Home

MTSA-PRO - Toner Cable

image

Contents

1. 4 SECTION 2 PRODUCT SUMMARY S SEAVENEANSENVPEEYIKETINEMEMNYSEPYNNENENIETNMUMV KP ENYYE 6 221 REVISION HISTORY MESE 6 22 PRODUCIAPPHEATION S DESCRIPTION 6 453 PRODUCTSPECIEICATIO reus 7 SECTION 3 PACKAGING AND DRIVERS cacicecacucesecesteseneewassinaissicasinessauanssanasananpinasvesssiuasisteawavssavaseeubaseosnnseonseasantvsaonsananenonines 8 1 OFTWARE INSTALLER FION c 11 SEC HON G SOFTWARE 15 CONTROL WINDOW E E E AE E E EOE 16 2m S agri 16 BEB TSANPUT WINDOW c 17 18 OTP 18 MODE E E 18 E 19 4 16 SETTINGS POP UP WINDOW GENERAL ra 19 4 1H SETTINGS POPUP WINDOW RECORD UE recla e 20 ZI SETUNGS POPUP WINDOW 21 4 2 ANALYSIS WINDOW SERVICES TAB Doni da memi can e EUM PN 22 A Sle 268 DE ter eee 23 2 2 ANALISIS WINDOW gt TABLE
2. Base Band Antenna NE Encoder Transmitter Features e Real time analysis via RF ASI IP input and TS file e Single DVB ASI input and single DVB ASI output adapter for USB half duplex e MPEG TS analysis and capture e USB 2 0 bus powered no power supply required e ATSC and OpenCable DTV standards compliant e ETSI TR 101 290 Priority with real time 3 stage error monitoring reporting and error logging e Diagnostic and verification of MPEG designs e PCR amp PTS analysis arrive time graphing measurement display and jitter analysis e Triggered recording e Data rate analysis e Table and packet views e SI PSI amp PSIP view and interval analysis e CAS view ECM and EMM repetition rate and update time e PES header analysis e Real time A V decoding MTSA PRO 7 User Manual 2 3 Product Specification Specifications Input Output ASI SMPTE 310M ASI SMPTE 310M Connectors 1x BNC 750 Connectors 1x BNC 750 Standard DVB ASI Standard DVB ASI SMPTE 310M Bitrate 0 108Mbps in 1 step Bitrate 0 108Mbps 16 step Mode 188 204 bytes packet mode Mode 188 204 bytes packet mode RF Demod 8VSB QAM64B QAM256B Connector xF 750 Freq Range 57 1000 MHz Level Min 15 dBmV QAM256B 20 dBmV QAM64B 30 dBmV 8VSB General Software Dimensions W x D x H 6 06 x 3 89 x 1 12 154mm x 100mm x 29mm TS Input ASI SM
3. E E beni DENS 23 4 5 ANALYSIS WINDOW SERVICE VIEW 25 46 ANALYSIS WINDOWS RATE 26 4 7 ANALYSIS WINDOW TR 101 2907 26 4 8 ANALYSIS WINDOWS TABLE HISTORY TAB nU 27 4 9 SYSTEM MESSAGE AND 101 290 SUMMARY WINDOW ta vM Ue 28 4 9 SYSTEM MESSAGE AND TR 101 290 SUMMARY WINDOW seicessrcsscscosuvatvcinpeateapqrtuevaresnnvaraness REI RE EORR EU ER Pw Era 29 4 MTSA PRO User Manual Section 1 General amp Safety Instructions The STOP sign symbol is intended to alert you to the presence of REQUIRED operating and maintenance servicing instructions that if not followed may result in product failure or destruction The YIELD sign symbol is intended to alert you to the presence of RECOMMENDED operating and maintenance servicing instructions The LIGHTNING flash symbol is intended to alert you to the presence of uninsulated dangerous voltage within the product s enclosure that may be of sufficient magnitude to constitute a risk of electrical shock TO REDUCE THE RISK OF ELECTRICAL SHOCK DO NOT REMOVE COVER FROM THIS UNIT NO USER SERVICEABLE PARTS INSIDE REFER SERVICING TO QUALIFIED SERVICE PERSONNEL WARNING TO PREVENT FIRE OR SHOCK HAZARD DO NOT EXPOSE THIS UNIT TO RAIN OR MOISTURE NOTE TO CATV SYSTEM IN
4. Error 3 9 Empty Buffer Error 3 10 Data Delay Error 500 ms 450 ms 400 ms 350 ms 300 ms 250 ms 200 ms 150 ms 100 ms 50 ms 0 ms 0 00 00 Last Error Time Pos Event Detail MTSA PRO 27 User Manual 4 8 Analysis Result Window Table History Tab The Table History tab shows the current and past table data Services PID Table Service View Bitrate TR101290 Table History Table Full Name Parameter Hex Value Bits Description PAT Program Association Table Transport Stream Program Map Program Map Table 5 6 Section Header 002 2 64 PMT Information MGT Master Guide Table i e Table ID 0 02 2 g uri Terrestrial Virtual Channel Table Section Syntax Indicator 0 01 1 1 EIT Event Information Table oxo0 0 1 au Extended Text Table 0x03 3 2 SIT System Time Table Section Length Ox0DA2 162 12 Program Number 0 0001 1 16 Reserved 0x03 3 2 Version Number 0 04 d Current Next Indicator 0 01 al 1 Current 009 Section Number 0 00 0 8 S PID 0x0030 Program 0 0001 22 6 Last Section Number 0 00 0 8 ge Current Version 04 Reserved 0x07 7 3 f PCR PID Ox0031 49 13 PID 0x0040 Program 0 0002 Reserved OxOF 15 4 Current Version 04 Program Info Descriptor Length 0 0010 29 12 Section 000 1 1 amp d3 Registration Descriptor 0x05 3 48
5. 300 ns 400 ns 500 ns MIN 148 ns 111 ns Play ATSC RF Input 8VSB KOR T 33 Ch 587 MHz 00 00 14 44 Locked Loc rec ts Start B8B B Inbox Microsof c The Latest US ir MTSA Instr 8 MTSA v1 2 2 BM AQTS AP IP QA 1 Service View tab 11 55 MTSA PRO 25 User Manual Once a program is specified the Media player is activated The Media player is not supported in Max Speed of File Input mode Three drop box menus right above the Media Player screen are activated after the program has been specified The user can select Video Audio and Sub title vices PID Table Service View Bitrate TR101290 Table History Services PID Table Service Bitrate TR101290 Table History KES D 1 Program 0000 z 0021 MPEG 2 video j xo024 AC3Aude 4 1040220 MPEG 2 Video 0x0221 Audio 6022 i Audio UU AC 3 GIVES PEACE TO TIENE ND RUE 5 NOW VIE GIVE The configuration tree on the right shows the components of the program This is the same configuration as the Service tab ZZ Pause P Record PID Table Service Bitrate TR101290 Table View History Services PID Table Services PID Table Service View Bitrate TR101290 Table History B Ts ID 0 0860 2 Services 2 1 WCBS HD
6. Smoothing Buffer Descriptor 0 10 16 64 443 Component Name Descriptor 163 96 d Redistribution Control Descriptor 170 24 ES Info 002 2 224 MPEG 2 Video ES Info 0x81 129 368 AC 3 Audio ES Info 0x81 129 368 AC 3 Audio lt Addr Hex ASCIl Addr Hex Binary ASsCIl 00000 02 B0 2 00 01 C900 00 31 10 05 04 47 41 554 00010 39 34 10 06 BD5B 08 00 0 01 65 6E 6 94 eng 00020 01 00 00 02 48 44 AAO 02 E031 F017 02 03 HD 5 00030 22 44 06 01 02 86 00 2 65 67 7E 3F D eng e 00040 67 Cl 7F FF 81 E0 34 F0 29 05 04 41 43 2D 33 4 AC 3 00050 OF 01 65 01 00 00 07 61 75 64 69 2D eng audi o 00060 30 81 0A 08 38 OF FF 01 65 04 65 0 8 eng e When a specific information table has been clicked the history is displayed in decoded and byte formats Current table data is displayed in blue while the history is gray Services PID Table Service View Bitrate TR101290 Table His Table Full Mame PAT Program Association Table PMT Program Map Table AIT Application Information Table MGT Master Guide Table Terrestrial Virtual Channel Table RRT Rating Region Table EIT Event Information Table ETT Extended Text Table pui STT System Time Table E PID 0x0020 Program Ox0002 E
