is pulsed for approximately 50 microseconds after new data is output on the selected port s When the Digital488 80A is addressed to Talk in Data Ready R mode RO it asserts Inhibit reads the data from all 5 ports unasserts Inhibit and outputs the number of characters determined by the Bus Input Output G and Port Select P commands Leading zeros are not suppressed and the bus terminators are appended to the output After output the Digital488 80A must be readdressed to Talk to perform subsequent reads In Data Ready R mode R1 or R2 EDR may also be used
61. d pulses both Clear lines for approximately 50 microseconds The Clear line is normally active high The nvert I command programs it active low 18 The Handshake 4 command can pulse the Clear line of either channel HO independent of any I O operations Data Strobe Pin 42 15 ps min gt 50 us typ gt Strobe CY _ _ 15 us typ in F5 Format Timing Diagram for Data Strobe Output The Data Strobe output is pulsed for approximately 50 microseconds after new data are output on the I O port The Data Strobe line is normally active high but may be programmed active low 14 by the Invert I command The Handshake H command can pulse the Data Strobe line H1 independent of any I O operations The Data Strobe output is not pulsed when Bit Set A or Bit Clear B commands are executed Trigger Pin 43 GET Trigger nee I 75 us typ i 50 ps typ Timing Diagram for Trigger Output The Trigger output is pulsed for approximately 50 microseconds after a Group Execute Trigger GET command is received from the bus controller The trigger pulse is normally active high but can be made active low 12 with the nvert I command The Handshake H command can independently pulse the Trigger line H2 independent of any bus activity 30 Digital488 80A Operation Digital488 80A User s Manual Inhibit Pin 44 The Inhibit output is asserted while data on the selected I O port are being read int
62. ded for indoor use only Outdoor conditions could result in equipment failure bodily injury or death WARNING Never disassemble the Digital488 80A case while it is connected to the AC power line Internal voltage potentials exist which could cause bodily injury or death To change the operating voltage of the Digital488 80A unit it is necessary to open the enclosure However before modifying the voltage disconnect any input or output connections from the rear panel of the affected unit and then disconnect the power cord from the power line terminal Line voltage must be set for 105 125 or 210 250 VAC to match the power being supplied to the Digital488 80A unit Ifthe line voltage is changed the fuse must also be changed Refer to the following text for the line voltage switch and fuse locations Line Voltage Selection CAUTION Service Fuse replacement and the changing of selected line voltage must be performed by qualified service personnel Never open the Digital488 80A case while it is connected to the AC line Contact with voltage potentials could cause bodily injury or death As already mentioned the Digital488 80A may be operated with 105 125 or 210 250 VAC 50 60 Hz power as set by its internal line voltage switch labelled S4 Each unit is shipped from the factory with this operating voltage setting marked on its rear panel If this is not the appropriate power setting to be supplied to the unit then the line voltage
63. dress Group TAG These commands address to Talk specified bus devices There are 31 0 to 30 Talk addresses associated with this group The 3 most significant bits of the data bus are set to 010 while the 5 least significant bits are the address of the device being told to Talk Secondary Command Group SCG These commands are used to specify a subaddress or subfunction within a given bus device These are any one of the 32 possible commands 0 to 31 in this group They must immediately follow a Talk or Listen address Three bus commands not found in the above 5 groups are MLA MTA and PPC All of the IEEE 488 bus commands are further described individually as follows Device Clear DCL This command causes all bus devices to be initialized to a pre defined or power up state Group Execute Trigger GET This command usually signals a group of devices to begin executing a triggered action This allows actions of different devices to begin simultaneously Go To Local GTL This command allows the selected devices to be manually controlled Local Lock Out LLO This command prevents manual control of the instrument s functions My Listen Address MLA This command addresses a device to Listen The device accepts data from the Active Talker and outputs this data through the serial interface It substitutes the selected serial terminators for the received IEEE 488 bus terminators My Talk Address MTA This command addresses a device
64. e are the responsibility of the Active Controller to send and the bus devices to recognize Most of these happen routinely by the interface and are totally transparent to the system programmer Other commands are used directly by the user to provide optimum system control Of the uniline commands SRQ is very important to the test system and the software designer has easy access to this line by most devices Service Request is the method by which a bus device can signal to the Controller that an event has occurred It is similar to an interrupt in a microprocessor based system Most intelligent bus peripherals have the ability to assert SRQ A digital multimeter DMM might assert it when its measurement is complete if its input is overloaded or for any of an assortment of reasons A power supply might SRQ if its output has current limited This is a powerful bus feature that removes the burden from the System Controller to periodically inquire Are you done yet Instead the Controller says Do what I told you to do and let me know when you re done or Tell me when something is wrong Since SRQ is a single line command there is no way for the Controller to determine which device requested the service without additional information This information is provided by the multiline commands for Serial Poll and Parallel Poll e Serial Poll Suppose the Controller receives a service request For this example let us assume there are several devices wh
65. e 27K ohm Pull Up SIP Resistor Output User Connection 200 mA max HVCX1 Option High Voltage Current Output Pin 48 sets the pull up logic level for all output lines on a channel Lines configured with the pull up can only be used as outputs These outputs can sink up to 200 mA in the ON state and withstand voltages up to 50 VDC through the use of open collector drivers with integral flyback diodes for inductive load transient suppression For more information see the Specifications section in Chapter 1 Digital488 80A Overview 10 Digital488 80A Setup Digital488 80A User s Manual Determining Ports Setup Before configuring the HVCX1 option determine which ports are going to be set up for inputs and which ports for outputs Determine what voltages are desired for the inputs 0 5 V 0 12 V 0 24 V or 0 48 V The following chart shows which combinations of outputs and inputs are permitted limitations set by the Configuration C software command Note If no chips are installed in the input or output side of a port the Digital488 80A lines are pulled up and the user will receive FF from that port For convenience you may want to program the Digital488 80A to power up with your configuration Refer to the Configuration C and Save Configuration S commands Input or output status is set using the Configuration C command To save the input output status as the new setting for the power up default it must be save
66. e and software configurations for the input and output ports must agree The Digital488 80A unit is protected from configuration conflict but the I O lines will not respond properly 82 Appendix A Digital488 80A User s Manual DB 50 Connector Wiring Reference Refer to the section Digital I O Ports in Chapter 2 Digital488 80A Setup Rear Panel DB 50 Connector Pin Out Channel 0 Description SignalName Pin Description Signal Name Port 1 Bit 1 I O Port 4 Bit 2 I O Port 1 Bit 2 I O Port 4 Bit 3 I O Port 1 Bit 3 I O Port 4 Bit 4 I O 4 Port 1 Bit 4 I O Port 4 Bit 5 I O 5 Port 1 Bit 5 I O Port 4 Bit 6 I O _ Port 1 Bit 6 I O Port 4 Bit 7 I O T Port 1 Bit 7 I O Port 4 Bit 8 I O I O Port 1 Bit 8 I O Port 5 Bit 1 Port 2 Bit 1 10 Port 2 Bit 2 I O I O 11 Port 2 Bit 3 I O Port 5 Bit 2 O Port 5 Bit 3 I O Port 5 Bit 4 I O 12 Port 2 Bit 4 I O Port 5 Bit 5 I O 1 Port 2 Bit 5 I O Port 5 Bit 7 I O Port 5 Bit 8 I O Port 5 Bit 6 I O 15 Port 2 Bit 7 I O 16 Port 2 Bit 8 I O 17 Port 3 Bit 1 I O 18 Port 3 Bit2 I O 19 Port 3 Bit 3 I O 20 Port 3 Bit 4 I O 21 Port3 Bit 5 I O 23 Pot3Bt7 MO OOO 24 Pot3Bit8 wo 49 8V 6omama 14 Pon t610 Digital488 80A User s Manual Appendix A
67. ed in conjunction with the Service Request Mask M command M2 the External Data Ready EDR line can both latch the input data and generate a Service Request SRQ to signal the controller that new data is available In the default mode RO data is read when the Digital488 80A is addressed to Talk In mode R1 the Digital488 80A unit waits for an EDR transition on the selected channel before latching the data and formatting the data for output If the unit is addressed to Talk before EDR is asserted the bus hangs up until the EDR pulse occurs Once EDR is asserted the data remains latched until the unit is addressed to Talk and the data is read by the controller If EDR transitions again before the previous EDR buffered data has been read the Digital488 80A generates an Internal Data Buffer Overrun E6 and ignores the EDR read request The Inhibit line is asserted once for each data read operation for all Data Format F modes except high speed binary mode F5 In mode R2 successive readings up to 2000 may be latched and stored in the internal data buffer The number of readings in the buffer may be found using the Buffer L command query L The EDR and Inhibit lines function in this mode in the same manner as in mode R1 If an attempt is made to store more than 2000 readings in the internal buffer the Digital488 80A generates an Internal Data Buffer Overrun E6 The EDR signal must be at least 1 0 microsecond wide and should have a rise an
68. en run the Keyboard Controller Program KYBDCTRL BAS and verify that the CMD gt prompt appears on the screen Digital488 80A User s Manual Digital488 80A Power amp Assembly 25 Digital488 80A Command Responses 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 CMD gt CMD gt OUTPUT 08 T1X CMD gt OUTPUT 08 TOX CMD gt CLEAR CMD gt OUTPUT 08 U0X CMD gt ENTER 08 1 0 CO EO FO GO I000 KO L0000 M000 PO RO YO CMD gt OUTPUT 09 U0X CMD gt ENTER 09 1 0 CO EO FO GO I000 KO M000 PO RO YO CMD gt OUTPUT 08 C CMD gt ENTER 08 Co CMD gt OUTPUT 08 C5X CMD gt OUTPUT 08 C CMD gt ENTER 08 C5 CMD gt OUTPUT 09 C CMD gt ENTER 09 Co CMD gt OUTPUT 08 G2 RO X CMD gt OUTPUT 08 D123Z X CMD gt ENTER 08 0000000123 CMD gt OUTPUT 08 A37 X CMD gt ENTER 08 1000000123 The above is a listing of the commands given to the Digital488 80A and the response received Some commands and command responses are separated by extra vertical and horizontal spaces for clarity although these spaces will not actually appear when using the program These command responses are explained as follows 26 Digital488 80A Power amp Assembly Digital488 80A User s Manual e Line 1 Initial command prompt from the Keyboard Controller program e Line 2 Instruct the Digital488 80A to turn on its TEST LED indicator The TEST LED indicator should light up e Line 3 Instruct the
69. ended to the output After output the Digital488 80A must be readdressed to Talk to perform subsequent reads In Data Ready R mode R1 or R2 EDR may also be used to capture data in this data format Data Format F3 ASCII Decimal In Data Format F3 the data is described in decimal 8 bit multiples and transmitted in ASCII Each decimal number 000 to 255 to be output must be separated by semi colons ASCII Decimal Decimal Equivalent ASCII Decimal Decimal Equivalent 008 54 Digital488 80A Commands Digital488 80A User s Manual Data received for output to the digital ports must be contained within a D command prefix and a Z terminator suffix If the amount of data sent is less than the number of bits programmed as outputs then the least significant bits contain the data sent and the most significant bits are cleared to logic 0 If the data sent is greater than the number of bits programmed for output or selected by the Port Select P command then the Digital488 80A generates a Conflict Error E3 and ignores the entire command string up to the next Execute X command The Data Strobe output is pulsed for approximately 50 microseconds after new data is output on the selected port s When the Digital488 80A is addressed to Talk in Data Ready R mode RO it asserts Inhibit reads the data from all 5 ports unasserts Inhibit and outputs the number of characters determined by the Bus Input Output G and Port Select P commands Leading zeros
