Home

o.chart5 o.chart5f

1. 63 RAM CIA crete ss ususi a sssassapsssaqhnausui ta 99 RAM Menu gege eege 99 Range Mode 81 Read MEDIA 92 Reading Directory 60 Real Time View 62 88 BEER SE 91 Receive route 94 Receive Mark 57 92 Receive Waypoint 56 96 Receiving Route 50 Removing MEDIA 104 108 Report route 94 reset partial distance 59 reset total distance 59 Resolution angle 30 Restart GPS 90 Restore Current Preset Defaults 84 Reversing Route 50 RMA iste S uu suum Dyus n usss pis 91 RMB eet 91 e 91 122 e GE 32 39 41 93 ROCKS 36 40 42 51 93 ROLLING ROAD 94 BOLO DAE ee ge 19 ROUTE unn nunus usia sss 18 94 Route 31 36 49 54 66 68 90 Route Check u u presiis ra i ERII raS 33 51 Route Check Accuracy 51 94 Route Check Report 51 94 Route Color
2. 89 Depth Range Max 39 41 93 Depth Range Min 39 41 93 Depth E 75 Depth UNIE cesaroni renns ususqa ua apus 20 95 Depths 32 DEVICES Menu 89 94 BIE oe be 89 EM ARN eene 32 33 Differential Correction 90 Differential GPS 89 Rief 40 42 51 93 Diffusion area 36 Digital D eptiy u u ar nnna 74 DIM Menu 99 DIMENSIONS 105 109 Directory DSC 71 89 Directory ON MEDIA 60 Re 64 103 107 Display AlS E 87 Display Mode 39 92 Display Mode track 88 Display Resolution 103 107 Display Setup Menu 82 Displaying Track 58 Dist amp Speed Units 95 IIe 20 Distance track 58 Distance Speed Units 95 Distance Step 88 Distance To Go 89 Distance Unit 20 Distress Call
3. 50 Route Data Report 49 56 68 Route Depth 51 94 route management 49 Route Menu 49 94 Route Width 51 94 Routes amp Tracks 93 Eege 94 Tee 50 S S N Ne e s u s ssasiqasShasssus sashakusnasanphaspas 28 Safe Route Checking 51 Safety Route Check 33 Safety Status Bar 35 91 Safety Toolbar 33 Satellite Imagery 36 91 Save e EE 84 Save Settings 84 Saving Uert eeh ssapakusswaushakas 59 92 screen brightness 21 Scrolling Speed 82 CR Re EE 103 107 Seabed Type 39 41 93 Search EE 32 Secondary Chart Plotter 65 Select route 94 Select Country to Call 62 Select Route No 96 Select Track No 96 Selecting Track Color 58 DONC eierne ETE mena aq Eene 91 See EE 94 SEN E EE 57 92 Send Waypoint 56 96 Sending Rout
4. 69 Download ME 61 88 Download Area 62 DPS eebe 61 DPT eebe 91 Dredged Areas 36 51 EE 69 89 DSC Directory page 71 120 DSC el CG 71 DSC Bee 70 DSC Menu 70 89 IR BE 35 DILEEP E uuu E aswaa sss 89 Dual page FF 78 Dynamic Currents 32 Dynamic Nav Aids 32 35 91 E Echogram 75 Echogram window 74 Edit Mark EE 57 92 Edit een 96 Elevation Data 33 ENTER S u uum asssa ruan ss 17 77 CR 89 External Alarm 23 48 87 100 External Alarm Connection 23 48 EXTERNAL CONNECTIONS 23 External NMEA 23 External NMEA Connections 23 EXTERNAL WIRING 106 110 Extra Large Coverage 32 F el EE 13 FF MODULE eege 104 108 ell s n saa S 59 89 el EE 32 FIND FUNCTION 44 Find Menu 89 91 Finding Coordinates 47 Finding CUSO u us asssssrnisssnakuyusa 47 Finding Lakes By Name 46
5. 55 Visibility eebe e tue 62 63 Visual ee E 95 Ee 65 e ee LE 20 VIG GE 91 W WAAS ee 96 WARNING EE 11 Warning Message 74 Warping Facility EE 51 Water Temperature 74 83 Water Temperature Rate 84 WOM CDOS E 62 63 Waypoint 17 31 49 51 54 55 56 Op CL EE 91 Weather data package 61 weather forecast 61 e E 103 107 WGS 84 u Yasassaskawqapanaakwkaqtaqah a wanupaqpas 96 UI 62 63 White Line 76 82 te EE 62 63 Wiring Diagrams 113 World Background 32 WV PIL out 22 22 EE 50 Wrecks 36 40 42 45 51 89 93 x eege Eege 47 91 97 XTE Alarm 47 87 Z ZDA Ee 91 ZOOM EE 33 35 36 ZOOME AP ashe uu yessssuistashastassupkashashunpapuyana 75 zoom factor 34 ZOOMIN 17 34 62 77 79 96 zoom level eege eet ere 35 ZOOM MODES EE 79 ZOOM OUI 17 34 62 77 79 97 POO TE 19 ZOOM yB E 34 91 123 EF UR UNO Declaration of Conformity D claration de conformit Konformit tserkl rung Declaraci n de conformidad We nous Wir nosotros Furuno France 12 rue Laplace 33698 M rignac Cedex France Declare on our own respo