7. TS ID 0 0860 2 Services fil 2 1 WCBS HD Program 0 0001 16 956kbps 87 43096 PID 0x0031 PCR PID 0x0031 MPEG 2 Video PID 0x0031 MPEG 2 Video H I PID 0x0034 AC 3 Audio I PID 0x0034 AC 3 Audio 8 2 PID 0x0035 AC 3 Audio Sd PID 0x0035 AC 3 Audio 4Descriptors 4Descriptors VCT yi 2 2 CBSNY Program 0 0002 1 526kbps 7 87296 E88 2 2 CBSNY Program 0x0002 1 526kbps 7 87296 PID 0x0041 PCR te PID 0x0041 MPEG 2 Video I PID 0x0044 AC 3 Audio 4 Descriptors VCT PID 0x0041 PCR PID 0x0041 MPEG 2 Video 5 a ES Info Horiz E Descriptors W 0x02 Video Stream Descriptor 0x06 Data Stream Alignment Descriptor amp 0x86 Caption Service Descriptor 42 PID 0x0044 AC 3 Audio 4Descriptors VCT 8 System TR 101 290 Summary System Event Log Q 2014 04 01 11 40 17 Start 2014 04 01 11 40 18 0 0000 PAT Updated Version 11 2014 04 01 11 40 18 Dx1FFB MGT Updated Version 24 2014 04 01 11 40 18 Dx1FFB Updated Version 1 2014 04 01 11 40 19 Dx0030 PMT Updated Version 4 Program 1 2014 04 01 11 40 19 0 0040 PMT Updated Version 4 Program 2 M Play ATSC RF Input 8VSB 33 Ch 587 MHz 00 00 06 38 Locked MER 29dB 10dBmV td start 28 EE Inbox Microsof The Latest US a MTSA PRO Instr 2 MTSA v1 2
8. amp Current Version 07 i Section 000 0 0 Ej Current Version 08 L w Section 000 0 0 28 MTSA PRO User Manual Selecting a parameter in the decoded section results in highlighted byte data Services PID Table Service View Bitrate TRIO1290 Table History Table Full Name Parameter Hex Value Bits Description PAT Program Association Table Transport Stream Program Map PMT Program Map Table 3 Section Header 0x02 2 64 PMT Information zs MGT Master Guide Table Table ID 0x02 2 8 um TVCT Terrestrial Virtual Channel Table 9 Section Syntax Indicator 0 01 1 1 du EIT Event Information Table 0 00 0 1 Extended Text Table B 0x03 3 2 STT system Time Table 22 Section Length 2 162 12 Program Number x Reserved 3 2 Version Number 0 04 4 Current Next Indicator 0 01 1 1 Current 0 9 Section Number Ox00 0 8 1 5 PID 0x0030 Program 0 0001 Last Section Number 0x00 8 e Current Version 04 Reserved 0x07 2 3 22 Section 000 1 1 f PCR PID Ox0031 49 13 PID 0x0040 Program 0 0002 Reserved OxOF 15 Current version 04 Program Info Descriptor Length 0 0010 29 12 Section 000 1 1 88 85 Registration Descriptor 0 05 3 48 193 Smoothing Buffer Descriptor 0 10 16 64 8 85 Component Name Descriptor 163 96 8 85 Redistribution Co
9. 0 VID 0525 amp PID 3320 Ventus10_1 5 File Action View Help fil E H ez C Ne 4 34 engbmiller lab gt Computer b Disk drives b Display adapters gt 3 DVD CD ROM drives b Human Interface Devices amm Keyboards hn Mice and other pointing devices b A Monitors EP Network adapters M Broadcom Metxtreme Gigabit Ethernet Intel R 82579LM Gigabit Network Connection gt Ports COM amp LPT gt Processors b T Sound video and game controllers b Storage controllers System devices Universal Serial Bus controllers USB DTV Signal Generator Ventus 1 0 VID 0525 amp PID 3320 10 1 5Y5 MTSA PRO 15 User Manual Section 4 SOFTWARE 4 MTSA PRO Software 4 1 Control Window The Control Window shows settings and status Additional controls are accessed by clicking on the tabs Active Input Output Mode Left Right Window and Option The user should be aware that the Input Output Mode and Option are only active when the system is NOT running MTSA v1 2 21 i Ham m am qx Play Pause Stop Record Table Service Bitrate TR101290 Table Clear Settings s View History MIB B B This tab controls the start and stop of the analyzer Selections are Play Pause Stop and Record Pause is active in the file analysis mode Record is active while analys
10. 0 Descriptors ID OxCB ID OxCC ETT ID OxCD STT Period 1 720 ms 2 1 WCBS HD Program 0x0001 9 617Kbps 77 609 f3 PID 0x0031 PCR PID 0x0031 MPEG 2 Video 42 PID 0x0034 AC 3 Audio 42 PID 0x0035 AC 3 Audio 4Descriptors E ee be EH H H 2 1 WCBS HD Program 0x0001 PMT OD PCR Accuracy Program 0x0001 PID 0x0031 PCR Repetition 0x0031 PCR Accuracy 0x0031 8 PTS Repetition 0x0031 2 Video 400 ns 0x0034 AC 3 Audio 300 ns Q 0x0035 AC 3 Audio 8 Prs PcR 0 0031 MPEG 2 Video 0x0034 AC 3 Audio Ons 00035 AC 3 Audio 100 ns 500 ns System TR 101 290 Summary System Event Log 2014 04 01 11 40 18 0x1FFB Updated Version 1 2014 04 01 11 40 19 0x0030 PMT Updated Version 4 Program 1 2014 04 01 11 40 19 Dx0040 PMT Updated Version 4 Program 2 2014 04 01 11 52 13 lt SYS gt Input Buffer Overflow 2014 04 01 11 52 17 lt SYS gt Input Buffer Overflow 2014 04 01 11 52 19 S YS Input Buffer Overflow 2014 04 01 11 52 22 lt SYS gt Input Buffer Overflow 2014 04 01 11 52 34 lt SYS gt Input Buffer Overflow 2014 04 01 11 53 36 S YS Input Buffer Overflow 2014 04 01 11 53 40 lt SYS gt Input Buffer Overflow 2014 04 01 11 53 41 S YS Input Buffer Overflow 2014 04 01 11 54 58 lt SYS gt Input Buffer Overflow gt 200 ns 100 ns 200 ns
11. 134 3 744 199 1 1 15 4 8 1 6 7 6 8 9 5 9 8 5 7 btr Kbps btr min Kbps btr max Kbps btr avg Kbps 00031 2 Video PCR CC error 15 971 0 393 0 131 0 1 796 0 197 0 n HH O n t qu ERN RNC D Im 1 2 1 WCBS HD 2 22 CBSNY 3 4 3 Tables The System message and TR 101 290 summary window is divided into System and TR 101 290 Summary tabs The MTSA Pro calculates PMT Repetition PCR Repetition PCR Accuracy PTS Repetition plus PCR PTS value PCR PTS indicates the difference in its value compare to PCR input value right before PTS Icon color key Gray Not analyzed Green normal Red error Selecting an item on the left side table actives the graphing function Services PID Table Service View Bitrate TR101290 Table History TR101290 Priority B Priority 1 1 1 TS Sync Loss Q 1 2 Sync Byte Error 1 3 PAT Error 1 4 Continuity Count Error Q 1 5 PMT Error 1 6 PID Error B Priority 2 2 1 Transport Error 2 2 CRC Error 2 3 PCR Repetition Error 2 4 PCR Accuracy Error 2 5 PTS Error 6 CAT Error 8 Priority 3 3 1 Error SI Repetition Ert 3 Buffer Error Q 3 4 Unreferenced PID Error 3 5 SDT Error 36 Erre 3 8
12. 2 1 BY Services tab PN QF 11 46 The component of each program lists the PID and properties along with the ES Info and Descriptor the sub node The ES info shows component information analysis inside the ES elementary Stream data and Descriptor shows contents included in PMT information table gt TS ID 0 0860 2 Services BB 2 1 WCBS HD Program 0001 16 958kbps 87 430 PID 0x0031 PCR db PID 0x0031 MPEG 2 Video Jd 0 0 0034 AC 3 Audio JJ PID 0x0035 AC 3 Audio end 4Descriptors Po Bee YET B B 2 2 CBSNY Program 0 0002 1 525khps 7 87236 PID 0x0041 PCR db PID 0x0041 MPEG 2 Video Jd 0 0 0044 AC 3 Audio 4Descriptors um YET 4 3 Analysis Window PID Tab The PID tab lists all the PIDs in the service along with its service type bit rate and occupancy TA MTSA PRO User Manual Main gt 648 Play Pause Stop Record RF In ASI Service Bitrate TR101290 Table X View Services PID Table Services PID Table Service View Bitrate TR101290 Table History e PID Information 58 5 e PID Information 58 PID 0x0000 PAT 15 6 0 077 3 10 0 0000 PAT 15kbps 0 077 1 PID 0x0030 4Kbps 0 02396 D PID 0x0030 PMT 4Kbps 0 023 PID 0x0031 MPEG 2 Video 16 454 84 8446 PID 0x0031 MPEG 2 Video 16 454Kbps 84 844