70. equest After output in the FO through F4 formats the Digital488 80A must be readdressed to Talk to perform subsequent buffered output of EDR captured data In Data Ready R mode R2 the Digital488 80A waits for an EDR transition on the selected channel before latching the data and storing them in the internal data buffer Up to 2000 readings may be latched and stored The EDR and Inhibit lines function in the same manner as in the R1 mode If an attempt is made to store more than 2000 readings the Digital488 80A generates an Internal Data Buffer Overrun E6 error After output in the FO through F4 formats the Digital488 80A must be readdressed to Talk to perform subsequent buffered output of EDR captured data For more information see the Data Ready R and Query Error Status E commands in Chapter 6 Digital488 80A Commands Query Error Status The Query Error Status E command is used to determine the present error condition on the selected channel of the Digital488 80A After execution of the E command the present error condition is cleared The error condition is also cleared by executing the User Status U command uo When an error has occurred the front panel ERROR LED indicator turns on The ERROR LED stays on until an E or U0 command is executed If a Non Volatile RAM Checksum Failure 5 occurs then it can only be cleared by doing a save of the configuration using the Save Configuration S command Executing this comm
71. ese Query commands may be combined into one string to allow the user to construct a specialized status command requesting the Digital488 80A to return only that information which is of interest for a given application Note It is necessary that the Execute x command follow all command strings sent to the Digital488 80A No commands are executed until an X is received by the Digital488 80A The only exceptions to this rule are the Query commands which do not have to be followed by x CAUTION If you would like to experiment with the Digital488 80A unit and the example programs do not install the HVCX1 option until after experimenting with the unit to avoid software hardware configuration conflicts If the HVCX1 option is already installed replace it with the jumper board to run the example programs Digital488 80A User s Manual Digital488 80A Commands 41 Command Syntax Operation of the Digital488 80A is accomplished using a set of commands that configure the entire unit The syntax rules for using the commands are listed below e Each command consists of one alphabetic character followed by one number value The alphabetic character is referred to as the command and the number value following the command is the command parameter F specifies the Format command 5 is the parameter which specifies the high speed binary format L specifies the Buffer command 0 is the parameter which clears the data buffer e
72. eturns EO if No Error has occurred E1 if Unrecognized Command E2 if Invalid Command Parameter E3 if Command Conflict Error E5 if Non Volatile RAM Checksum Failure E6 if Internal Data Buffer Overrun e Note Except for E5 error is cleared upon reading error status Data Format ma Define format n of data where n valuefom 015 r0 Defaut Define ASCII hexadecimal 4 bits per character Define mode n of data transmission on the IEEE 488 bus when the Digital488 80A is addressed to Talk wheren value from O to 4 a Talk i Bus Input Output Only input port data is sent Only output port data is sent Buffered input and output data are sent Continuous buffered input and output data are sent Returns current bus input output mode n The amount of data sent is dependent upon the Port Select P command 44 Digital488 80A Commands o Digita488 80A User s Manual Handshake iin Define handshake ine n to be pulsed where n 0 4 0r2 Ho Define the Clear output ine to be pulsed Define the Trigger output line to be pulsed Returns the last Handshake command executed Define the polarity of the handshake and data lines where 000 lt val lt 127 as summed from the following states 0 Default All handshaking control lines are active high all data lines are high true 1 The Inhibit output line is active low 2 The Trigger output line is active low 4 The Data Strobe output line is acti
73. f Attention is asserted then the information contained on the data lines is to be interpreted as a multiline command If it is not then that information is to be interpreted as data for the Active Listeners The Active Controller is the only bus device that has control of this line e End Or Identify EOI The EOT line is used to signal the last byte of a multibyte data transfer The device that is sending the data asserts EOI during the transfer of the last data byte The EOT signal is not always necessary for the end of the data may be indicated by some special character such as carriage return CR and or line feed LF The Active Controller also uses EOI to perform a Parallel Poll by simultaneously asserting EOI and ATN e Service Request SRQ When a device desires the immediate attention of the Active Controller it asserts SRQ It is then the responsibility of the controller to determine which device requested service This is accomplished with a Serial Poll or a Parallel Poll IEEE 488 Background Digital488 80A User s Manual Handshake Lines DIO1 thru DIO8 1st Data Byte 2nd Data Byte composite 4 Eight bidirectional active low data lines DIO1 thru DIO8 DAV Data Valid Handshake Line 1 Source I m Ready Valid vate Valid a Controlled by Talker NREFD Not Ready for Data Handshake Line 2 Acceptor All None All None Here s the Data Ready Ready Ready Ready Controlled by Listeners E a E A E
74. for the line voltage See section Fuse Replacement Step 3 following this section CAUTION Fuse Failure Fuse failure indicates a possible problem within the device circuitry Ifa fuse blows contact a qualified service representative Replacement fuses are to be installed by qualified service personnel with the unit disconnected from the power source and with all other terminals disconnected If the line voltage selector is changed then the fuse designated for that line voltage must be used 5 Make note of the new voltage setting for later reference 6 Carefully reassemble the unit Note For re assembly first reconnect the AC power line and then any other cables prior to reapplying power to the entire system Digital488 80A User s Manual Digital488 80A Power amp Assembly 21 Fuse Replacement CAUTION Service Fuse replacement and the changing of selected line voltage must be performed by qualified service personnel Never open the Digital488 80A case while it is connected to the AC line Contact with voltage potentials could cause bodily injury or death The Digital488 80A unit contains an internal AC line fuse The fuse is located next to the internal line voltage switch S4 You may replace the fuse by using the procedures found in the following text Note If disassembly or disconnections are necessary first turn off the power next disconnect the AC power line and then any other cables prior to disasse
75. g the Terminator Y command To save the new setting as the power up default it must be saved with the Save Configuration S command Then this new setting can be loaded with the Recall Configuration 0 command For more information on these commands refer to Chapter 6 Digital488 S0A Commands The only input terminating character accepted by the Digital488 80A is the Execute xX command All other input terminators are ignored 34 Digital488 80A Operation Digital488 80A User s Manual IEEE 488 Background 5 History 35 General Bus Structure 35 Bus Lines amp Bus Command 36 Bus Management Lines 36 Handshake Lines 37 Data Transfer Lines 37 Bus Command Groups 38 More On Service Requests 39 History The IEEE 488 bus is an instrumentation communication bus adopted by the Institute of Electrical and Electronic Engineers in 1975 and revised in 1978 Prior to the adoption of this standard most instrumentation manufacturers offered their own versions of computer interfaces This placed the burden of system hardware design on the end user If his application required the products of several different manufacturers then he might need to design several different hardware and software interfaces The popularity of the IEEE 488 interface sometimes called the General Purpose Interface Bus or GPIB is due to the total specification of the electrical and mechanical interface as well as the data
76. gital488 80A User s Manual S Save Configuration SYNTAX Sval Save current configuration as configuration val where val value from 0 to 100 S S Returns the last saved configuration val not the currently loaded configuration DESCRIPTION The Save Configuration S command is used to save a non volatile copy of the present channel configuration for later recall with the Recall Configuration 0 command The argument val for this command may range from 0 to 100 allowing 101 different configurations to be saved in battery backed up RAM Upon power up the default configuration is configuration 0 The present state of all output bits is read before saving When the configuration is restored using the Recall Configuration command the outputs are set to the same values they had at the time that the Save Configuration command was executed If it is desired that the outputs be set to a specific state as part of a configuration the Data Output D command should be used just prior to the Save Configuration S command to insure that the data bits are set to the proper state upon retrieval of the configuration CAUTION Because the Configuration C command is used the following programming example s will not work properly if the HVCX1 option is installed with a conflicting hardware configuration To be safe remove the HVCX1 board and replace it with the jumper board to run the example s EXAMPLE PRINT 1 CLEARO8 Reset the Digita
77. he HVCX1 Option CAUTION When the HVCX1 option is used the I O lines are hardware configured as either inputs or outputs The hardware and software configurations for the input and output ports must agree The Digital488 80A unit is protected from configuration conflict but the I O lines will not respond properly Note If disassembly or disconnections are necessary first turn off the power next disconnect the AC power line and then any other cables prior to disassembly 1 When the input and output port configurations on the HVCX1 option are complete record the settings on the Digital488 S0A HVCX1 Configuration Record supplied with your user s manual or provided in Appendix A of this manual 2 Turn off the power Next disconnect the AC power line cord and then all other test cables from the unit 3 Place the unit on a flat surface Remove the four screws on top of the case and remove the top cover 4 Locate the two DIN 96 connectors on the HVCX1 board labelled J1 and J2 and the two DIN 96 connectors on the Digital488 80A main board labelled J4 and J1 Note Ifthe HVCX1 option was not factory installed the DIN 96 connectors have a jumper board plugged into them Remove the jumper board 5 Hold the HVCX1 board upside down with the label FRONT toward the front of the Digital488 80A and the label REAR toward the back of the Digital488 80A 6 Line up the J1 DIN 96 on the HVCX1 board with the J4 DIN 96 on the Digital488 80
78. he R2 mode data are latched and buffered on an External Data Ready transition a transition on the EDR input causes the Digital488 80A to collect the current value of all 40 bits and store the reading in the buffer This collection and storage of 40 bits of data can occur at a maximum rate of once every 140 microseconds e Output of Data to Ports When sending data to the outputs on a Digital488 80A channel the fastest format mode is high speed binary mode Format F command F5 In this mode 5 bytes of binary data are accepted from the bus and sent directly to the Digital488 80A outputs all 40 bits This constitutes one data transfer The data transfer rate in this mode is approximately 1400 transfers per second o IEEE 488 Bus Communication The fastest data transfer rate across the IEEE 488 bus to the IEEE 488 controller is approximately 1 byte every 140 microseconds whether reading data from the internal data buffer or accepting commands or data from the bus e Transistor Transistor Logic TTL Levels The data and handshake output lines drive two TTL loads In addition Ports 1 and 2 on each channel can function as 5 volt CMOS compatible outputs All input lines are less than 1 5 TTL loads Normal precautions should be taken to limit the input voltages to the range of 0 3 to 7 0 volts All I O lines are referenced to I O Common Ground DB 50 Pin 50 4 Digital488 80A Overview Digital488 80A User s Manual Digital488 80A Setup