6. 4 5 MOUNTING d HOLES 4 POS m t O E N O kel 1152mm 6 2 120mm 4 9 Flush mounting on the left and Bracket mounting on the right 4mm 20 mm T A SY M4 threaded M4 threaded 27 mm Mounting Screws p User Manual 105 EXTERNAL WIRING TNC active GPS antenna QUICK DISCONNECT BRACKET POWER amp I O CABLE WIRE COLOR Power Input GND POWER SUPPLY GND Power Input 10 35VDC POWER SUPPLY INPUT 1 NMEA0183 C COM BBFF C LINK AIS SIGNAL GROUND OUTPUT 1 NMEA0183 AUTOPILOT INPUT 2 NMEA0183 C COM BBFF C LINK AIS OUTPUT 2 NMEA0183 AUTOPILOT SIGNAL GROUND External Wiring for O CHART5 TRANSDUCER Connector PINFUNCTION 1 DEPTH TNC active E SND GPS antenna POWER SUPPLY 5Vdc 1A max SENSE DEPTH SHIELD DEPTH Gi Sek J SPEED QUICK DISCONNECT BRACKET POWER amp I O CABLE WIRE COLOR DESCRIPTION FUNCTION BLACK Power Input GND POWER SUPPLY GND RED Power Input 10 35VDC POWER SUPPLY lt WHITE INPUT 1 NMEA0183 C COM BBFF C LINK AIS GREEN SIGNAL GROUND YELLOW OUTPUT 1 NMEA0183 AUTOPILOT BROWN NC GRAY NC ORANGE NC PINK NC BLUE SIGNAL GROUND External Wiring for O CHART5F Note The Active GPS Antenna must be used only if the Internal G
7. a When User Interface Language is changed Chart Language settings are set as follows MODE is set to Off and Chart Language is set as the User Interface Language selection if available on the chart data otherwise is set to English b If the cartographic data is changed for example the DATA MEDIA is removed or replaced Chart Language settings should be verified and if necessary changed 22 D User Manual 2 7 EXTERNAL CONNECTIONS Note In the following paragraphs n 1 2 3 for O CHART5 O CHART DE and n 1 2 3 4 5 for O CHART7 0O CHART 7F 2 7 1 AUTOPILOT CONNECTIONS To connect the Autopilot to the serial Port n To choose your preferred setting follow the procedure MENU I nput Output ENTER Port n Output ENTER Then choose your preferred setting among the NMEA available settings NMEA 0183 4800 N81 N NMEA 0180 NMEA 0180 CDX the default setting is NMEA 0183 4800 N81 N and press ENTER to confirm 2 7 2 EXTERNAL NMEA CONNECTIONS To connect the External NMEA to the serial Port n To choose your preferred setting follow the procedure MENU I nput Output ENTER Port n Input ENTER Then choose your preferred setting among the NMEA available settings NMEA 0183 1200 N81 N NMEA 0183 4800 N81 N NMEA 0183 4800 N82 N NMEA 0183 9600 N81 N NMEA 0183 9600 O081 N the default setting is NMEA 0183 4800 N81 N and press ENTER to confirm 2 7 3 C COM CONNECTIONS To connect the mo
8. 43 44 Info on Mark EE 92 Info On ROUTE jects yo sasa sliuncssssssshas panpana 49 fO OM A RE 96 Info page 37 Information on Mark 57 information on Waypoint 55 Input Output Menu 90 94 Inserting MEDIA 104 108 eege 92 Inserting Waypoint 54 96 INSTALLATION 105 109 Interference Rejection 81 Internal GPS Setup Menu 91 Intertidal Areas 36 51 ISO Certification 32 K Keel Offset 83 Le 14 17 Keyboard 14 17 103 107 Keypad Beep 21 95 L labelled key 14 EC 43 Lakes By Name 46 89 Lakes WANG EE 43 45 89 Lakes Information 45 Fang s u EE 36 Land EE 51 Land Elevation 32 39 41 93 Land Elevation Values 39 41 93 D User Manual Language 20 22 26 95 LasUGOT0O NEE 18 90 Lele OM EE 28 91 Lat Lon Grid 40 41 93 LATITUDE geegent eegen 91 LCD Adjustment 19 21 94 LCD EIERE 21 EE 91 LIST