13. 42 PID 0x0034 AC 3 Audio 392kbps 2 02296 42 PID 0x0034 AC 3 Audio 392Kbps 2 02296 PID 0x0035 AC 3 Audio 132Kbps 0 684 42 PID 0x0035 AC 3 Audio 132kbps 0 684 PID 0x0040 PMT 3kbps 0 01596 D PID 0x0040 PMT 3kbps 0 015 PID 0x0041 MPEG 2 Video 1 320kbps 6 80796 3 PID 0x0041 MPEG 2 Video 1 320kbps 6 80796 42 PID 0x0044 AC 3 Audio 197Kbps 1 01996 42 PID 0x0044 AC 3 Audio 197Kbps 1 01996 0 1000 18kbps 0 09396 D 0 1000 EIT 18kbps 0 093 0 1001 EIT Dkbps 0 00096 PID 0x1DO1 EIT Okbps 0 00096 PID 0x1D02 EIT Dkbps 0 00096 PID 0x1D02 Okbps 0 000 0 1003 EIT Okbps 0 00096 PID 0x1D03 EIT Okbps 0 00096 0 1004 EIT Dkbps 0 00096 E 0 1004 EIT Dkbps 0 000 0 1005 EIT Dkbps 0 00096 D 0 1005 EIT Okbps 0 000 PID 0x1D06 EIT Dkbps 0 00096 PID 0x1D06 EIT Dkbps 0 000 PID 0x1D07 EIT Okbps 0 00096 D PID 0x1D07 EIT Dkbps 0 00096 3 0 1008 7kbps 0 03896 0 1008 7kbps 0 03895 PID 0x1D09 Okbps 0 00096 0 1009 EIT Dkbps 0 00096 PID 0x1D0A EIT Dkbps 0 00096 PID 0x1DOA EIT Dkbps 0 00095 PID 0x1D0B EIT Okbps 0 00096 D PID 0x1DOB EIT OKbps 0 000 0 100 EIT 7kbps 0 03896 PID 0x1D0C EIT 7kbps 0 038 PID 0x1DOD EIT 0 000 D PID 0x1DOD EIT Dkbps 0 000 0 100 EIT Dkbps 0 00096 PID Ox1DOE EIT DKbps 0 00096 PI
14. ATSC TS Input ASI 00 00 00 00 oKbps Loc Nis ATSC RF Input 8VSB KOR T 33 Ch 587 MHz 00 00 07 59 Locked MER 32dB 5dBmV E TR LOG L REC Summarized information will be shown in following sequence Operation status Play Stop Pause current operating status Analysis mode MPEG 2 ATSC DVB and ISDB Input configuration input port configuration information Analysis processing time and input status File TS IP input status shows its Bit rate whereas RF input shows quality of RF status Lock MER modulation error ratio RSSI received signal strength indicator TR 101 290 error detection status Gray oeration disabled Green normal Red LOG record status Grey recording disabled Green recording TS Recording Status Grey recording disabled Green recording file size and recording time is shown during recording status MTSA PRO 31 User Manual NOTES Limited Warranty Seller will at its sole option either repair or replace with a new or factory reconditioned product as Seller may determine any product manufactured or sold or in the case of software licensed by Seller which is defective in materials or workmanship or fails to meet the applicable specifications that are in effect on the date of shipment or such other specifications as may have been expressly agreed upon in writing i for a period of three 3 years from the date of original purchase for all stock ha
15. Tab The Table tab shows the MPEG tables in a tree structure indexed by Table ID Double click on the node or click on to expand or minimize the display TA AS Play Pause Stop Record PID Service Bitrate TR101290 Table View History Services Clear Settings Table Service View Bitrate TR101290 Table History Table Information 206 ud 10 0 00 PAT Period 94 ms mi 10 0 02 PMT 6 ID OxC7 MGT Period 87 ms ID 0xC8 Period 288 ms 4 ID OxCB fal ID OxCC ETT a ID OxCD STT Period 863 ms Services PID Table Services PID Table Information 206 10 0 00 PAT Period 94 ms Table Info 2 1WCBS HD Program 0 0001 2 2 CBSNY Program 0x0002 ID 0x02 PMT 8 2 1 WCBS HD Program 0 0001 Period 379 ms 8 2 2 CBSNY Program 0x0002 Period 379 ms ID 0xC7 MGT Period 90 ms ID 0xC8 Period 288 ms Table Info Protocol Version 0 2 1WCBS HD Program 0 0001 2 2 5 Program 0 0002 0 Descriptors ID UxCB ID OxCC ETT ID OxCD STT Period 863 ms m 8 8 System TR 101 290 Summary System Event Log 2014 04 01 11 40 17 Start 2014 04 01 11 40 18 0x0000 PAT Updated Version 11 2014 04 01 11 40 18 Dx1FFB MGT Updated Version 24 2014 04 01 11 40 18 OX1FFB Updated Version 1 2014 04 01 11 40 19 0x0030 PMT Updated Version 4 Progra
16. by Seller shall be made free of charge f o b the delivery point called for in the original order Products for which replacement has been made under the provisions of this clause shall become the property of Seller Under no circumstances are products to be returned to Seller without Seller s prior written authorization Seller reserves the right to scrap any unauthorized returns on a no credit basis Any actions for breach of a contract of sale between Seller and a customer must be commenced by the customer within thirteen 13 months after the cause of action has accrued A copy of Seller s standard terms and conditions of sale including the limited warranty is available from Seller upon request Copies of the limited warranties covering third party proprietary sub assembly modules and private label products manufactured by third parties may also be available from Seller on request Rev 0713 One Jake Brown Road Old Bridge NJ 08857 1000 USA 732 679 4000 Fax 732 679 4353 www blondertongue com
17. factory default 4 1G Settings Pop up window General Tab Analyze Other SI Tables Need more performance The General tab allows the user to set the GUI update rate The default is 1 sec The DVB Analyze option needs a software update before it is fully operational 20 MTSA PRO User Manual 4 1H Settings Popup Window Record Tab TR101290 Info T5 Record Path C Program Files Blonder Tongue MTSARecord Record ts Log Record Recard Enable Path C Program Files Blonder Tongue MTSAlRecordlRecord csv Include System Message Indude Table Update Include Minor Table Update Indude TR 101 290 Message The Record tab facilitates recording streams and logging of system and table messages Press the Record Stop button in the Active tab to start stop recording Set the path and file name for recording the transport stream by pressing the button Press Open to view the file path in TS Record The date and time is appended to the file name Check the Record Enable box to save log data in Log Record The Log file is saved in csv format Set the path and file name for the log file by pressing the button Press Open to view the file path in Log Record The date and time are appended to the file name The date and time of the log data is appended be added to the actual file name Check the Include System Message box in Log Record to save system operation messages in the log data file Check Incl
18. in materials or workmanship or fails to meet the applicable specifications that are in effect on the date of shipment of that product or fails to meet such other specifications as may have been expressly agreed upon in writing between the parties for a period of ninety 90 days from the date of original purchase Notwithstanding the foregoing in some cases the warranty on certain proprietary sub assembly modules manufactured by third party vendors and contained in Seller products third party software installed in certain of Seller s products and on certain private label products manufactured by third parties for resale by Seller will be of shorter duration or otherwise more limited than Seller limited warranty for Refurbished Closeout Products In such cases Seller s warranty for Refurbished Closeout Products constituting such third party proprietary sub assembly modules third party software and private label products will be limited to the duration and other terms of such third party vendor s warranty if any In addition notwithstanding the foregoing i certain Refurbished Closeout Products that are not manufactured but are resold by Seller may carry the original OEM warranty for such products if any which may be longer or shorter than Seller s limited warranty for Refurbished Closeout Products All sales of Refurbished Closeout Products are final To obtain service under this warranty the defective product together with a copy of the sales re