79. he rear panel DIP switch S1 for Secondary addressing mode Then repeat the above commands substituting IEEE 488 bus address 0800 for 08 and address 0801 for 09 in all of the commands Digital488 80A User s Manual Digital488 80A Power amp Assembly 27 Notes 28 Digital488 80A Power amp Assembly Digital488 80A User s Manual Digital488 80A Operation 4 Introduction 29 Handshaking Control Lines 29 Clear Pin 41 30 Data Strobe Pin 42 30 Trigger Pin 43 30 Inhibit Pin 44 31 Service Pin 45 31 External Data Ready Pin 46 31 IEEE 488 Bus Support 32 Bus Lines 32 Bus Commands 32 Bus Addresses 34 Bus Terminators 34 Introduction Each 40 bit channel has six handshaking control lines as follows Clear Pin 41 This output line is pulsed whenever a Device Clear DCL or Selected Device Clear SDC command is received from the IEEE 488 controller Data Strobe Pin 42 This output is pulsed when the IEEE 488 controller presents new data on the I O lines Trigger Pin 43 This output signal is pulsed when a Group Execute Trigger GET command is received on the bus Inhibit Pin 44 This output line is asserted while the IEEE 488 controller is reading data from input lines Service Pin 45 This line is an edge triggered input that generates a Service Request on the bus External Data Ready Pin 46 This input line is u
80. hms 4116R 001 563 0 48 V 120K ohms 4116R 001 124 3 Verify that the appropriate DIP packs are installed in the CHO EDR SERVICE section for the Channel 0 settings and in the CH1 EDR SERVICE section for the Channel 1 settings Digital488 80A User s Manual Digital488 80A Setup 13 To Set Up Output Ports CH1 CONTROL 2596 Ld CH1 Jimo 5c OUTPUT m SIP Pack 2596 OUTPUT E SIP Pack To Front of Digital488 80A Unit CHO CONTROL 1 2598 hy DIN 96 Connector ae Sai CHO JP2 moo Soe OV DG et VDC CH1 PORT 5 CHO PORT 5 2596 INPUT J DIP Pack DIP Pack INPUT 2596 2596 OUTPUT CHO CH1 PORT 4 EDR SERVICE CHO PORT 4 2596 INPUT J DIP Pack DIP R Pack DIP Pack INPUT 2596 CH1 CH1 PORT 3 EDR SERVICE CHO PORT 3 2596 INPUT J DIP Pack DIP R Pack DIP Pack INPUT 2596 a CH1 PORT 2 CHO PORT 2 2596 INPUT J DIP Pack DIP Pack INPUT 2596 J21C DIN 96 Connector a CH1 PORT 1 CHO PORT 1 2596 INPUT J DIP Pack DIP Pack INPUT 2596 a OUTPUT OUTPUT OUTPUT m SIP Pack To Rear of Digital488 80A Unit HVCX1 High Voltage Current Interface Option Output Ports Section Highlighted Note All of the components mentioned below are for the port section of the HVCX1 board labelled OUTPUT 1 Locate the two 5 port sections one in the right end one in the left end of the HVCX1 board labelled OUTPUT 2 Place the 2596 IC chip into the IC input socket of the port being configure
81. ices emit radio frequency energy in levels compliant with Federal Communications Commission rules Part 15 for Class A devices If necessary refer to the FCC booklet How To Identify and Resolve Radio TV Interference Problems stock 004 000 00345 4 which is available from the U S Government Printing Office Washington D C 20402 CE Notice cE Many IOtech products carry the CE marker indicating they comply with the safety and emissions standards of the European Community As applicable we ship these products with a Declaration of Conformity stating which specifications and operating conditions apply Warnings and Cautions Refer all service to qualified personnel This caution symbol warns of possible personal injury or equipment damage under noted conditions Follow all safety standards of professional practice and the recommendations in this manual Using this equipment in ways other than described in this manual can present serious safety hazards or cause equipment damage This warning symbol is used in this manual or on the equipment to warn of possible injury or death from electrical shock under noted conditions This ESD caution symbol urges proper handling of equipment or components sensitive to damage from electrostatic discharge Proper handling guidelines include the use of grounded anti static mats and wrist straps ESD protective bags and cartons and related procedures Specifications and Calibration Specifications a
82. ich could assert SRQ The Controller issues a Serial Poll Enable SPE command to each device sequentially If any device responds with DIO7 asserted it indicates to the Controller that it was the device that asserted SRQ Often times the other bits will indicate why the device wanted service This Serial Polling sequence and any resulting action is under control of the software designer e Parallel Poll The Parallel Poll is another way the Controller can determine which device requested service It provides the who but not necessarily the why When bus devices are configured for Parallel Poll they are assigned one bit on the data bus for their response By using the Status bit the logic level of the response can be programmed to allow logical OR AND conditions on one data line by more than one device When SRQ is asserted the Controller under the user s software conducts a Parallel Poll The Controller must then analyze the eight bits of data received to determine the source of the request Once the source is determined a Serial Poll might be used to determine the why Of the two polling types the Serial Poll is the most popular due to its ability to determine the who and why In addition most devices support Serial Poll only Digital488 80A User s Manual IEEE 488 Background 39 Notes 40 IEEE 488 Background Digital488 80A User s Manual Digital488 80A Commands Introduction Command Syntax Command Set amp Support
83. igital488 80A Unit CH1 CONTROL CHO CONTROL _ 5 EE I CH1 rr CHO JP 1m0 Sog JP2 mo Goe 5VDC H VDC CH1 PORT 5 CHO PORT 5 2596 INPUT J DIP Pack DIP Pack INPUT 2596 SSS CHO CH1 PORT 4 EDR SERVICE CHO PORT 4 2596 INPUT J DIP Pack DIP R Pack DIP Pack INPUT 2596 CH1 CH1 PORT 3 EDR SERVICE CHO PORT 3 2596 INPUT J DIP Pack DIP R Pack DIP Pack INPUT 2596 CH1 PORT 2 CHO PORT 2 2596 INPUT J DIP Pack DIP Pack INPUT 2596 E eed E SIP Pack CH1 PORT 1 CHO PORT 1 2596 INPUT J DIP Pack DIP Pack INPUT 2596 QUTPUT a OUTPUT m SIP Pack m SIP Pack To Rear of Digital488 80A Unit HVCX1 High Voltage Current Interface Option Handshaking Output Lines Section Highlighted Note All of the components mentioned below are for the upper corner sections of the HVCX1 board labelled CONTROL 1 Locate the upper corners of the HVCX1 board labelled CH1 CONTROL and CHO CONTROL 2 In these CH1 CONTROL and CHO CONTROL sections the handshaking outputs are set by jumpers JP 1 and JP2 for either 5 VDC TTL or a user defined voltage see following figure for the proper jumper settings CH1 CONTROL CHO CONTROL 2596 2596 CH1 CHO JP1 ED Oc JP2 Om oo 5VDC 5VDC JP1 set for 5VDC TTL option JP2 set for User Defined option Handshaking Output Lines Sections JPI amp JP2 Options Digital488 80A User s Manual Digital488 80A Setup 15 To Install t
84. ion level of the ROM In response to this command the Digital488 80A returns a number in the format where each is a one digit number This View Version V command is not related to the above View Configuration V command But the Execute X command is not needed since View Version is still interpreted as a query command EXAMPLE PRINT 1 CLEARO8 Reset the Digital488 80A PRINT 1 OUTPUTO08 V Request the Digital488 80A firmware revision level PRINT 1 ENTERO8 INPUT 2 AS Read data from the Digital488 80A PRINT AS Display shows 1 0 or higher Digital488 80A User s Manual Digital488 80A Commands 73 X Execute SYNTAX X Execute the command string DESCRIPTION Commands sent to the Digital488 80A will result in no action until the unit is instructed to execute these commands This is done by issuing the Execute X command usually as the last character of a command string Commands sent without an X are stored in an internal buffer and are not executed until an X is received Any number of Execute X commands may be inserted into the same command string For example if the Bit Set A command is used more than once in a command string then the X command must be used after each use of the A command EXAMPLE PRINT 1 CLEARO8 Line 1 Reset the Digital488 80A PRINT 1 OUTPUTO8 F2 Line 2 Send Data Format F2 to the Digital488 80A command input buffer PRINT 1 OUTPUTO8 X Line 3 Instruct the Dig
85. ital488 80A to execute the F2 command PRINT 1 OUTPUT08 A1XA2X Line 4 Send two Bit Set A commands within the same command string 74 Digital488 80A Commands Digital488 80A User s Manual Y Bus Terminator To save a bus terminator as the new default setting use the Save Configuration S command SO DESCRIPTION At power up the IEEE 488 bus terminator defaults to the Bus Terminator Y setting saved in configuration 0 the power up configuration It may also be programmed for any combination of carriage return CR and line feed LF Mode YO is the most commonly accepted terminator CR LF Mode Y1 reverses the sequence LF CR Mode Y2 sends carriage return CR only while mode Y3 sends line feed LF only To save a bus terminator as the new default setting use the Save Configuration S command SO EXAMPLE PRINT 1 OUTPUTO8 Y3X Line 1 Select the line feed terminator Digital488 80A User s Manual Digital488 80A Commands 75 Command Support Returns present configuration or mode of the command preceding the One exception to this command description is the View Version V command which is not related to the View Configuration V command DESCRIPTION All Digital488 80A commands offer a Query option which may be used to determine the present configuration or mode of a command previously executed To use this option the first letter of the command is used followed by a question mark One exce
86. l488 80A PRINT 1 OUTPUT08 C5xX Configure all 5 ports as outputs PRINT 1 OUTPUTO8 F3X Select the ASCII decimal data format PRINT 1 OUTPUTO8 P4xX Select Port 4 PRINT 1 OUTPUTO8 S57X Save the present channel configuration as configuration 57 Digital488 80A User s Manual Digital488 80A Commands 67 Define mode n to test Digital488 80A communication where n 0or1 Turn off the TEST LED indicator on Digital488 80A front panel Turn on the TEST LED indicator on Digital488 80A front panel DESCRIPTION The Test T command is used to verify that communication has been established between the PC IEEE 488 controller and the Digital488 80A If the Test T command T1 is executed then the front panel TEST LED indicator should light up If the Test T command TO is executed then the front panel TEST LED indicator should turn off EXAMPLE PRINT 1 CLEARO8 Line 1 Reset the Digital488 80A PRINT 1 OUTPUTO8 T1X Line 2 Turn on the TEST LED indicator TEST LED should be on PRINT 1 OUTPUTO8 TOX Line 3 Turn off the TEST LED indicator TEST LED should be off 68 Digital488 80A Commands Digital488 80A User s Manual U User Status Uval Define status message val to send when the Digital488 80A is next addressed to Talk where val 0 orbit andwhere bit bit value from 1 to 40 Send status of Digital488 80A unit Send status of bit where bit bit value from 1 to 40 Note After the UO status string is
87. lacement 22 To Replace the Fuse 22 Rack Mount amp Bench Top Assembly 23 Rack Mount 23 Bench Top 23 Power Up amp Programming Tests 24 Power Up Activation 24 Programming Examples 25 KYBDCTRL BAS Program 25 To Run the Keyboard Controller Program 25 Digital488 80A Command Responses 26 4 Digital488 80A Operation Introduction 29 Handshaking Control Lines 29 Clear Pin 41 30 Data Strobe Pin 42 30 Trigger Pin 43 30 Inhibit Pin 44 31 Service Pin 45 31 External Data Ready Pin 46 31 IEEE 488 Bus Support 32 Bus Lines 32 Bus Commands 32 Bus Addresses 34 Bus Terminators 34 History 35 General Bus Structure 35 Bus Lines amp Bus Commands 36 Bus Management Lines 36 Handshake Lines 37 Data Transfer Lines 37 Bus Command Groups 38 More On Service Requests 39 6 Digital488 80A Commands Introduction 41 Command Syntax 42 Command Set amp Support 43 Command Summary 44 Command Reference 46 A Bit Set 47 B Bit Clear 48 C Configuration 49 D Data Output 50 E Query Error Status 51 F Data Format 53 G Bus Input Output 57 H Handshake 58 Invert 59 K End Or lIdentify 60 L Buffer 61 M Service Re