9. Alarms ENTER Arrival Alarm ENTER oat XTE Alarm value Off MENU Alarms ENTER XTE Alarm ENTER sss Anchor Alarm value Off MENU Alarms ENTER Anchor Alarm ENTER sss Depth Alarm value Off MENU Alarms ENTER Depth Alarm ENTER ww HDOP Alarm value Off MENU Alarms ENTER HDOP Alarm ENTER 11 Heading Alarm On Off MENU Alarms ENTER Heading Alarm ENTER ess Grounding Alarm value Off MENU Alarms ENTER Grounding Alarm ENTER ees Grounding Alarm Range 0 25 Nm 0 5 Nm 1 0 Nm MENU Alarms ENTER Grounding Alarm Range ENTER a Grounding Alarm Report MENU Alarms ENTER Grounding Alarm Report ENTER sss External Alarm On Off OnLy For O CHART7 O CHART7F MENU Alarms ENTER External Alarm ENTER gt AUTO INFO The type of Automatic Info is user selectable The possible settings are Off disabled no auto matic info shown at all On Points only on points This is the default setting On All on all objects points lines and areas MENU Setup ENTER Auto Info ENTER E AZIMUTH Angular measurement from the horizon to a satellite or another object E BEACON Prominent specially constructed object forming a conspicuous vertical mark as a fixed aid to navigation E BRG Bearing Angle between the North True or Magnetic and a destination It re
10. Devices ENTER DSC ENTER E DGPS Differential GPS Provides even greater positioning accuracy than standard GPS gt DSC Digital Selective Calling Method of establishing a VHF radio call it is used to announce urgent maritime safety information broadcasts ua DSC Log MENU Devices ENTER DSC ENTER DSC Log ENTER ene DSC Directory MENU Devices ENTER DSC ENTER DSC Directory ENTER E DTG Distance To Go Actual distance to reach the Target E EVENT User point that refers to the ship s position It is simply a way of marking where the boat is E FILE Collection of information of the same type stored on a MEDIA Each file must have a unique name ideally one that describes its contents Filenames are kept in a directory on each MEDIA gt FIND menu Allows finding Port Services Port By Name Port By Distance Lakes By Name Lakes Information Points Of Interest Tide Stations Wrecks Obstructions Cursor Coordinates and User Points saa Port Services Press any soft key Mar Find ENTER Port Services ENTER ene Port By Name Press any soft key Mar Find ENTER Port by Name ENTER saa Port By Distance Press any soft key Mar Find ENTER Port by Distance ENTER vn Tide Stations Press any soft key Mar Find ENTER Tide Stations ENTER wee Wrecks Press any soft key Mar Find ENTER
11. ENTER A window is shown to find the Waypoint inserting label Using the cursor to insert the name and press Accept CANcEL otherwise For example if the inserted name is W005 the cursor will be placed on this Waypoint and the window contain ing route information is shown 4 1 2 8 Finding information on Waypoints User Points List page gt MENU List ENTER List ENTER A full page window is shown with information on stored User Points Move cursor up down to select the desired User Point NOt eebe In the list a circle surrounds the User Point symbol of the User Point on which the Target is set DST and BRG from Cursor Ge E Lat Lon 50 13 086N MRK 001 MARK 002 54 915W 50 00 688N MRK002 MARK 003 41244W WPT003 49 30 953N Route 01 Waypoint 992 54 915W WPT004 Waypoint 49 53 579N WPT005 49 53 579N Route 01 002 43 730W Route 01 Waypoint 994 51 952W gt Dst Bra Fig 4 1 2 8 User Points List page View Waypoint on the map gt MENU List ENTER List ENTER View The chart plotter exits from the User Points List page and redraws the map On the User Manual 55 screen the selected point appears centered with the cursor placed on it Press Exit to return to the User Points List page Find Waypoint in the User Points List page MENU List ENTER List ENTER Finp A window is shown to insert the name by using the cursor key Press ENTER