19. Blonder Tonque SOLUTIONS FOR ALL YOUR APPLICATIONS USER MANUAL MTSA PRO Status Date Document No Issue Author ACTIVE May 8 2014 651236500 A MADE IN 800 523 6049 www blondertongue com 2014 Blonder Tongue Laboratories Inc All rights reserved Specifications are subject to change without notice Trademarks are the property of their respective owner 2 MTSA PRO User Manual We recommend that you write the following information in the spaces provided below Purchase Location Name Purchase Location Telephone Number MTSA PRO Serial Number The information contained herein is subject to change without notice Revisions may be issued to advise of such changes and or additions Correspondence regarding this publication should be addressed directly to Blonder Tongue Laboratories Inc One Jake Brown Road Old Bridge NJ 08857 Document Number 651236500 Printed in the United States of America All product names trade names or corporate names mentioned in this document are acknowledged to be the proprietary property of the registered owners This product incorporates copyright protection technology that is protected by U S patents and other intellectual property rights Reverse engineering or disassembly is prohibited MTSA PRO 3 User Manual Table of Contents SECTION 1 GENERAL amp SAFETY INSTRUCTIONS wis
20. D 0x1DOF EIT kbps 0 03196 D PID 0xi1DOF EIT kbps 0 03196 PID 0 1D10 EIT Dkbps 0 00096 D PID 0x1D10 EIT Okbps 0 000 PID 0x1D11 EIT Okbps 0 00096 0 0 1011 EIT Okbps 0 000 PID 0x1D12 EIT Dkbps 0 00096 3 D PID 0x1D12 EIT Okbps 0 000 PID 0x1D13 EIT Dkbps 0 000 System TR 101 290 Summary D 0 1014 7kbps 0 038 System Event Log D 10 0 1015 EIT Dkbps 0 000 2014 04 01 11 40 17 Start D PID Ox1D16 EIT Dkbps 0 00096 E 2014 04 01 11 40 18 0 0000 PAT Updated Version 11 D PID Ox1D17 Okbps 0 00096 2014 04 01 11 40 18 Dx1FFB MGT Updated Version 24 C PID 0x1E00 ETT Okbps 0 00096 2014 04 01 11 40 18 Dx1FFB Updated Version 1 PID OxiEO1 ETT ikbps 0 007 2014 04 01 11 40 19 0 0030 PMT Updated Version 4 Program 1 D PID Ox1EO02 ETT 1Kbps 0 00796 2014 04 01 11 40 19 0 0040 PMT Updated Version 4 Program 2 D PID 0x1E03 ikbps 0 007 PID 0x1E04 ETT ikbps 0 00796 D 0 1 05 ETT ikbps 0 007 D PID 0x1E06 ETT Dkbps 0 00095 PID 0x1E07 ETT Dkbps 0 00096 0 1 08 ETT Dkbps 0 000 0 1 09 ETT Okbps 0 000 3 nrn n 1704 rrr n nonna Play RF Input 8VSB Ch 587 MHz Locked MER 30dB 9dBmV B TR 106 start Bm E Inbox Mk The Latest US a MTSA MTSA PRO Instr 7 tab PN 3 Pe 4 4 Analysis Window Table
21. N FOR ANY BREACH OF THE WARRANTIES CONTAINED HEREIN SHALL BE LIMITED TO THE REPAIR OR REPLACEMENT OF THE DEFECTIVE PRODUCT F O B SHIPPING POINT AS SELLER IN ITS SOLE DISCRETION SHALL DETERMINE SELLER SHALL IN NO EVENT AND UNDER NO CIRCUMSTANCES BE LIABLE OR RESPONSIBLE FOR ANY CONSEQUENTIAL INDIRECT INCIDENTAL PUNITIVE DIRECT OR SPECIAL DAMAGES BASED UPON BREACH OF WARRANTY BREACH OF CONTRACT NEGLIGENCE STRICT TORT LIABILITY OR OTHERWISE OR ANY OTHER LEGAL THEORY ARISING DIRECTLY OR INDIRECTLY FROM THE SALE USE INSTALLATION OR FAILURE OF ANY PRODUCT ACQUIRED BY BUYER FROM SELLER All claims for shortages defects and non conforming goods must be made by the customer in writing within five 5 days of receipt of merchandise which writing shall state with particularity all material facts concerning the claim then known to the customer Upon any such claim the customer shall hold the goods complained of intact and duly protected for a period of up to sixty 60 days Upon the request of Seller the customer shall ship such allegedly non conforming or defective goods freight prepaid to Seller for examination by Seller s inspection department and verification of the defect Seller at its option will either repair replace or issue a credit for products determined to be defective Seller s liability and responsibility for defective products is specifically limited to the defective item or to credit towards the original billing such replacements
22. PTE 310M File IP UDP TS or UDP RTP TS RF 0 5 Ib TS Out 0 108Mbps 1bps step 2 Analysis Mode 188 204 bytes packet mode USB 2 0 powered no power supply required 7 analysis Window Tab Service PID Table Service View Bit rate TR 101 290 Table History Recommended System Requirements CPU better than Intel Core i3 more than 2 GB RAM Windows 7 8 MTSA PRO User Manual Section 3 PACKAGING AND DRIVERS 3 MTSA PRO System Package igi T p pum is TP DENTS TT TENERENT RESTI UR TS CER UA QE EY er ees Milieu e 3 252 TRAU AA wisi ons Y z ae d 7 1 MESA ewe ret AI a do d hdlir be 2 CORRI DATI E Re VETT he RE ae Lg 3 bes REED ANN id 1 A IPIE BLONDER TONGUE As SMPTE Input Port SMPTE 310M ASI Out 4 7 OutPut Port RF Input Port seed MTSA PRO Stk No 3726 MPEG TS Analyzer ASI RF IP to USB LEDs Status USB 2 0 Port USB Conection Cable 3 1 Software installation Software installation must be run with Administrator privilege for Windows 7 or above Disconnect the USB cable from the MTSA PRO before installation Get amp run the setup file from the BT website Press Next to begin installa
23. Program 0 0001 16 956Kbps 87 43096 PID 0x0031 PCR db PID 0x0031 MPEG 2 Video 42 PID 0x0034 AC 3 Audio 42 PID 0x0035 AC 3 Audio 4Descriptors VCT il 2 2 CBSNY Program 0x0002 1 526Kbps 7 872 2 PID 0x0041 PCR 5 PID 0x0041 MPEG 2 Video 5 a ES Info Horizontal Size 640 Vertical Size 480 Aspect Ratio 4 3 Frame Rate 29 97 Chrominance 4 2 0 Closed Caption EIA 708 B a 3Descriptors amp 0x02 Video Stream Descriptor 0x06 Data Stream Alignment Descriptor amp 0x86 Caption Service Descriptor JJ PID 0x0044 AC 3 Audio 4Descriptors VCT Ts ID 0 0860 2 Services E88 2 1 WCBS HD Program 0 0001 16 956Kbps 8743096 PID 0x0031 PCR P1D 0x0031 MPEG 2 Video 42 PID 0x0034 AC 3 Audio 42 PID 0x0035 AC 3 Audio 4Descriptors VCT E88 2 2 CBSNY Program 0 0002 1 526Kbps 7 872 f3 PID 0x0041 PCR db PID 0x0041 MPEG 2 Video 42 PID 0x0044 AC 3 Audio 4Descriptors VCT 6 6 6 8 6 6 System TR 101 290 Summary System Event Log 2014 04 01 11 40 17 Start 2014 04 01 11 40 18 0 0000 PAT Updated Version 11 2014 04 01 11 40 18 Dx1FFB MGT Updated Version 24 2014 04 01 11 40 18 Dx1FFB Updated Version 1 2014 04 01 11 40 19 0 0030 PMT Updated Version 4 Program 1 2014 04 01 11 40 19 0 0040 PMT Updated Version 4 Program 2 Play ATSC RF Input 8VSB 33 C