88. laces the Digital488 80A in the Talker Listener Idle State and pulses the Clear output line for approximately 50 microseconds e Service Request SRQ Whenever the Digital488 80A generates a Service Request SRQ a Serial Poll of either channel will return a Serial Poll Status byte of at least 64 decimal showing that the SRQ was generated by the Digital488 80A In order to determine which channel generated the SRQ use the Service Request Mask M command with the Query option or M to recall what SRQ conditions are selected The Digital488 80A returns MO if SRQs are disabled or returns a response between either M1 through M7 or M16 through M23 depending on what SRQs conditions are selected The following BASIC program illustrates one approach for handling Service Requests PRINT 1 SPOLLO8 Serial poll Channel 0 INPUT 2 SRQ08 PRINT 1 SPOLL09 Serial poll Channel 1 INPUT 2 SRQO09 PRINT 1 OUTPUT08 M Retrieve SRQ selection s from Channel 0 PRINT 1 ENTERO8 INPUT 2 M08 PRINT 1 OUTPUTO9 M Retrieve SRQ selection s from Channel 1 PRINT 1 ENTERO9 INPUT 2 M09 IF MO8 M0 THEN GOTO 500 SRQs disabled Channel 0 test Channel 1 IF MO8 M1 AND SRQO8 65 THEN GOTO 600 Service input transition routine Channel 0 IF MO8 M2 AND SRQO8 66 THEN GOTO 700 EDR input transition routine Channel 0 EDR IF MO8S M4 AND SRQO8 70 THEN GOTO 800 Bus error routine Channel 0 Note To allow the Digital488 80A to de
89. ller e Serial Poll Enable SPE When Serial Poll Enabled the Digital488 80A sets itself to respond to a Serial Poll with its Serial Poll Status byte if addressed to Talk When the Serial Poll byte is accepted by the controller any pending SRQs are cleared The Digital488 80A will continue to try to output its Serial Poll response until it is Serial Poll Disabled by the controller e Unlisten UNL UNL places the Digital488 80A in the Listener Idle State e Untalk UNT UNT places the Digital488 80A in the Talker Idle State Bus Addresses The IEEE 488 interface standard permits up to 15 devices to be configured within one system Each of these devices must have a unique address to avoid confusion In a similar fashion every building in town has a unique address to prevent one home from receiving another home s mail Exactly how each device s address is set is specific to the product s manufacturer Some are set by DIP switches in hardware others by software To determine how to set the Digital488 80A addresses refer to Chapter 2 Digital488 80A Setup IEEE 488 bus addresses are sent with bus multiline commands from the Active Controller These commands include My Listen Address MLA My Talk Address MTA Talk Address Group TAG and Listen Address Group LAG Bus Terminators The factory default setting for the Digital488 80A output terminating character is Carriage Return Line Feed CR LF If necessary it can be changed usin
90. m DIP Resistor Pack solenoids switching relays and other high ie voltage high current devices When using Connection the HVCX1 with an external voltage source the I O lines may be configured as high voltage inputs up to 50 V or as high voltage high current outputs The factory default is all 5 V I O and handshaking for both channels with all ports set as inputs Inputs are configured on a port by port basis in groups of 8 bits Inputs can be configured to be compatible with 5 12 24 and 48 volt logic The interface voltage for each port may be set independently from other ports When the HVCX1 option is used the data lines of both channels can be configured as high voltage high current outputs Outputs can support up to 50 VDC at 200 mA not to exceed 8 A total When the outputs are configured as high voltage using internal pull up resistors such as the 27K ohm SIP all 40 output lines on a channel have their pull ups and integral flyback diodes pulled up to the flyback pin Pin 48 on the DB 50 connector When used in this mode outputs are configured on a per channel basis This flyback pin should be connected to the positive supply lead of the power supply used with the external devices The flyback diode supplies protection against inductive transients 15K ohm HVCX1 Option 5 12 24 or 48 Volt Logic Input Flyback Pull Up Voltage User Connection Flyback Diode User Connection Removabl
91. mands 71 V View Configuration DESCRIPTION The View Configuration V command is used to look at a configuration previously saved without loading it for use as the present configuration In response to this command the Digital488 80A returns a string in the following format SHHHCHFHGHIF HHKHEMH FH HPHRHY D0000000000Z where each equals the option for that command saved in the requested configuration Data between the D and the Z are dependent upon the state of the I O lines at the time when the configuration was saved EXAMPLE PRINT 1 CLEARO8 Line 1 Reset the Digital488 80A PRINT 1 OUTPUT08 V18X Line 2 View configuration 18 INPUT 2 AS PRINT AS Line 4 Display is SOL8C5F2G2I000K1M016POR1Y2D0000000000Z where this message is interpreted as follows S018 Saved configuration 18 C5 All 5 ports are outputs F2 ASCII binary data format G2 Only output port data sent when addressed to Talk 1000 Data lines are active high K1 EOT disabled M016 SRQ on Ready PO All 5 ports are selected R1 Data is latched on an EDR transition Y2 Bus terminator is CR only D0000000000Z All I O lines are active low 72 Digital488 80A Commands Digital488 80A User s Manual V View Version SYNTAX View the current firmware revision level of the ROM Note This V command is not related to the above View Configuration V command DESCRIPTION The View Version V command is used to look at the firmware revis
92. mat The 3 tells Driver488 to send only the 3 byte command string F5X without terminators If this was not done the first data bytes to appear at the output of the Digital488 80A would be CR LF or whatever terminators were selected Send high speed binary data to the Digital488 80A 56 Digital488 80A Commands Digital488 80A User s Manual G Bus Input Output Gn Define mode n of data transmission on the IEEE 488 bus when the Digital488 80A is addressed to Talk where n value from 0 to 4 G Default Input and output port data are sent when addressed to Talk G Only input port data is sent G2 Only output port data is sent G3 Buffered input and output data are sent G4 Continuous buffered input and output data are sent Returns current bus input output mode n The amount of data sent is dependent upon the Port Select P command DESCRIPTION The Bus Input Output G command determines whether input port data output port data both input and output port data or buffered data are transmitted on the bus when the Digital488 80A is addressed to Talk The amount of data sent is dependent upon the Port Select P command The Bus Input Output G default mode GO causes all input and output port data to be sent to the controller when addressed to Talk Mode G1 causes only data from the ports programmed as inputs to be returned when addressed to Talk Mode G2 causes only data from ports programmed as outputs to be returned whe
93. mbly To Replace the Fuse 1 Turn off the power Next disconnect the AC power line cord and then all other cables from the unit 2 Place the unit on a flat surface Remove the four screws on top of the case and remove the top cover 3 Located next to the line voltage selection switch labelled S4 is the power fuse Gently pull upward on the plastic fuse housing The entire housing with the fuse inside should be removed 4 Open the fuse housing by pushing up on the tab on the bottom of the housing Remove the fuse and replace it with the proper type using the following list as a guide e For line voltage 105 125 V use fuse type 1 4 A Slo Blo 3AG e For line voltage 210 250 V use fuse type 1 8 A Slo Blo 3AG CAUTION Fuse Failure Fuse failure indicates a possible problem within the device circuitry Ifa fuse blows contact a qualified service representative Replacement fuses are to be installed by qualified service personnel with the unit disconnected from the power source and with all other terminals disconnected If the line voltage selector is changed then the fuse designated for that line voltage must be used 5 Close the housing Insert the fuse into the fuse holder 6 Make note of the new fuse rating for later reference If you have also changed the operating line voltage selection return to the previous section Line Voltage Selection Step 5 7 Carefully reassemble the unit Note For re assembly first reco
94. mming examples 25 Q command 65 Query command support 76 Query Error Status E command 51 80 R command 66 rack mount 23 radio interference 79 rear panel layout 6 Recall Configuration O command 63 record 81 return codes 70 S command 67 Save Configuration S command 67 AppendixB 95 secondary addressing mode 8 serial bus line 85 Serial Poll 77 Serial Poll Status Byte 77 Service input line 31 Service Request SRQ 39 Service Request Mask M command 62 setup 2 hardware 6 HVCX1 option 10 port 11 specifications 3 SPOLL 77 SRQ 39 Status U0 Return Codes 70 96 Index T command 68 terminator bus 34 Test T command 68 Trigger output line 30 U command 69 User Status U command 69 V command 72 V command 73 View Configuration V command T2 View Version V command 73 WARNING 3 6 10 20 X command 74 Y command 75 Digital488 80A User s Manual Notes Digital488 80A User s Manual Appendix B 97 Abbreviations bullet symbol and e g SCeCA asterisk symbol unasserted e g SC Not Controller Active mode Federal Communications Commission Form Feed ASCII Code File Separator ASCII Code Not System Controller mode Analog to Digital Addressed Command Group Group Execute Trigger bus command General Purpose Interface Bus Group Separator ASCII Code Acknowledgement ASCII Code An
95. n addressed to Talk Mode G3 causes data in the data buffer to be returned when addressed to Talk Both input and output data all 40 bits are returned in this mode If the count of readings in the buffer is 0 the Digital488 80A holds off the bus until the next transition of EDR and another reading has been collected and buffered After the EDR transition it returns the newly collecting reading The Digital488 80A must be readdressed to Talk to perform subsequent buffered output of EDR captured data Mode G4 is identical to mode G3 except that the Digital488 80A performs subsequent buffered output of EDR captured data until the controller stops handshaking Note If all ports are programmed as outputs with mode G1 selected and the Digital488 80A is addressed to Talk nothing is transmitted and the bus hangs The converse also causes the bus to hang if all ports are programmed as inputs with mode G2 selected CAUTION Because the Configuration C command is used the following programming example s will not work properly if the HVCX1 option is installed with a conflicting hardware configuration To be safe remove the HVCX1 board and replace it with the jumper board to run the example s EXAMPLE PRINT 1 CLEARO8 Line 1 Reset the Digital488 80A PRINT 1 OUTPUTO8 POC1ROX Line 2 Configure Port 1 as output Ports 2 through 5 as inputs PRINT 1 OUTPUTO8 G1X Line 3 Select only input ports for data PRINT 1 ENTERO8 INPUT 2 A
96. nd Flyback Digital Output Digital Output Pin 50 Pin 48 Pin 27 Pin 37 Relay eK Coil 9O samp max load DB 50 Connector Using Lines for a Lamp and Flyback Since a relay is used for this application the flyback terminal is connected to the positive terminal of the external power supply Note also that the Ground lead of the power supply should be connected to Pin 50 on the DB 50 connector Remember that ports configured as high level outputs can only be used as outputs 18 Digital488 80A Setup Digital488 80A User s Manual Digital488 80A Power amp Assembly 3 Introduction 19 Internal Components 19 Factory Service 19 Power Line amp Fuse Configuration 20 Line Voltage Selection 20 To Select the Line Voltage 21 Fuse Replacement 22 To Replace the Fuse 22 Rack Mount amp Bench Top Assembly 23 Rack Mount 23 Bench Top 23 Power Up amp Programming Tests 24 Power Up Activation 24 Programming Examples 25 KYBDCTRL BAS Program 25 To Run the Keyboard Controller Program 25 Digital488 80A Command Responses 26 Introduction Internal Components The heart of the Digital488 80A is a 6809 microprocessor U1 supported by 8K bytes of firmware EPROM U2 and 32K bytes of battery backed up RAM U3 Interface to the IEEE 488 bus is accomplished by a 9914 interface chip U13 A 65B22 U14 generates real time interrupts for the