12. Before activating the function you could change the function parameters as the width and the depth of the detected area and the research accuracy To select the width of the detected area aside the Route gt MENU Route ENTER Route Width ENTER insert the desired value ENTER Note Safe Route width value represents half the total width checked by the function To select the depth of the detected area aside the Route gt MENU Route ENTER Route Depth ENTER insert the desired value ENTER It also possible to select the accuracy for the Route check among Minimum Low Medium High and Maximum gt MENU Route ENTER Route Check Accuracy ENTER 4 1 2 WAYPOINTS You may add Waypoints see Par 3 4 1 delete Waypoints from a route move any Waypoint in the route to another location insert a Waypoint between two existing ones find any Waypoint at anytime User Manual 51 4 1 2 1 Adding Waypoints gt ENTER WAYPOINT ENTER The Waypoint appears on the cursor position An info window is shown con taining route number date and time Waypoint name symbol and Latitude Longi tude information on previous next Waypoint It is also shown the distance to cover and or covered if there are several Waypoints refer to next Waypoint The se quence of moving the cursor and pressing ENTER selecting WAYPOINT and pressing ENTER again is continued to create the rout
13. First Setup Page English Chart Language Distance Speed Units Mmi E ts Depth Altitude Units Mr Temperature Units Time Reference Daylight Saving Time Time Format 24 hour Date Format DLD NINI Y Y Maw Aids Presentation Keypad Beep Input Output Simulation Mode Fig 2 3 First Setup Page menu The possible selections are listed in the table below Language The map information will still be displayed in the language of the official digitalized paper chart Chart Language Selects a sub menu with two items Language to set the language to display chart information and Mode to define how objects are translated Distance Speed Units Selects the unit for Distance and Speed among Nm Kts Sm Mph Km Kph The default setting is Nm Kts Depth Altitude Units Selects the unit for Depth and Altitude among Ft and Mt The default setting is Mt Temperature Units Selects the unit among C and F The default setting is C 20 D User Manual Time Reference Allows switching between UTC or local time by entering the Local Time offset The default setting is UTC Daylight Saving Time Sets On Off the Daylight Saving Time The default setting is Off Time Format Selects the format for the time between 12 and 24 hour The default setting is 24 hour Date Format Selects the Date Format between MM DD YY month day year and DD MM YY day month year The default setting is DD MM YY Nav Aids Presentatio
14. 1 Depth Range Min Press any soft key Map Other Map Configurations ENTER Depth Range Min ENTER 11 Depth Range Max Press any soft key Map Other Map Configurations ENTER Depth Range Max ENTER sat Land Elevation On Off Press any soft key Mar Other Map Configurations ENTER Land Elevation ENTER ast Land Elevation values On Off Press any soft key MaP Other Map Configurations ENTER Land Elevation values ENTER sss Roads On Off Press any soft key Map Other Map Configurations ENTER Roads ENTER sat Points Of Interest On Off Press any soft key Map Other Map Configurations ENTER POI ENTER ene Lat Lon Grid On Off Press any soft key Map Other Map Configurations ENTER Lat Lon Grid ENTER sss Chart Boundaries On Off Auto Press any soft key Mar Other Map Configurations ENTER Chart Boundaries ENTER 22 Value Added Data On Off Press any soft key Map Other Map Configurations ENTER Value Added Data ENTER saa Chart Lock On Off Press any soft key Map Other Map Configurations ENTER Chart Lock ENTER u Underwater Objects Limit Press any soft key Map Other Map Configurations ENTER Underwater Objects Limit ENTER sss Rocks Off Icon Icon Depth Press any soft key Map Other Map Configurat