24. S5 Input Buffer Overflow e 2014 04 02 08 58 53 S YS57 Input Buffer Overflow 2014 04 02 08 58 54 S YS57 Input Buffer Overflow System Tab System shows color coded operational messages Operational and stop messages Green information table refresh messages Green and internal operation warning messages Orange Selecting a parameter in the decoded section results in highlighted byte data EE ON ON Warning PCR prediction failed The system cannot carry out PCR data related analysis on Input data input data Warning PID Name Update failed Abnormal data detected during the update process after Input data the table data collection Warning PID Name PACKET COLLECTING FAILED Information table packet collection failure Warnning Clean Unkown PIDs Deleting any unknown PIDs from the memory when there Input data is too many types of PID Warning Media Player Packet Loss Occur Packet Loss occurred during its data transfer to the Media PC calculation overflow Player while Media Player is in its operation at Service View SYS Input Buffer Overflow Data not processed Omitted PC calculation overflow lt 101 290 Summary Tab TR 101 290 error detection results are presented in a summarized format For further information see analysis window TR101290 TR101290 Priority Last Error Time Pos Event Detail B Priority 1 1 1 TS Sync Loss Q 1 2 Sy
25. STALLER This reminder is provided to call the CATV System Installer s attention to Article 820 40 of the NEC that provides guidelines for proper grounding and in particular specifies that the cable ground shall be connected to the grounding system of the building as close to the point of cable entry as practical Safety Instructions YOU SHOULD ALWAYS FOLLOW THESE INSTRUCTIONS TO HELP ENSURE AGAINST INJURY TO YOURSELF AND DAMAGE TO YOUR EQUIPMENT Read all safety and operating instructions before you operate the unit Retain all safety and operating instructions for future reference Heed all warnings on the unit and in the safety and operating instructions Follow all installation operating and use instructions Unplug the unit from the AC power outlet before cleaning Use only a damp cloth for cleaning the exterior of the unit Do not use accessories or attachments not recommended by Blonder Tongue as they may cause hazards and will void the warranty Do not operate the unit in high humidity areas or expose it to water or moisture D3 X Do not place the unit an unstable cart stand tripod bracket or table The unit may fall causing serious personal injury and damage to the unit Install the unit only in a mounting rack designed for 19 rack mounted equipment MTSA PRO 5 User Manual Safety Instructions continued X Do not block or cover slots and openings in the unit These ar
26. The selections in the Left Right Window results in the same action as clicking on the tabs in the corresponding window lu Table Service Bitrate TR101290 Table History iN in Ge ay ause Stop Record RF In ASI v v Acti pu Output Services PID Table ID 0 0860 2 Services 2 1 WCBS HD Program 0 0001 15 731Kbps 81 115 ies PID Table Service View Bitrate TR101290 Table History amp Ts ID 0 0860 2 Services 2 1 WCBS HD Program 0 0001 15 731Kbps 81 115 9 10 0 0031 PCR PID 0x0031 PCR te PID 0x0031 MPEG 2 Video PID 0x0031 MPEG 2 Video lt lt 42 PID 0x0034 AC 3 Audio 42 PID 0x0034 AC 3 Audio 9 9 PID 0x0035 AC 3 Audio JJ PID 0x0035 AC 3 Audio 4Descriptors 4Descriptors fe y EB 2 2 CBSNY Program 0 0002 2 594Kbps 13 376 E88 2 2 CBSNY Program 0 0002 2 594Kbps 13 376 PID 0x0041 PCR PID 0x0041 PCR MTSA PRO 19 User Manual 4 1F Option Tab The Option Tab is comprised of the Clear and Settings buttons Clear cancels outstanding alarms and clears the associated alarm status The color of this button changes from green to yellow with exclamation mark when an alarm is triggered Clear Settings Clicking the Settings button brings up a pop up window with 5 tabs Press OK to save settings Cancel to abort changes and Load Default to re initialize settings to
27. The unit has been dropped or the chassis has been damaged X The unit exhibits a distinct change in performance X When replacement parts are required ensure that the service technician uses replacement parts specified by Blonder Tongue Unauthorized substitutions may damage the unit or cause electrical shock or fire and will void the warranty X Upon completion of any service or repair to the unit ask the service technician to perform safety checks to ensure that the unit is in proper operating condition Returning Product for Repair or Credit A Return Material Authorization RMA Number is required on all products returned to Blonder Tongue regardless if the product is being returned for repair or credit Before returning product please contact the Blonder Tongue Service Department at 1 800 523 6049 Ext 4256 or visit our website www blondertongue com for further information 6 MTSA PRO User Manual Section 2 Product Summary 2 1 Revision History amp Reason This is the first issue of this Instruction Manual 2 2 Product Application amp Description Application The MTSA PRO is designed to analyze MPEG transport stream in real time off line bases Hardware and Software as in a package The Hardware interlocks with the PC via USB cable to maximize its utilization as a mobile analyzer Furthermore it supports TS file output through ASI and real time input can be re transmitted via ASI MTSA PRO ASI IP
28. ceipt serial number if applicable or other satisfactory proof of purchase and a brief description of the defect must be shipped freight prepaid to Seller at the following address One Jake Brown Road Old Bridge New Jersey 08857 This warranty does not cover failure of performance or damage resulting from i use or installation other than in strict accordance with manufacturer s written instructions ii disassembly or repair by someone other than the manufacturer or a manufacturer authorized repair center iii misuse misapplication or abuse iv alteration v exposure to unusual physical or electrical stress abuse or accident or forces or exposure beyond normal use within specified operational or environmental parameters set forth in applicable product specifications vi lack of reasonable care or vii wind ice snow rain lightning or any other weather conditions or acts of God OTHER THAN THE WARRANTIES SET FORTH ABOVE SELLER MAKES NO OTHER WARRANTIES OR REPRESENTATIONS OF ANY KIND EXPRESS OR IMPLIED AS TO THE CONDITION DESCRIPTION FITNESS FOR A PARTICULAR PURPOSE MERCHANTABILITY OR AS TO ANY OTHER MATTER AND SUCH WARRANTIES SET FORTH ABOVE SUPERSEDE ANY ORAL OR WRITTEN WARRANTIES OR REPRESENTATIONS MADE OR IMPLIED BY SELLER OR BY ANY OF SELLER S EMPLOYEES OR REPRESENTATIVES OR IN ANY OF SELLER S BROCHURES MANUALS CATALOGS LITERATURE OR OTHER MATERIALS IN ALL CASES BUYER S SOLE AND EXCLUSIVE REMEDY AND SELLER S SOLE OBLIGATIO