97. nd DIP switch external for IEEE 488 addressing mode and IEEE 488 address Indicators LED indicators for TALK LISTEN SRQ ERROR TEST and POWER Power Internally selectable 105 125 or 210 250 VAC 50 60 Hz 30 VA maximum Fuse 1 4A Slo Blo 3AG for 105 125 V power line or 1 8A Slo Blo 3AG for 210 250 V power line CAUTION Line Voltage The protective conductor terminal on the AC line connector must be connected to an external protective earthing system Failure to make such a connection will impair protection from shock CAUTION Fuse Failure Fuse failure indicates a possible problem within the device circuitry Ifa fuse blows contact a qualified service representative Replacement fuses are to be installed by qualified service personnel with the unit disconnected from the power source and with all other terminals disconnected If the line voltage selector is changed then the fuse designated for that line voltage must be used Data Transfer Speeds The Digital488 80A has been measured to perform at the approximate speeds listed below The testing was done in such a way that the limiting factor was the Digital488 80A and not the IEEE 488 bus controller driving it All explanations discuss only one channel although the specifications given are valid for either channel e Collection and Storage of Data The Digital488 80A has an internal data buffer capable of storing 2000 readings of 40 bit data per channel When operating in t
98. ndshake H command should be issued to the desired channel if it is desired to pulse only one handshake line H2 e My Listen Address MLA When the Digital488 80A is addressed to Listen in the Fo through F4 format it accepts characters from the Active Talker and interprets these characters as commands and command parameters In the high speed binary format F5 the command interpreter is disabled The Digital488 80A treats all bytes received as data to be output to the digital I O ports Each time it receives 5 bytes or detects EOI it pulses the Data Strobe for approximately 15 microseconds Data is expected in a PORTS PORT4 PORT3 PORT2 PORT 1 sequence If only 2 bytes are received with EOI asserted on the second byte the Digital488 80A updates PORTS with the first byte received PORT4 with the second byte received and pulses the Data Strobe Since the Digital488 80A treats all received characters as data the User Status U command is not recognized e My Talk Address MTA In Data Ready R mode RO when the Digital488 80A is addressed to Talk the unit asserts Inhibit reads the data from all ports unasserts Inhibit and outputs the data to the bus in the format as defined by the Format F Port P and Bus Input Output G commands The output bus terminators are appended to the output with the exception of the F4 and F5 formats The F4 format does not append terminators The output format of F5 is separately described After o
99. nnect the AC power line and then any other cables prior to reapplying power to the entire system 22 Digital488 80A Power amp Assembly Digital488 80A User s Manual Rack Mount amp Bench Top Assembly The Digital488 80A includes accessories for rack mount or bench top assembly Rack Mount Plastic Screw Front or Rear of Unit Bracket 1 of 2 Attaching a Rack Mount Bracket If rack mount assembly is required remove the two plastic screws from the pre drilled holes on each side of the unit Since the unit can be mounted with the front or rear panel facing the front of the rack fixture remove only those screws from the set of holes that will be toward the front of the rack Attach the two rack ears using the enclosed screws Bench Top If bench top assembly is required install the self adhesive rubber feet on the bottom of the unit approximately one inch from each corner Digital488 80A User s Manual Digital488 80A Power amp Assembly 23 Power Up amp Programming Tests Power Up Activation CAUTION Line Voltage The protective conductor terminal on the AC line connector must be connected to an external protective earthing system Failure to make such a connection will impair protection from shock LED Patterns for Error Conditions Aa LED Indicators Condition TALK LISTEN SRQ ERROR TEST POWER Normal No Errors Off Off Off Off Off ON ROM Error ON ON ON ON ON ON RAM Error FLASHING F
100. ntrol 1 DC1 Not defined Normally used for ON controls Device Control 2 DC2 Usually user defined Device Control 3 DC3 Not defined Normally used for OFF controls Device Control 4 DC4 Usually user defined Negative Acknowledgement NAK No answer to questions or errors found re transmit Used in asynchronous protocols for timing Synchronous Idle SYN Sent by asynchronous devices when idle to insure sync End of Transmission Block ETB Marks block boundaries in transmission Cancel CAN Indicates previous transmission should be disregarded End of Medium EM Marks end of physical media as in paper tape Substitute SUB Used to replace a character known to be wrong Escape ESC Marks beginning of an Escape control sequence File Separator FS Marker for major portion of transmission Group Separator GS Marker for submajor portion of transmission Record Separator RS Marker for minor portion of transmission Unit Separator US Marker for most minor portion of transmission Note 1 ASCII control codes are sometimes used to formalize a communications session between communication devices 2 DC1 DC2 DC3 DC4 FS GS RS and US all have user defined meanings and may vary in use between sessions or devices 3 DC4 is often used as a general stop transmission character 4 Codes used to control cursor position may be used to control print devices and move the print head accordingly Howeve
101. o the I O port buffer This line is normally active high but may be programmed active low 11 by the nvert I command The Inhibit line can be programmed independent of any I O operations with the nhibit Q command The Inhibit line is asserted once for each data read operation for all Format F modes except high speed binary F5 In this mode it is asserted for the first data read after the Digital488 80A is addressed to talk On the last data byte transfer the data are read again with Inhibit asserted in anticipation of another data transfer If Inhibit is used to sequence external hardware you should be aware that this line pulses N times where N is the number of total 5 byte data transfers The Inhibit Line is not pulsed when reading a particular bit status using the User Status U command 50 us typ gt Data Valid pa us ai Inhibit Data 10 us min gt 1 us min EDR I lt 50 ps typ Timing Diagram for EDR Input amp Inhibit Output Service Pin 45 The Service input is an edge sensitive input capable of generating a bus Service Request SRQ It is enabled with the Service Request Mask M command and defaults to rising edge sensitive The nvert I command can be used to program it to be falling edge sensitive 164 External Data Ready Pin 46 The External Data Ready EDR line is an edge sensitive input used to latch input data Itis used in conjunction with the D
102. on in a similar way with a method of data transfer called handshaking For data transfer on the IEEE 488 interface the Active Controller must Unlisten all devices to protect against eavesdroppers Designate a device who will talk by addressing it to Talk Designate all the devices who will listen by addressing them to Listen Indicate to all devices that the data transfer can take place Bus Lines amp Bus Commands Bus Management Lines 36 For the general control and coordination of bus activities five hardware lines on the IEEE 488 interface are used for bus management Signals on these lines are often referred to as uniline single line commands The signals are active low 1 e a low voltage represents an asserted logic of 1 and a high voltage represents an unasserted logic of 0 e Interface Clear IFC The IFC line is used only by the System Controller It is used to place all bus devices in a known state Although device configurations vary the 1FC command usually places the devices in the Talk and Listen Idle states neither Active Talker nor Active Listener e Remote Enable REN When the System Controller sends the REN command bus devices will respond to remote operation Generally the REN command should be issued before any bus programming is attempted Only the System Controller has control of the Remote Enable line e Attention ATN The ATN line is one of the most important lines for bus management I
103. oswitches 6 and 7 are ignored SI Factory Default Settings Note DIP switch S1 is read only during power up For this reason you must make any setting changes prior to applying power to the unit To modify the default settings disconnect the power cord from the AC line and change the microswitch settings using a small screwdriver The enclosure does not need to be opened to change the DIP microswitch settings IEEE 488 Bus Address Selection The IEEE 488 bus address is set by positioning the rear panel DIP microswitches through 5 The address can be set from 0 through 30 and is read only at power on The address is selected by simple binary weighting with microswitch 1 being ae the Least Significant Bit LSB with a value of 1 T TEP and microswitch 5 the Most Significant Bit MSB er Es with a value of 16 The factory default setting is gt 0x4 0 address 8 as shown in the diagram A a Z i Note If address 31 is selected it defaults to IEEE 488 Address 8 sum address 30 because the IEEE 488 standard has reserved address 31 SI IEEE 488 Bus Address Selection Note The Digital488 80A bus address must agree with the IEEE 488 controller address Addressing Mode Selection The Digital488 80A can be operated in one of two addressing modes Dual Primary addressing mode or Secondary addressing mode which are selected by the rear panel DIP microswitch 8 The factory default setting for mic
104. p TAG mi Aimi Ni K iM S K Hanai WiO gt At Sign Capital A Capital B Capital C Capital D Capital E Capital F Capital G Capital H Capital Capital J Capital K Capital L Capital M Capital N Capital O Capital P Capital Q Capital R Capital S Capital T Capital U Capital V Capital W Capital X Capital Y Capital Z Opening Bracket Backward Slash Closing Bracket Caret Underscore Bus address 00 Bus address 01 Bus address 02 Bus address 03 Bus address 04 Bus address 05 Bus address 06 Bus address 07 Bus address 08 Bus address 09 Bus address 10 Bus address 11 Bus address 12 Bus address 13 Bus address 14 Bus address 15 Bus address 16 Bus address 17 Bus address 18 Bus address 19 Bus address 20 Bus address 21 Bus address 22 Bus address 23 Bus address 24 Bus address 25 Bus address 26 Bus address 27 Bus address 28 Bus address 29 Bus address 30 Untalk UNT Digital488 80A User s Manual Decimal Values 96 to 127 SCG ASCII Character Set 96 to 127 Dec Hex Character Name Bus Message Secondary Command Group SCG Secondary Command Group SCG Digital488 80A User s Manual a a E e A S E a E O O TE S E o E D ue KO Mi Siqicicin NES wi ima Grave Lowercase A Lowercase B Lowercase C Lowercase D Lowercase E Lowercase F Lowercase G Lowercase H Lowercase Lowercase J Lowercase K Lowercase L Lowercase M Lowercase N Lowercase O Lowercase
105. port When addressed to Listen the unit accepts input data and programming information from the controller and outputs the data to the appropriate I O port Digital I O Lines The Digital488 80A has 80 TTL level digital I O lines that are divided into two 40 bit channels Each channel is divided into five eight bit ports Six high level ASCII commands configure the ports to be all inputs all outputs or combinations in between Thus a configuration can range from 80 input lines to 80 output lines or combinations in between in multiples of 8 bits Handshaking Control Lines Each 40 bit channel has six handshaking control lines The Clear Pin 41 output line is pulsed whenever a Device Clear DCL or Selected Device Clear SDC command is received from the IEEE 488 controller The Data Strobe Pin 42 output is pulsed when the IEEE 488 controller presents new data on the I O lines The Trigger Pin 43 output signal is pulsed when a Group Execute Trigger GET command is received on the bus The Inhibit Pin 44 output line is asserted while the IEEE 488 controller is reading data from input lines The Service Pin 45 line is an edge triggered input that generates a Service Request on the bus The External Data Ready Pin 46 input line is used to latch digital input data on the I O lines Digital488 80A User s Manual Digital488 80A Overview 1 HVCX1 High Voltage Current Interface Option The HVCX1 option permits the I O lines to be configured a
106. ption to this command description is the View Version V command which is not related to the View Configuration V command Any number of these Query commands may be combined into one string to allow the user to construct a specialized status command requesting the Digital488 80A to return only that information which is of interest for a given application The Execute X command is not needed when using the Query option of a command EXAMPLE 1 Channel 1 SRQ Status PRINT 1 CLEARO8 Reset the Digital488 80A PRINT 1 OUTPUTO8 M4X Select SRQ on IEEE 488 bus error PRINT 1 OUTPUTO8 M Determine the last Service Request Mask M command executed PRINT 1 ENTERO8 Read data from the Digital488 80A INPUT 2 AS PRINT AS Display shows M4 EXAMPLE 2 Using the User Status U Command to Return Channel 1 Status PRINT 1 CLEARO8 Line 1 Reset the Digital488 80A PRINT 1 OUTPUTO8 U0X Line 2 Request the status of Channel 1 PRINT 1 ENTERO8 Line 3 Read data from the Digital488 80A INPUT 2 AS PRINT AS Line 5 Display shows the status message CHEFFHCHLHFHKHLEFHEMHHFHEPHRESHHY EXAMPLE 3 Using a Query Command String to Return the Same Channel 1 Status PRINT 1 CLEARO8 Line 1 Reset the Digital488 80A PRINT 1 OUTPUT0O8 V C E Line 2 Request the status of Channel 1 F G I K L M P R S Y X PRINT 1 ENTERO8 Line 3 Read data from the Digital488 80A INPUT 2 AS PRINT AS Line 5 Display shows the