15. READ ene Format MENU Memory Card ENTER MEpiA Format see Sort By MENU Memory Card ENTER MEpiA Sort By gt MEMORY CARD menu The chart plotter uses the optional MEDIA to save user data it is a convenient medium to store and retrieve your information ssa Save File Mark Event Routes Tracks MENU Memory Card ENTER Save ene Load File MENU Memory Card ENTERT Loap 11 Delete File MENU Memory Card ENTER DELETE ees Media Menu MENU Memory Card ENTER MEpiA gt MOB Man OverBoard It is an important function useful in the case someone or something falls overboard Inserting MOB ENTER MOB ENTER Deleting MOB ENTER MOB ENTER Accept gt NAVIGATION or Home From charting while receiving a fix position and the chart plotter is not in Navigation mode enables the Navigation mode also called Home When in Navigation mode the cursor is not shown and all cartographic functions are related to the ship position The received fix position is centered in the cartography area and the window screen follows the ship position as the position changes When the cursor key has been pressing the Navigation mode is disabled and the cursor symbol is shown again Note that also the cursor symbol is not shown while Navigation mode is active its coordinates are updated with ship position coordinates CLEAR gt OTHER M
16. Surface Noise Filter 4 6 5 2 GAIN MODE Selects Auto or Manual 80 D User Manual gt MENU Devices ENTER Fish Finder Setup ENTER Gain Mode ENTER 6 5 3 RANGE MODE Selects among Manual Auto Range and Bottom Lock When in Manual Range Mode it is possible to set Shift the offset from the surface see Par 6 5 5 and Depth see Par 6 5 4 on which the Fish Finder shall operate When in Auto Range Mode the Fish Finder determines automatically the range as to keep the bottom visible in the lower left of the screen In this mode Shift is always set to 0 In Bottom Lock Mode the Fish Finder automatically tracks the range around the bottom specified by the Bottom Range value MENU Devices ENTER Fish Finder Setup ENTER Range Mode ENTER 6 5 4 DEPTH This option is available only when Range Mode is Manual and it is disabled in Auto Range and Bottom Lock Mode gt MENU Devices ENTER Fish Finder Setup ENTER Depth ENTER 6 5 5 SHIFT This option is available only when Range Mode is Manual and it is disabled in Auto Range and Bottom Lock Mode gt MENU Devices ENTER Fish Finder Setup ENTER Shift ENTER 6 5 6 BOTTOM RANGE This option is available when Range Mode is Bottom Lock gt MENU Devices ENTER Fish Finder Setup ENTER Bottom Range ENTER 6 5 7 FREQUENCY Allows you to choose the frequency bet
17. A G 0L qQ334 3S nOq ON OV 18 dION eeoeoeogos s s s s s s s s s s s d em eeeeeeeef 6 oxy un sindep ulu OL1 384 0 1209 OGL 000 S780 ei ANIT LOH MOV1E YION 31IHAVONV 18 A38 Sl89 REIWEN EE q 13IHOS 3SS4331 ADNVYO SAONVYO 008r OY eI nod Sq uuop ap 90JNOs nne un 1ne oinos Sd9 O p o uuoo aq o sp u 009r OX LON N3a3 S L Id3A Amu OSA u DOD UOS d euu luV JHA JHA uu luv MOTISA ANNVE P eeeeeeeeeeeeeeeeeeeeee MO 1E YION ALIHM ONV14E Add n1g na1g N333S 13d3A MOTISA ANNVE AL User Manual 114 0L0 0 YVd190 avs 19 YILNI el TK Y3LN3 ZHOd nua N L8N 008r 8LO VAIIN SEHR HOd HOS N L8N 008r 8L0 V3INN sd31N3 LHOd ou Y31N3 nuos nu3 NNIN vJ 10 vJ 10 d72INZ OOP8ESIV oo HIN yndu ZHOd N L8N 008r 8L0 V3INN HIN yNdjnO LHOd N L8N 008r 8L0 V3INN SIN yndu Lued A2INZ y yndino nndu NNAW Z LYVHO O WEIEN MNid ASOY AONVYO AONVEO Add oxy UN sind p UllW D LL 381 0 1002 OGL 000 SZ80 Zei ANITLOH MOV 18 dION 31IHAVONV 18 Add rn 1g na 1 SSSSSSSSSS q 1dIHOS 3SS3Aq1 3l1IHAVONV 18 3SNV O 3SNVSHO N3a332 JS LHd3A MOTISA ANAWE A S 0L qQ33 3SnOs ON MOV 18 3ION LIMVHO O 0087ON 8 BeIqeO BulJlIAA N3JY9 LYJA MOTIAA ANNWVE Au OSA U DOD uolisoq jp gt euu uv JHA 008rOq JHA uu luy 115 User Manual oxy UN sind p ultuu