29. ch for driver software in this location C Program Files Blonder Tongue MTSA Driver Windowso4bit 1 Include subfolders gt Let me pick from a list of device drivers my computer This list will show installed driver software compatible with the device and all driver software in the same category as the device Select Browse my computer for driver software then select either c Program Files Blonder Tongue MTSA Driver Windows32bit 1 or Windows64bit 1 based on your Window s OS Click on Next How do you want to search for driver software Browse for driver software on your computer Search for driver software in this location gt Search automatically for updated driver software Windows will search your computer and the Internet for the latest driver software for your device unless you ve disabled this feature in your device installation settings C Program Files Blonder Tongue MTSA Driver Windows4bit 1 Include subfolders gt Browse my computer for driver software Locate and install driver software manually gt Let me pick from a list of device drivers on my computer This list will show installed driver software compatible with the device and all driver software in the same category as the device 14 MTSA PRO User Manual VID 0525 amp PID 3320 Ventusl Windows has successfully updated your driver software Windows has finished installing the driver software for this device Ventus 1
30. e provided for ventilation and protection from overheating Never place the unit near or over a radiator or heat register Do not place the unit in an enclosure such as a cabinet without proper ventilation Do not mount equipment in the rack space directly above or below the unit X Operate the unit using only the type of power source indicated on the marking label Unplug the unit power cord by gripping the plug not the cord unit is equipped with a three wire ground type plug This plug will fit only into ground type power outlet If you are unable to insert the plug into the outlet contact an electrician to replace the outlet Do not defeat the safety purpose of the ground type plug X Route power supply cords so that they not likely to be walked on or pinched by items placed upon or against them Pay particular attention to cords at plugs convenience receptacles and the point where they exit from the unit Be sure that the outdoor components of the antenna system are grounded in accordance with local federal and National Electrical Code NEC requirements Pay special attention to NEC Sections 810 and 820 See the example shown in the following diagram Satellite Dish Coaxial Cable from Satellite Dish Ground Clamp Electric Service Equipment 1 Ground Clamps Antenna Discharge Unit NEC Section 810 20 ower Service Grounding Electrode System NEC Art 250 Pa
31. erest in and to and ownership of all software including all Core Pro duct Software and Non Core Software including any and all enhancements modifications and updates to the same and iv in some cases the warranty on certain proprietary sub assembly modules manufactured by third party vendors and contained in Seller s products third party software installed in certain of Seller s products and on certain private label products manufactured by third parties for resale by Seller will be of shorter duration or otherwise more limited than the standard Seller limited warranty In such cases Seller s warranty with respect to such third party proprietary sub assembly modules third party software and private label products will be limited to the duration and other terms of such third party vendor s warranty if any In addition certain products that are not manufactured by Seller but are resold by Seller may carry the original OEM warranty for such products if any The limited warranty set forth above does not apply to any product sold by Seller which at the time of sale constituted a Refurbished Closeout Product the limited warranty for which is provided in the following paragraph Seller will at its sole option either repair or replace with a new or factory reconditioned product as Seller may determine any product sold by Seller which at the time of sale constituted a refurbished or closeout item Refurbished Closeout Product which is defective
32. h 587 MHz 00 00 06 38 Locked MER 29dB 10dBmV OG REC start Ba Inbox Microsof J The Latest US a Ba MTSA PRO Instr 12 MTSA v 1 2 2 1 Bf AQTS AP IP OA Services tab PN 3I 7 11 46 26 MTSA PRO User Manual 4 6 Analysis Result Window Bit Rate Tab The Bit rate tab shows a breakdown of the elementary streams contained within the transport stream Rates are listed in tabular and graphic formats Two sub tabs are present to organize the data by Service or PID 4 7 Analysis Result Window Services PID Table Service View Birate TR101290 Table History Service Bitrate PID Bitrate 20Mbps SMbps 18Mbps 17Mbps 16Mbps 15Mbps 14Mbps 3Mbps 12Mbps MIN 0 bps PAT 0 0030 0 0040 0 1000 000 0 1001 EIT 001 0 1002 EIT 002 0 1003 EIT 003 Ox1D04 EIT 004 0 1005 EIT 005 0 1006 EIT 006 0 1 07 EIT 007 0 1008 008 0 1009 EIT 009 100 EIT 010 0 1008 EIT 011 MAX 19 394 8 94 bps ratio 96 83 877 Total Bitrate 19 394 130 bps 16 267 Hd m 6 505 0 0034 AC 3 Audio 2 35 394 390 0 0035 AC 3 Audio 0 675 131 129 2 2 CBSNY Program 0x00 m 124 1 963 s MPEG 2 Video PCR 1 766 0 0044 AC 3 Audio E 197 ES TR 101 290 Tab 17 528 396
33. is is in progress You can start stop during the analysis at any time 16 MTSA PRO User Manual 4 1A Input Tab The Input tab is where the input port is selected Click on the down arrow to choose the desired interface You can select input port and detailed settings File TS In IP In and RF In can be selected and each option comes with pop up window for detailed settings C Users bmiller Desktop 1127_H13M45 Bit Rate 19 392 652 bps Edit 0 Kbytes 102 760 Kbytes 00 42 A media file can be played through the unit for analysis and concurrently sent to the ASI output Select a file with Open button Typical file extensions ts and trp The bit rate is calculated automatically after selecting the file The rate can be modified with Edit button if necessary The user can select between two speeds 1x and Max analysis modes The 1x mode is the standard setting for stream analysis and an active ASI output The Max mode enables high speed analysis In this mode the Data output through Media Player and ASI output port are NOT available You can select the Analysis starting point by adjusting the navigation bar 4 1B TS Input window SMPTE 310M The TS Input can be ASI or SMPTE 310M SMPTE 310M is a protocol standard that provides for transmitting 19 39 Mbps transport streams between transmission devices such as multiplexers and 8 and 16 VSB exciters in a headend or statio
34. m 1 2014 04 01 11 40 19 0x0040 PMT Updated Version 4 Program 2 Play RF Input 00 ked MER 2948 9dBmV UTEM DS o Ee 23 24 MTSA PRO User Manual 4 5 Analysis Window Service View Tab The Service View shows service timing errors with a Media Player for playing a selected program During the Analysis operation the drop box menu selection is inactive until a program is detected If Auto Select Program has been selected in Settings Service View tab the first program detected is specified as the program and begins playing automatically IN MTSA v1 2 2 1 mss s B M Bitrate TR101290 Table Settings History Table Service View Bitrate TR101290 Table History Record RF In ASI ATSC Services PID v v Services PID Services PID Table Services PID Table Information 206 2 1 WCBS HD Program 0x0001 44 3 10 0 00 PAT Period 95 ms No Select amp Table Info 2 1 WCBS HD Program 0 0001 Caption LS 2 1 WCBS HD Program 0x0001 2 2 CBSNY Program 0 0002 2 2 CBSNY Program 0 0002 10 0 02 2 1 WCBS HD Program 0 0001 Period 378 ms 2 2 5 Program 0x0002 Period 380 ms 0 MGT Period 90 ms ID 0xC8 TVCT Period 288 ms Table Info Protocol Version 0 2 1 WCBS HD Program 0 0001 2 2 CBSNY Program 0 0002