107. quest Mask 62 O Recall Configuration 63 P Port Select 64 Q Inhibit 65 R Data Ready 66 S Save Configuration 67 T Test 68 U User Status 69 V View Configuration 72 V View Version 73 X Execute 14 Query 76 Digital488 80A User s Manual 7 Troubleshooting Radio Interference Problems 79 Electrostatic Discharge ESD Damage 79 Other Issues 79 Power Up Activation 19 Buffer Overrun 80 Query Error Status 80 A Appendix A Digital488 80A HVCX1 Configuration Record 81 Hardware Setup 81 Software Setup 82 DB 50 Connector Wiring Reference 83 B Appendix B IEEE 488 Bus amp Serial Bus Lines 81 IEEE 488 Bus Commands 86 ASCII Codes 87 ASCII Code Summary 87 Decimal Values 00 to 63 ACG UCG amp LAG 87 Decimal Values 64 to 127 TAG amp SCG ASCII Code Details 89 Decimal Values 00 to 31 ACG amp UCG Characteristics 89 Decimal Values 00 to 31 ACG amp UCG Descriptions 90 Decimal Values 32 to 63 LAG 91 Decimal Values 64 to 95 TAG 92 Decimal Values 96 to 127 SCG 93 Digital488 80A User s Manual Notes iv Digital488 80A User s Manual Digital488 80A Overview 1 Introduction 1 Addressing Modes 1 Digital I O Lines 1 Handshaking Control Lines 1 HVCX1 High
108. r not all devices support the full set of positioning codes 90 Appendix B Digital488 80A User s Manual Decimal Values 32 to 63 LAG ASCII Character Set Decimal 32 to 63 Dec Hex Character Name Bus Message Listen Address Group LAG Listen Address Group LAG Digital488 80A User s Manual lt space gt Wi OPN ND UiA Wi NiP Space Exclamation Point Quotation Mark Number Sign Dollar Sign Percent Sign Ampersand Apostrophe Opening Parenthesis Closing Parenthesis Asterisk Plus Sign Comma Hyphen or Minus Sign Period Slash Zero One Two Three Four Five Six Seven Eight Nine Colon Semicolon Less Than Sign Equal Sign Greater Than Sign Question Mark Bus address 00 Bus address 01 Bus address 02 Bus address 03 Bus address 04 Bus address 05 Bus address 06 Bus address 07 Bus address 08 Bus address 09 Bus address 10 Bus address 11 Bus address 12 Bus address 13 Bus address 14 Bus address 15 Bus address 16 Bus address 17 Bus address 18 Bus address 19 Bus address 20 Bus address 21 Bus address 22 Bus address 23 Bus address 24 Bus address 25 Bus address 26 Bus address 27 Bus address 28 Bus address 29 Bus address 30 Unlisten UNL AppendixB 91 Decimal Values 64 to 95 TAG 92 Appendix B ASCII Character Set Decimal 64 to 95 Dec Hex Character Name Bus Message Talk Address Group TAG 2S DPN G AHN Q MA ALD Aa wip Talk Address Grou
109. r in the Digital488 80A can store up to 8 000 bytes which is large enough to capture two thousand patterns from one 40 bit I O channel When interfacing to slow devices the data buffer relieves the controller of the need to constantly read data from the Digital488 80A Software Programmable Features The software programmable features on the Digital488 80A include data formats individual bit set and bit clear commands and terminators The six available data formats are ASCII hexadecimal ASCII character ASCII binary binary high speed binary and ASCII decimal The programmable terminators facilitate interfacing to various controllers Using the User Status U command the controller can check the programmed status of the Digital488 80A at any time With the Query option offered with each Digital488 80A command user defined status command strings can be built to request the status information needed for a given application Accessories Additional accessories that can be ordered for the Digital488 80A include CA 1 Power cable CA 7 1 1 5 foot IEEE 488 cable CA 7 3 6 foot shielded IEEE 488 cable CA 7 4 6 foot reverse entry IEEE 488 cable CA 88 6 foot 50 pin D shell ribbon cable CN 20 Right angle IEEE 488 adapter male and female CN 22 IEEE 488 multi tap bus strip four female connectors in parallel CN 23 IEEE 488 panel mount feed through connector male and female 2 Digital488 80A Overview Digital488 80A User s Manual
110. re subject to change without notice Significant changes will be addressed in an addendum or revision to the manual As applicable IOtech calibrates its hardware products to published specifications Periodic hardware calibration is not covered under the warranty and must be performed by qualified personnel as specified in this manual Improper calibration procedures may void the warranty Quality Notice IOtech has maintained ISO 9001 certification since 1996 Prior to shipment we thoroughly test our products and review our documentation to assure the highest quality in all aspects In a spirit of continuous improvement IOtech welcomes your suggestions Introduction to this Manual This manual covers the setup and operation of the Digital488 80A 80 bit IEEE 488 Digital I O interface system This manual is organized as follows Chapter I Digital488 80A Overview gives an overview of the basic features of a Digital488 80A system Digital488 80A accessories and specifications are also provided Chapter 2 Digital488 80A Setup explains in detail the various hardware features of the Digital488 80A unit Chapter 3 Digital488 80A Power amp Assembly provides detailed instructions on line voltage selection and fuse replacement rack mount and bench top installation as well as power up activation Chapter 4 Digital488 80A Operation explains the Digital488 80A internal operation Descriptions of the handshaking control lines as well
111. read by the controller any error conditions are cleared DESCRIPTION The User Status U command U0 causes the Digital488 80A to send the status message when next addressed to Talk while the command Ubit where bit is the bit value from 1 to 40 enables the controller to read any single bit from the I O ports The UO status string of the Digital488 80A may be read at any time without interfering with normal operation and after the string is read by the controller any error conditions are cleared When the command U0 is received the format of the UO status byte returned by the Digital488 80A is as follows CHEH FHGHI K HLFFFEMEFHEPHRHY where each equals the parameter s corresponding to that command The leading information is the revision level of the Digital488 80A firmware When the command Ubit is received the format of the Ubit status message is an ASCII character 1 or 0 depending on the level of the data line and the state of the Invert I command 116 EXAMPLE 1 User Status U0 Digital488 80A Status PRINT 1 CLEARO8 Line 1 Reset the Digital488 80A PRINT 1 OUTPUTO8 U0X Line 2 Request the status of the Digital488 80A PRINT 1 ENTERO8 INPUT 2 A Line 4 Read the status byte PRINT AS Line 5 Display shows 1 OCOEOFOGOIOOOKOLOOOOMOOOPOROSOOYO EXAMPLE 2 User Status Ubit Bit Status PRINT 1 CLEARO8 Line 1 Reset the Digital488 80A PRINT 1 OUTPUT08 U22X Line 2 Request the status of the Bi
112. readdressed to Talk to perform subsequent reads In Data Ready R mode R1 or R2 EDR may also be used to capture data in this data format Data Format F2 ASCII Binary In Data Format F2 each data bit is described with an ASCII 0 or 1 Each byte is formatted in two 4 bit multiples separated by semi colons 0000 0001 0000 1010 0000 0110 0000 1111 0000 0111 1000 0001 Data received for output to the digital ports must be contained within a D command prefix and a Z terminator suffix and each 4 bit quantity must be separated by semi colons Leading zeros are not required If the amount of data sent is less than the number of bits programmed as outputs then the least significant bits contain the data sent and the most significant bits are cleared to logic 0 If the data sent is greater than the number of bits programmed for output or selected by the Port Select P command then the Digital488 80A generates a Conflict Error E3 and ignores the entire command string up to the next Execute X command The Data Strobe output is pulsed for approximately 50 microseconds after new data is output on the selected port s a ae 10 55 When the Digital488 80A is addressed to Talk in Data Ready R mode RO it asserts Inhibit reads the data from all 5 ports unasserts Inhibit and outputs the number of characters determined by the Bus Input Output G and Port Select P commands Leading zeros are not suppressed and the bus terminators are app
113. rogrammed R mode returns EDR cannot be used to capture data in the high speed binary format F5 When addressed to Talk in this format it asserts Inhibit reads the data from all ports unasserts Inhibit and outputs the binary data to the bus with EOI asserted on the fifth byte When the last data byte is transferred the data is read again in anticipation of another data transfer If Inhibit is used to sequence external hardware this line pulses N times where N is the number of total 5 byte data transfers In this format the Digital488 80A does not have to be readdressed to Talk to read the ports multiple times With all F formats the data is output in a PORTS PORT4 PORT3 PORT2 PORT1 sequence Digital488 80A User s Manual Digital488 80A Operation 33 e Selected Device Clear spc In the Fo through F4 formats Device Clear resets the Digital488 80A to its power on default state and pulses the Clear output line for approximately 50 microseconds If either channel is in the high speed binary data format F5 a DCL or SDC to either channel enables the command interpreter on the channel in the F5 mode and then changes the format to Fo All other parameters remain unchanged In addition the Clear output line is not pulsed by DCL or spc when either channel is in the F5 mode This is the only programmable method to exit the F5 format e Serial Poll Disable SPD Disables the Digital488 80A from responding to Serial Polls by the contro
114. roswitch 8 is Dual Primary addressing mode in the up position as shown in the diagram A detailed description of the Dual Dual Primary Addressing Mode Secondary Addressing Mode Primary and Secondary addressing modes is provided in the following text SI Addressing Mode Selection Digital488 80A User s Manual Digital488 80A Setup 7 Dual Primary Addressing Mode The Digital488 80A can be thought of as two identical IEEE 488 to digital I O interfaces Each interface occupies one bus address and has one I O channel For this reason the Digital488 80A occupies two bus addresses in an IEEE 488 system The default addressing mode on the Digital488 80A is Dual Primary in which two consecutive bus addresses are used Dual Primary addressing offers ease of use at the expense of two bus address locations This may not be practical for applications in which the bus address locations are required by other equipment In these situations Secondary addressing mode may be used Secondary addressing uses a single bus address for multiple interfaces When Dual Primary addressing mode is selected with DIP microswitch 8 in the up position then microswitch 1 LSB of the address is ignored The Channel 0 interface resides at an even numbered bus address while the Channel 1 interface resides at the next higher odd address For example if the address switches are set for IEEE 488 bus address 8 Channel 0 s interface resides at b
115. s This line indicates to the Talker that each device addressed to Listen has accepted the information Each device releases NDAC high at its own rate but the NDAC will not go high until the slowest Listener has accepted the data byte Data Transfer Lines To transfer bit parallel byte serial information between devices on the bus the IEEE 488 interface provides eight data lines DIO1 through DIo8 These data lines are bidirectional and are active low Digital488 80A User s Manual IEEE 488 Background 37 Bus Command Groups Bus multiline commands are bytes sent by the Active Controller over the data bus with Attention ATN asserted These commands are sent to all devices and are divided into the following 5 groups Addressed Command Group ACG These commands affect only those devices which have previously been addressed to be a Listener There are 5 bus line addressed commands GET GTL PPD SDC and TCT Universal Command Group UCG These commands cause every instrument on the bus to carry out the bus function specified if the instrument is capable of it There are 5 bus line universal commands DCL LLO PPU SPD and SPE Listen Address Group LAG These commands address to Listen specified bus devices There are 31 0 to 30 Listen addresses associated with this group The 3 most significant bits of the data bus are set to 001 while the 5 least significant bits are the address of the device being told to Listen Talk Ad