18. EECH ees 072N 09 43 658E GE ae SA s t i f fer J Fig 6 3 1 2 Example of Fish Finder with Databoxes page 6 3 1 3 Dual Fish Finder page To display the Dual Fish Finder echogram follow this procedure ONLY FoR O CHART5F gt PAGE Dual Fish Finder ENTER ONLY FoR O CHART7F gt MENU Page ENTER Dual Fish Finder ENTER Fig 6 3 1 3 Example of Dual Fish Finder page Note The gray box surrounds the area of the screen that it is active The Cursor key Moving the Cursor key to the right or the left to change the gray box from the left window to the right window Moving the Cursor key up or down adjusts the Variable Depth Marker VDM up or down on the active screen window Press CLEAR to hide the VDM 78 D User Manual The ZOOM IN and ZOOM OUT keys From this page pressing ZOOM IN once changes to Zoom 2X pressing ZOOM IN twice changes to Zoom 4X while pressing ZOOM OUT reverts to Zoom 2X and no ZOOM 6 3 1 4 Fish Finder and Chart page To display the Chart page on the half of the screen and the Fish Finder Echogram on the other half of the screen follow this procedure OnLy For O CHART5F gt PAGE Chart Fish Finder ENTER ONLY For O CHART7F gt MENU Page ENTER Chart Fish Finder ENTER Fig 6 3 1 4 Example of Fish Finder 200kHz left and 50kHz right and Chart page The Focus Soft Key to change the active window When in Chart an
19. ENTER Config ENTER Time Step ENTER select the desired Time Step ENTER ss Distance Step 0 01 0 05 0 1 0 5 1 0 2 0 5 0 10 0 MENU Track ENTER Config ENTER Distance Step ENTER select the desired Disatance Step ENTER ss Delete All Tracks MENU Track ENTER Config ENTER Delete All Tracks ENTER Yes E CURRENT Non periodical movement of sea water generally horizontal due to many causes such as differ ent temperatures and prevalent winds Some may be temporary others permanent gt C WEATHER Meteorological forecasting system with the ability to visualize the weather forecast overlaying it on cartography ene Copy From Media MENU C Weather ENTER Copy from Media ENTER ss Download Select Country To Call Telephone Number Pin Sim Download Area MENU C Weather ENTER Download ENTER aa Forecast MENU C Weather ENTER Forecast ENTER set Real Time View On Off MENU C Weather ENTER Real Time View ENTER ssa Type of Data Wind Wave Data Weather Humidity Temperature Visibility MENU C Weather ENTER Type Of Data ENTER E DATA MEDIA Chart cartridge that contains detailed charts of the area covered E DATUM The Latitude and Longitude lines printed on any map are based on certain models of the shape of the earth these models are called Datum or Coordinate
20. OnLy For O CHART7F gt MENU Page ENTER Fish Finder ENTER Note To select the 200kHz or 50 kHz Fish Finder page press ENTER and then select the desired Frequency among 50kHz or 200kHz see Par 6 5 9 AO 1e fg 6G 26 KHe SSS Fig 6 3 1 1 Example of 200kHz left or 50 kHz right Fish Finder Full display To activate the Fish Finder Setup menu see Par 6 5 press gt MENU Devices ENTER Fish Finder Setup ENTER The Cursor key Moving the Cursor key up down adjusts the Variable Depth Marker VDM up or down on the screen The ENTER key Pressing ENTER activates the Sensitivity menu see Par 6 5 9 that allows tuning Frequency Gain the Surface Noise Filter and the STC STC Strength Surf Noise Filter Off Fig 6 3 3 la Sensitivity sub menu Pressing CLEAR turns off the Sensitivity menu The CLEAR key By pressing CLEAR the Variable Depth Marker VDM is hidden The ZOOM IN and ZOOM OUT keys From this page pressing ZOOM I N once changes to Zoom 2X pressing ZOOMIN twice changes to Zoom 4X while pressing ZOOM OUT reverts to Zoom 2X and no zoom User Manual 77 6 3 1 2 Fish Finder Full Databoxes page It is possible to have the same picture of the previous Par 6 3 1 1 with the Data Boxes on the top of the screen ONLY FoR O CHART5F gt PAGE Fish Databoxes ENTER ONLY FoR O CHART7F gt MENU Page ENTER Fish Databoxes ENTER