35. n origination facility MTSA PRO 17 User Manual The IP Input window is used to setup the address and protocol to receive an IP stream Adapter Select your computer s network adapter Protocol options are UDP and RTP IP Addr IP address of the destination Port Number IP port of the destination T 17 0 0 4 1C RF In Input Window The RF input selection sets up the RF mode and parameters for the receiver Modulation type can be 8VSB 64QAM 2560 Input tuning can be in frequency or RF channel number Terrestrial or Cable selections only accept channel numbers HJ KHz 40 MHz 1002 MHz 521000 40 MHz 1002 MHz 570 KH 40 MHz 1002 MHz 587 18 MTSA PRO User Manual 4 1D Output Tab The Output tab allows the user to select between ASI or SMPTE 310M An internal re mux feature is activated for SMPTE 310M with an ASI or RF input 4 1E Mode Tab The user selects the Broadcasting standard for table decoding Options are MPEG2 ATSC and DVB The MPEG2 PSI tables are common to both ATSC and DVB They include PAT PMT NIT and CAT ATSC adds the extended PSIP tables MGT VCT STT etc These tables contain virtual channel numbers and names DVB is the European version of extended tables They include NIT SDT EIT TDT etc A software update for DVB mode is required before DVBit is fully operational Left Window Tab amp Right Window Tab
36. nc Byte Error 1 3 PAT Error 2014 05 06 13 38 52 PAT Repetition Error 1045 ms Q 1 4 Continuity Count Error 2014 05 06 13 38 57 TS Continuity Counter Error PID 0x1D16 15 gt 1 Q 1 5 PMT Error 2014 05 06 13 38 53 PMT Repetition Error 0 0001 1519 ms 1 6 PID Error B Priority 2 Q 2 1 Transport Error 2014 05 06 13 38 52 TS Error Indicator Error PID 0x0031 Q 2 2 CRC Error Q 2 3 PCR Repetition Error 2014 05 06 13 38 52 PCR Repetition Error 0 0001 PCR PID 0x0031 67 ms Q 2 4 PCR Accuracy Error 2014 05 06 13 38 52 PCR Accuracy Error 0 0001 PCR PID 0x0031 1455110579 ns Q 2 5 PTS Error 2014 05 06 13 38 52 PTS Repetition Error 0 0001 PID 0x0034 1280 ms 2 6 CAT Error Priority 3 3 1 Error 3 2 SI Repetition Error 3 3 Buffer Error Q 3 4 Unreferenced PID Error 2014 05 06 13 38 51 Unreferenced PID Error PID 0 0825 3 5 SDT Error 3 6 EIT Error 3 7 RST Error 3 8 TDT Error 3 9 Empty Buffer Error 3 10 Data Delay Error E E E EP 30 MTSA PRO User Manual 4 10 Operation Status Window Operation status window shows the summary of overall operation information Various operating status is shown below Various operating status is shown below ATSC FILE Input 1x 1127_H13M45_CH2 1 The Bold and the Beautifultrp 00 00 00 42 19 392 Kbps rec ATSC IP Input udp 127 0 0 1 5000 00 00 00 00 okbps Loc e
37. ntrol Descriptor 170 24 L3 amp B ES Info 0x02 2 224 MPEG 2 Video ES Info Ox81 129 368 AC 3 Audio 0 ES Info 0 81 129 368 AC 3 Audio 9 gt Addr Hex ASCII Addr Hex Binary ASCII 00000 02 B0 2 00 01 C900 00 E031 F01D05 04 47 41 1 G 00003 00 00010 39 34 10 06 CO BD5B C0 08 00 01 65 6E67 94 eng 00004 0 00020 01 00 00 02 48 44 01 02 E031 F017 0203 ee 00030 22 44 06 01 02 86 0D E2 65 67 7E FF amp 65 D eng 00040 87 1 FF81 E034 FO 29 05 04 41 432033 4 AG3 00050 01 65 BE 67 01 00 00 07 61 75 64 69 6F2D eng audi o 00060 30 81 0A08 38 OF FF OF 01 BF65 67 0 04 65 0 8 eng 00070 67 00 81 35 29 05 04 41 43 20 33 ng 5 AC 3 00080 01 65 01 00 00 07 61 75 69 BF 2D 31 81 audiosi 00090 0A 08 20 03 FF 2F 01 70 61 0A 04 73 70 61 TE io spa 000 0 00 03 14 50 01 MTSA PRO 29 User Manual 4 9 System Message and TR 101 290 Summary Window The System message and TR 101 290 summary window is divided into System and TR 101 290 Summary tabs System TR 101 290 Summary System Event Log 2014 04 02 08 58 39 S5 Input Buffer Overflow 2014 04 02 08 58 45 88 Input Buffer Overflow 2014 04 02 08 58 48 lt 5YS gt Input Buffer Overflow 2014 04 02 08 58 50
38. rdware products other than those specifically referenced herein below having a shorter warranty period ii for a period of one 1 year from the date of original purchase with respect to all MegaPort IPTV products test equipment and fiber optics receivers transmitters couplers and integrated receiver distribution amplifiers iii for a period of one 1 year from the date of original purchase or such shorter period of time as may be set forth in the license agreement specific to the particular software being licensed from Seller with respect to all software products licensed from Seller other than Core Product Software that is a developed for a specific function or application b complimentary to and does not function without the Core Product Software and c listed with a specific model number and stock number in Seller s Price List Non Core Software iv for a period of ninety 90 days from the date of original purchase with respect to non serialized products and accessories such as parts sub assemblies splitters and all other products sold by Seller other than Core Product Software and Refurbished Closeout Products not otherwise referred to in clauses i through iii above The warranty period for computer programs in machine readable form included in a hardware product which are essential for the functionality thereof as specifically stated in the published product specifications Core Product Software will be coincident
39. rt H Grounding Conductors NEC Section 810 21 We strongly recommend using an outlet that contains surge suppression or ground fault protection For added protection during a lightning storm or when the unit is left unattended and unused for long periods of time unplug it from the wall outlet and disconnect the lines between the unit and the antenna This will prevent damage caused by lightning or power line surges X Do not locate the antenna near overhead power lines or other electric light or power circuits or where it can fall into such power lines or circuits When installing the antenna take extreme care to avoid touching such power lines or circuits as contact with them can be fatal Do not overload wall outlets or extension cords as this can result in a risk of fire or electrical shock Never insert objects of any kind into the unit through openings as the objects may touch dangerous voltage points or short out parts This could cause fire or electrical shock X Donot attempt to service the unit yourself as opening or removing covers may expose you to dangerous voltage and will void the warranty Refer all servicing to authorized service personnel X Unplug the unit from the wall outlet and refer servicing to authorized service personnel whenever the following occurs X The power supply cord or plug is damaged X Liquid has been spilled or objects have fallen into the unit X The unit has been exposed to rain or water X