116. s high voltage up to 50 V inputs or as high voltage high current outputs up to 200 mA sink capability to allow interfacing with solenoids switching relays and other high voltage high current devices using an external voltage source It allows interfacing to non TTL level devices by offering compatibility with 12 24 and 48 volt logic The individual 8 bit ports can be configured to control high current open collector drivers Each high current driver has an internal fly back diode for protection when switching inductive devices such as relays When the HVCX1 option is used the six handshake and control lines can also interface to 12 24 or 48 volt logic Power Up amp Setup Configuration The Digital488 80A allows up to 100 configurations for each channel to be created The configurations are stored in non volatile memory which enables the input output status and logic level of every I O line to be defined when power is applied The configurations can be called from a single pre defined command from the IEEE 488 controller This allows easy configuration of the device for a variety of applications Internal pull up resistors ensure a logic high the instant power is applied When using the HVCX1 option with high current driver outputs the internal pull up resistors ensure that the high current driver outputs are switched off the instant power is applied a requirement for process control applications Internal Buffer A built in data buffe
117. s the number of port readings in the internal data buffer from 0 to 2000 DESCRIPTION The Buffer L command is used to clear the internal data buffer or to determine the number of readings in the buffer It is used primarily with the Data Ready R command R2 data is latched and buffered on an EDR transition although it may be used at any time to determine the buffer status CAUTION Because the Configuration C command is used the following programming example s will not work properly if the HVCX1 option is installed with a conflicting hardware configuration To be safe remove the HVCX1 board and replace it with the jumper board to run the example s EXAMPLE PRINT 1 OUTPUTO8 COPOR2G3X Line 1 Buffer data to be sent when addressed to Talk collect some data PRINT 1 OUTPUTO8 L X Line 2 Request buffer status of Channel 0 PRINT 1 ENTERO8 INPUT 2 COUNTS COUNTS RIGHTS COUNTS 4 COUNT VAL COUNTS PRINT COUNT i Display shows 24 24 port readings in buffer DIM B 100 i Store readings in an array FOR I 1 TO COUNT i Readings are stored as integers PRINT 1 ENTERO8 INPUT 2 AS B I VAL RIGHTS AS 4 NEXT I PRINT 1 OUTPUTO8 L X Line 14 Request buffer status PRINT 1 ENTERO8 INPUT 2 COUNTS PRINT COUNTS Line 17 Display shows L000 since all data has been read Digital488 80A User s Manual Digital488 80A Commands 61 M Service Request Mask SYNTAX Mmask Define
118. s used the following programming example s will not work properly if the HVCX1 option is installed with a conflicting hardware configuration To be safe remove the HVCX1 board and replace it with the jumper board to run the example s EXAMPLE 1 Using Dual Primary addressing mode to communicate with Channel 0 PRINT 1 CLEARO8 i Reset the Digital488 80A PRINT 1 OUTPUT08 C5POX i Configure all 5 ports as output select all 5 ports PRINT 1 OUTPUTO8 A22X i Set Bit 22 to a logic 1 5 volts PRINT 1 OUTPUT08 A23X A24xX i Set Bits 23 and 24 to a logic 1 5 volts EXAMPLE 2 Using Secondary addressing mode to communicate with Channel 0 PRINT 1 CLEARO800 Line 1 Reset the Digital488 80A PRINT 1 OUTPUT0800 C5POX Line 2 Configure all 5 ports as output select all 5 ports PRINT 1 OUTPUT0800 A22X Line 3 Set Bit 22 to a logic 1 5 volts PRINT 1 OUTPUT0800 A23X A24xX Line 4 Set Bits 23 and 24 to a logic 1 5 volts Digital488 80A User s Manual Digital488 80A Commands 47 B Bit Clear SYNTAX Clear bit to logic 0 where bit bit value from 1 to 40 Returns bit of the last bit that was a DESCRIPTION The Bit Clear B command clears to a logic 0 an output bit described by the argument bit Clearing a bit may represent either a 0 volt or a 5 volt output depending on whether an Invert command I16 has been sent If data is active high default condition then Bit Clear outputs O volts If
119. same status message CHEFFHCHLHHHKHLEFHEMHHHEPHRESHHY 76 Digital488 80A Commands Digital488 80A User s Manual Serial Poll Status Byte SUMMARY The Serial Poll Status byte is sent upon receiving the Serial Poll SPOLL command from the IEEE 488 bus controller prog 8 Not usedralways logic MSB Not used always logic 0 DESCRIPTION The Serial Poll Status byte is sent upon receiving the Serial Poll SPOLL command from the controller Refer to the Service Request Mask M command description for details on how the Serial Poll Status byte is affected To enable each bit to reflect the true status of the device the appropriate M command must be executed The significance of each bit in the Serial Poll Status byte is shown below DIO1 When enabled by the M1 command the DIO1 bit is set by a transition on the Service input line its active transition state determined by the Invert I command 164 DIO1 is cleared after the controller Serial Polls the Digital488 80A DIO2 When enabled by the M2 command the DIO2 bit is set by a transition on the EDR input line its active transition state determined by the Invert I command I32 DIO2 is cleared after the controller Serial Polls the Digital488 80A DIO3 The DIO3 bit is set when an invalid command is sent to the Digital488 80A The M4 command enables a Service Request SRQ to occur when an invalid command is received The bit is cleared after the controller sends the User St
120. sed to latch digital input data on the I O lines These lines are more fully discussed in the following text Handshaking Control Lines The six control lines on each channel enable handshaking of digital I O data transfer to the Digital488 80A They are automatically activated with the corresponding I O activity and can also be independently activated with the Handshake H command For all descriptions that follow information on the function and action of a given line is true for both channels except where noted Digital488 80A User s Manual Digital488 80A Operation 29 Clear Pin 41 DCL SDC or IFC mE I 65 ps typ 50 ps typ Timing Diagram for Clear Output The Clear output can be pulsed for approximately 50 microseconds after a Device Clear DCL Selected Device Clear SDC or Interface Clear IFC command has been sent on the bus determined by the Format F mode of each channel Execution of an SDC to either channel or a DCL affects both channels The effect depends on whether either channel is in the High Speed Binary F5 mode If in the F5 mode the channels in this mode have their command interpreter re enabled and then they are returned to the ASCII Hexadecimal F0 mode All other parameters remain unchanged In addition the Clear lines on both channels are not pulsed If neither channel is in the F5 mode an SDC to either channel or a DCL returns both channels to their power up configuration an
121. summed from the following states 0 Default All handshaking control lines are active high all data lines are high true 1 The Inhibit output line is active low 2 The Trigger output line is active low 4 The Data Strobe output line is active low 8 The Clear output line is active low 16 The Data lines are low true 32 The EDR input line is falling edge sensitive 64 The Service input line is falling edge sensitive I Returns the last Invert command executed The Invert commands are ORed together as received To delete any one command it is necessary to program the default mode I0 then reprogram the desired commands DESCRIPTION The Invert I command is used to change the polarity of the handshaking and data lines At power up all handshaking control lines are active high logic 1 5 volts The Invert command can selectively change the polarity of each of the handshaking control lines and the polarity of the set of data lines If multiple Invert commands are contained within the same string an Execute X command should be included at the end of each Invert command An alternative is to add up the values of each Invert command desired and send a single command with the sum of the desired commands The Invert commands are ORed together as received To delete any one command it is necessary to program the default mode I0 then reprogram the desired commands EXAMPLE 1 PRINT 1 CLEARO8 Line 1 Reset the Digital
122. t 22 INPUT 2 A Line 3 Read the status message PRINT A Line 4 Display shows 0 Message is dependent upon the signal applied to the input Digital488 80A User s Manual Digital488 80A Commands 69 System Status U0 Return Codes CEET mo f noen me mema DaaBuiorOvern O O OOo C Note Except Tor E5 error is cleared upon reading error status O a Daarom OOOO ro ASCII hexadecimal 4 bits per character SOS ASCIl decimal 8 bits per number F4 Binary each byte 8 bits Note In Data Format F5 high speed binary the command interpreter is disabled Wote The status message reflects the sum of all received Invert commands 70 Digital488 80A Commands Digital488 80A User s Manual CRE Ea ordentiy KO EOI enabled assert EOI on last byte transferred EOI disabled do not assert EOT on last byte transferred HHHH Buffer HHHH The number of port readings in the internal data buffer from 0 to 2000 ervice Request Mask RQ is disabled RQ on Service input transition RQ on EDR input transition RQ on IEEE 488 bus error RQ on Ready he status message reflects the sum of all received Service Request Mask commands Port 4 selected Port 5 selected Data Ready Data is not latched but is read whenever the Digital488 80A is addressd Data is latched on an EDR transition Data is latched and buffered on an EDR transition Digital488 80A User s Manual Digital488 80A Com
123. tect each of the above conditions the Service Request Mask M command must be executed for each condition More extensive comparisons of the Serial Poll Status Byte and the M response are needed if multiple SRQ conditions are selected Refer to the Service Request Mask M command in Chapter 6 Digital488 80A Commands The Digital488 80A unit may be programmed to generate an SRQ on power up by selecting the SRQ on Ready option M16 of the Service Request Mask M command and saving this selection as part of the power up configuration Configuration 0 Bus Commands The following IEEE 488 bus commands are supported by Digital488 80A 32 Digital488 80A Operation Digital488 80A User s Manual e Device Clear DCL Inthe Fo through F4 formats Device Clear resets the Digital488 80A to its power on default state and pulses the Clear output line for approximately 50 microseconds If either channel is in the high speed binary data format F5 a DCL or SDC to either channel enables the command interpreter on the channel in the F5 mode and then changes the format to Fo All other parameters remain unchanged In addition the Clear output line is not pulsed by DCL or spc when either channel is in the F5 mode This is the only programmable method to exit the F5 format e Group Execute Trigger GET When the Digital488 80A recognizes a GET on either channel it pulses the Trigger output lines on both channels for approximately 50 microseconds The Ha
124. tens This is not the case with the IEEE 488 interface The Active Controller selects which devices will Listen and commands all other devices to ignore what is being transmitted A device is instructed to Listen by being Addressed to Listen This device is then referred to as an Active Listener Devices which are to ignore the data message are instructed to Unlisten The reason some devices are instructed to Unlisten is quite simple Suppose a college instructor is presenting the day s lesson Each student is told to raise their hand if the instructor has exceeded their ability to keep up while taking notes Ifa hand is raised the instructor stops his discussion to allow the slower students the time to catch up In this way the instructor is certain that each and every student receives all the information he is trying to present Since there are a lot of students in the classroom this exchange of information can be very slow In fact the rate of information transfer is no faster than the rate at which the slowest note taker can keep up The instructor though may have a message for one particular student The instructor tells the rest of the class to ignore this message Unlisten and tells it to that one student at a rate which he can understand This information transfer can then happen much quicker because it need not wait for the slowest student Digital488 80A User s Manual IEEE 488 Background 35 The IEEE 488 interface transfers informati