40. st reproduce the above copyright notice this list of conditions and the following disclaimer in the documentation and or other materials If you accept the terms of the agreement click I Agree to continue You must accept the agreement to install WinPcap 4 1 1 MullsaFE Install System v2 45 WinPcap 4 1 1 Installer QU A Welcome to the WinPcap 4 1 1 Installation Wizard This product is brought to you by CACE TECHNOLOGIES Packet Capturing and Network Analysis Solutions Nullsoft Install System v2 45 WinPcap 4 1 1 Setup Installation options F review the following options before installing WinPcap Automatically start the WinPcap driver at boot time System Information Operating system detected on registry Windows 7 AMD64 True operating system kernel dll Windows 7 AMD64 npptools dll present on the system false netnm inf present on the system false nmnt sys present on the system false Nullsoft Install System v2 45 Be sure to check the box to automatically start the WinPcap driver at boot time After the software installation has completed the Driver will automatically start its installation when the hardware is connected If not see Section 3 2 Driver Installation MTSA PRO 13 User Manual Right click on the Unknown device in Device manager and then click Update Driver Software Browse for driver software on your computer Sear
41. t C Register Server Micrasoft C Register Server Analyzer Automatically dose the applications Do not dose the applications Installing Please wait while Setup installs MTSA on your computer Extracting files C Program Files Blonder Tongue MTSA pluginslaudio filter Vibsamplerate plugin dll DilRegisterServer in CA Windows system32 ChartFX ClientServer Core dll succeeded 12 MTSA PRO User Manual After the installation is completed the WinPcap file needs to be installed This must be done during the installation no reinstallation required for version updates Completing the MTSA Setup Wizard Setup has finished installing MTSA on your computer The application may be launched by selecting the installed icons Click Finish to exit Setup 3 WinPcap 4 1 1 Setup license Agreement Win Pear VJ Im Please review the license terms before installing WinPcap 4 1 1 Press Page Down to see the rest of the agreement Copyright c 1999 2005 NetGroup Politecnico di Torino Italy Copyright c 2005 2009 CACE Technologies Davis California All rights reserved Redistribution and use in source and binary forms with or without modification are permitted provided that the following conditions are met 1 Redistributions of source code must retain the above copyright natice this list of conditions and the following disclaimer 2 Redistributions in binary form mu
42. tion Welcome to the MTSA Setup Wizard This will install MTSA version 1 2 2 1 your computer It is recommended that you dose all other applications before Click Next to continue or Cancel to exit Setup fhich components should be installed Select the components you want to install dear the components you do not want to install Click Next when you are ready to continue Current selection requires at least 91 7 MB af disk space MTSA PRO 9 User Manual 10 MTSA PRO User Manual Ready to Install Setup is now ready to begin installing MTSA on your computer Click Install to continue with the installation or dick Back if you want to review or change any settings Setup type Full installation Selected components 64 bit Additional tasks Additional icons Create a desktop icon Installing Please wait while Setup installs MTSA on your computer Extracting files C Program Files Blonder Tongue MTSA pluginslaudio filter Vibsamplerate_plugin dll LL lt MTSA PRO 11 User Manual If you see below messages please select Do not close the application Preparing to Install Setup is preparing to install DTV Analyzer on your computer o The following applications are using files that need to be updated by Setup It is recommended that you allow Setup to automatically close these applications After the installation has completed Setup will attempt to restart the applications Micrasof
43. ude Table Update box in Log Record to save table update messages Check Include Minor Table Update in Log Record to save frequently updated table messages Frequently updated table messages includes STT EIT STT in ATSC mode Check Include TR 101 290 Message box in Log Record to save TR 101 290 error messages to the log file MTSA PRO 21 User Manual 4 11 Settings Popup Window Info Tab This is a read only tab which displays the HW type and serial number Eun Device Info HAW Type MTSA PRO H W ID APGM24021 22 MTSA PRO User Manual 4 2 Analysis Window Services Tab The Service tab displays the analysis of the service components in a tree structure format Double click on the node or click on to expand or minimize the display The TSID and number of services are shown at the top For each service the Service name Program Number bit rate and occupancy information is shown along with the configuration information in sub node g D Ges ij om RF In ASI PID Table Service Bitrate TR101290 Table v v View History Input Mode Left Window Right S Services PID Table Service View Bitrate TR101290 Table History TS ID 0x086D 2 Services 2 1 WCBS HD Program 0 0001 16 956Kbps 87 430 PID 0x0031 PCR Main oHm Pla Pause Stop Record Services PID Table Clear Settings
44. with the warranty period of the applicable hardware product within which such Core Product Software is installed Software patches bug fixes updates or workarounds do not extend the original warranty period of any Core Product Software or Non Core Software Notwithstanding anything herein to the contrary i Seller s sole obligation for software that when properly installed and used does not substantially conform to the published specifications in effect when the software is first shipped by Seller is to use commercially reasonable efforts to correct any reproducible material non conformity as determined by Seller in its sole discretion by providing the customer with a telephone or e mail access to report non conformance so that Seller can verify reproducibility b a software patch or bug fix if available or a workaround to bypass the issue if available and c where applicable replacement or damaged or defective external media such as CD ROM disk on which the software was originally delivered ii Seller does not warrant that the use of any software will be uninterrupted error free free of security vulnerabilities or that the software will meet the customer s particular requirements and the customer s sole and exclusive remedy for breach of this warranty is at Seller s option to receive a suitably modified software or part thereof or b comparable replacement software or part thereof iii Seller retains all right title and int

Download Pdf Manuals

image

Related Search

Related Contents

Stovax Riva Plus Large Wood & Multi-fuel User's Manual  identiFINDER NGH  Procédure d`installation et de mise à jour de  Congratulations on your purchase of a VR dive  Optoma DW318 Projector    DELL E Series E2014H  Respironics EverFlo  S4M - Guida per l`utente - Zebra Technologies Corporation    

Copyright © All rights reserved.
Failed to retrieve file