125. the error status EXAMPLE 4 Invalid Command Parameter PRINT 1 OUTPUTO8 P8xX Line 1 Send command with an invalid option no P8 command option exists PRINT 1 OUTPUTO08 E Line 2 Query the error status ERROR LED should be on PRINT 1 ENTERO8 INPUT 2 AS PRINT AS Line 5 Display shows E2 Invalid Parameter ERROR LED should be off EXAMPLE 5 Command Conflict Error See Next Page Digital488 80A User s Manual Digital488 80A Commands 51 CAUTION Because the Configuration C command is used the following programming example s will not work properly if the HVCX1 option is installed with a conflicting hardware configuration To be safe remove the HVCX1 board and replace it with the jumper board to run the example s EXAMPLE 5 Command Conflict Error PRINT 1 OUTPUTO8 GOC5P1X Line 1 Configure all 5 ports as outputs select Port 1 only PRINT 1 OUTPUT08 D123456ZX Line 2 Send too much data for one port PRINT 1 OUTPUTO08 E Line 3 Query the error status ERROR LED should be on PRINT 1 ENTERO8 INPUT 2 AS PRINT AS Line 6 Display shows E3 Conflict Error ERROR LED should be off 52 Digital488 80A Commands Digital488 80A User s Manual F Data Format F F2 P3 F Returns current data format n SYNTAX rj J UI He DESCRIPTION The Data Format F command determines the method by which input and output data are described The six available data formats are discusse
126. timeter Data Set Ready line Data Terminal Ready line Electronically Erasable Programmable ROM End of Medium ASCII Code Non Volatile RAM Peripheral Component Interconnect bus Parallel Poll Configure bus command Parallel Poll Disable bus command Parallel Poll Unconfig bus command Random Access Memory ENQ EOI EOL Inquiry ASCII Code End Or ldentify line End Of Line terminator Remote Enable line Ring Indicator line Root Mean Square EOT EPROM ESB End of Transmission ASCII Code Erasable Programmable ROM Event Status Register bit Read Only Memory Request for Service bit Record Separator ASCII Code ESC ESC ESE Error Source Register Escape ASCII Code Event Status Enable Register Revised Standard e g RS 232 RS 422 Request for Service bit Resistance Temperature Device ESR ETB ETX Event Status Register End of Transmission Block ASCII Code End of Text ASCII Code 98 Abbreviations Request To Send line System Controller mode Secondary Command Group Digital488 80A User s Manual Standard Cmds for Programmable Instruments Substitute ASCII Code Small Computer System Interface bus Synchronous Idle ASCII Code Selected Device Clear bus command Thermocouple Shift In ASCII Code Talk Address Group bus command Shift Out ASCII Code Take Control bus command Start of Header ASCII Code Transistor Transistor Logic Serial Poll Disable bus command Universal Command Group Seri
127. to Talk The device retrieves data from the serial input buffer and outputs it to the IEEE 488 bus It substitutes the selected IEEE 488 bus terminators for the received serial terminators The device will continue to output serial input buffer data as long as the IEEE 488 controller allows Parallel Poll Configure PPc This command configures devices capable of performing a Parallel Poll via the data bit they are to assert in response to a Parallel Poll Parallel Poll Disable PPD This command disables the Parallel Poll response of selected devices Parallel Poll Unconfigure PPU This disables all devices from responding to a Parallel Poll Selected Device Clear SDC This command causes a single device to be initialized to a pre defined or power up state 38 IEEE 488 Background Digital488 80A User s Manual e Serial Poll Disable SPD The command disables all devices from sending their Serial Poll status byte e Serial Poll Enable SPE This command when ATN is unasserted will cause a device that is addressed to Talk to output its Serial Poll status byte e Take Control TCT This command passes bus control responsibilities from the current Controller to another device which has the ability to control e Unlisten UNL This command places the device in the Listen Idle state e Untalk UNT This command places the device in the Talk Idle state More On Service Requests Most of the commands covered both uniline and multilin
128. transfer and control protocols The use of the IEEE 488 standard has moved the responsibility of the user from the design of the interface to the design of the high level software that is specific to the measurement application General Bus Structure The main purpose of the IEEE 488 interface is to transfer information between two or more devices A device can either be an instrument or a computer Before any information transfer can take place it is first necessary to specify which will do the talking send data and which devices will be allowed to listen receive data The decision of who will Talk and who will Listen usually falls on the System Controller which is at power on the Active Controller The System Controller is similar to a committee chairman On a well run committee only one person may speak at a time and the chairman is responsible for recognizing members and allowing them to have their say On the bus the device which is recognized to speak is the Active Talker There can only be one Talker at a time if the information transferred is to be clearly understood by all The act of giving the floor to that device is called Addressing to Talk If the committee chairman cannot attend the meeting or if other matters require his attention he can appoint an acting chairman to take control of the proceedings For the IEEE 488 interface this device becomes the Active Controller At a committee meeting everyone present usually lis
129. uery Error Status E command is used to determine the present error condition on the selected channel of the Digital488 80A After execution of the E command the present error condition is cleared The error condition is also cleared by executing the User Status U command U0 When an error has occurred the front panel ERROR LED indicator turns on The ERROR LED stays on until an E or UO command is executed If a Non Volatile RAM Checksum Failure E5 occurs then it can only be cleared by doing a save of the configuration using the Save Configuration S command Executing this command updates the checksum to a known value and clears the E5 error condition EXAMPLE 1 No Error PRINT 1 CLEARO8 Line 1 Reset the Digital488 80A PRINT 1 OUTPUTO08 E Line 2 Query the error status PRINT 1 ENTERO8 INPUT 2 AS PRINT AS Line 5 Display shows EO no errors have occurred EXAMPLE 2 Unrecognized Command PRINT 1 OUTPUTO8 W5X Line 1 Send an illegal command to the Digital488 80A no W command exists PRINT 1 OUTPUTO8 E Line 2 Query the error status ERROR LED should be on PRINT 1 ENTERO8 INPUT 2 AS PRINT A Line 5 Display shows E1 Unrecognized Command ERROR LED should be off EXAMPLE 3 Error is cleared PRINT 1 OUTPUTO8 E Line 1 Query the error status PRINT 1 ENTERO8 INPUT 2 A PRINT A Line 4 Display shows EO because the previous error condition was cleared after reading
130. uration 4 and Port 5 OUTPUT08 P3 S4 X P5 S6 X as Configuration 6 using one command string as shown 42 Digital488 80A Commands Digital488 80A User s Manual Command Set amp Support Command Set The 23 Digital488 80A commands are listed below B al ere pa n w i m Serice Request Mask Command Support o Recall Configura on e PorSelect SSCS e mw SOS R Daarsy SOS s Save Configuration x Execute O ooo Support for the above 23 commands includes the Query command extension and the use of the Serial Poll Status Byte For more details refer to the upcoming Command Reference section in this chapter Digital488 80A User s Manual Digital488 80A Commands 43 Command Summary The following summary presents all 23 of the Digital488 80A commands in alphabetical order according to their command syntax plus the Query command support Command Set bit to logic 1 where bit bit value from 1 to 40 Returns bit of the last bit that was set Bit Clear Clear bit to logic 0 where bit bit value from 1 to 40 Returns bit of the last bit that was cleared Configuration Data Output DvalZ Define data to be outputted where val data value In the Format F4 mode the Z terminator suffix is not used In the Format F5 mode both the D command prefix and the Z terminator suffix are not used Query Error Status Returns error status code which indicates the last error encountered It r
131. us address 8 and Channel 1 s interface resides at bus address 9 Note Because the IEEE 488 standard has reserved address 31 if address 30 is selected when in Dual Primary addressing mode then the Digital488 80A defaults to address 28 for Channel 0 and to address 29 for Channel 1 Secondary Addressing Mode When Secondary addressing mode 1s selected with DIP microswitch 8 in the down position then up to four Digital488 80A units can reside at the same primary bus addresses The Secondary addresses at which Channel 0 and Channel 1 reside are selected with microswitches 6 and 7 as indicated in the adjacent figure Addresses 2 and 3 Note When in the Secondary address mode if IEEE 488 primary address 31 is selected the Digital488 80A unit will automatically default to primary address 30 iT 8 16x Y D S H 0 N A N A N A N A wf A ES 12345678 For example if two Digital488 80A units are configured for primary address 08 with the first unit being configured for Secondary addresses 0 Addresses 4 and 5 Addresses 6 and 7 and 1 and the second unit configured for Secondary addresses 2 and 3 then the communication is as indicated by the following table Secondary Address Settings Communication Example To Communicate With Use Primary Address Use Secondary Address Chann J eooo Unit2 Channel wooo Chann eooo 8 Digital488 80A Setup Digital488 80A User s Manual
132. utput in the Fo through F4 formats the Digital488 80A must be readdressed to Talk to perform subsequent reads In Data Ready R mode R1 the Digital488 80A waits for an EDR transition on the selected channel before latching the data and formatting it for output If the EDR line has changed state prior to being addressed to Talk the data read at the time of EDR is buffered for output when next addressed to Talk If EDR changes again before the previous EDR buffered data has been output the Digital488 80A generates an EDR Overrun error and ignores the EDR read request After output in the FO through F4 formats the Digital488 80A must be readdressed to Talk to perform subsequent buffered output of EDR captured data In Data Ready R mode R2 the Digital488 80A waits for an EDR transition on the selected channel before latching the data and storing them in the internal data buffer Up to 2000 readings may be latched and stored The EDR and Inhibit lines function in the same manner as in the R1 mode If an attempt is made to store more than 2000 readings the Digital488 80A generates an Overrun error After output in the FO through F4 formats the Digital488 80A must be readdressed to Talk to perform subsequent buffered output of EDR captured data In any Data Ready R mode the Digital488 80A can request status using the User Status U command without affecting the data ports or the Inhibit line After the requested status is output the presently p
133. ve low 8 The Clear output line is active low 16 The Data lines are low true 32 The EDR input line is falling edge sensitive 64 The Service input line is falling edge sensitive The Invert commands are ORed together as received To delete any one command it is necessary to program the default mode I0 then reprogram the desired commands End Ordentify Clear the internal data buffer where n 0 only L Returns the number of port readings in the internal data buffer from 0 to 2000 Service Request Define the Service Request SRQ conditions where Mask 00 lt mask lt 31 as summed from the following states 0 Default SRQ is disabled 1 SRQ on Service input transition 2 SRQ on EDR input transition 4 SRQ on IEEE 488 bus error 16 SRQ on Ready The Service Request Mask commands are ORed together as received To delete any one command it is necessary to program the default mode MO then reprogram the desired commands Recall Configuration Load configuration val where val value from 0 to 100 Returns currently loaded configuration val Port Select a Select porils m for data VO wheren value from 0105 r0 efault Selectall Sports SSS ea fs earna O OOOO Select Port Returns current port s selection n omn Define mode n of Inhibit output ine wheren Oord 90 Glear the Inhibit line return to unasserted state Digital488 80A User s Manual Digital488 80A Commands

IO TECH 488, 80A User

Contents

Download Pdf Manuals

Related Search

Related Contents