21. Primary Station ENTER Master mode is the default factory setting All regular chart plotters functions are allowed As soon as the Destination is placed the Master chart plotter will start transmitting all C Link Navigation Data In Master mode the C Link Navigation Data received from the NMEA port is ignored So if the two chart plotters are both operating in Master mode the C Link Navigation Data sent by the other chart plotter never processed Under such condition if the navigation is activated on one of the two chart plotters a warning message will be shown to notify that the C Link Navigation Data will be ignored by the other chart plotter 66 D User Manual 5 3 3 2 Slave Chart Plotter Operating mode To select the Slave mode Secondary Station follow the procedure gt MENU I nput Output ENTER C Link ENTER Secondary Station ENTER When Slave mode is set the chart plotter cannot manipulate the C Link Navigation Data anymore It is necessary to disable the Internal GPS on the Slave chart plotter before start to work with the C Link system MENU Input Output ENTER GPS Configuration ENTER GPS Antenna ENTER No ENTER Stop current navigation If the navigation was already active it will be disabled as soon as Slave mode is set An appropriate warning message will be shown to notify that the Navigation is already active and to confirm whether Slave mod
22. Wrecks ENTER ees Obstructions Press any soft key Mar Find ENTER Obstructions ENTER 11 Lakes I nfo Press any soft key Mar Find ENTER Lakes I nfo ENTER 11 Lakes By Name Press any soft key Mar Find ENTER Lakes by Name ENTER User Manual 89 ess Points Of Interest Press any soft key Mar Find ENTER Points of Interest ENTER aa Cursor Press any soft key Mar Find ENTER Cursor ENTER ss Coordinates Press any soft key Mar Find ENTER Coordinates ENTER sss User Points Press any soft key Map Find ENTER User Points ENTER gt FISH FINDER SETUP menu The chart plotter combined with the sonar performance of the Fish Finder is one of the most advanced marine navigation system available From any Fish finder page MENU Devices ENTER Fish Finder Setup ENTER gt GOTO menu Allows to select the main navigation functions to a Target aa Last GoTo GOTO Last GoTo ENTER or GOTO aaua Cursor GOTO Cursor ENTER or GOTO aaa Mark GOTO Mark ENTER or GOTO aua Routes GOTO Route ENTER or GOTO 1 Port Services GOTO Port Services ENTER or GOTO 11 Clear GOTO GOTO Clear GoTo ENTER or GOTO E GPS Global Positioning System Satellite based navigation system operated by the US De
23. and the chart plotter will point the Waypoint out in the User Points List page Deleting Waypoint gt MENU List ENTER List ENTER Devete To Ge Waypoints Deleting Selected Waypoint Using the cursor key to select the Waypoint to delete and press SELEcTrED A warning message appears press ENTER or Yes CLEAR or No otherwise If you want to delete the Waypoint on which Target is set first delete the Target and then delete the Waypoint e Deleting all stored User Points A warning message appears Press ENTER or Yes CLEAR or No otherwise to delete all stored User Points If a Target is set on an User Point first delete the Target and then delete all User Points Selecting the Databoxes Setup and the Route Data Report pages MENU List ENTER List ENTER Data To select wrap around the Databox Setup the User Points List and the Route Data Report pages see also Par 3 1 and Par 4 1 2 8 4 1 2 9 Send Waypoints To transmit all User Points onto the NMEA output port gt MENU List ENTER Send ENTER 4 1 2 10 Receive Waypoints To save all User Points received from the NMEA input port gt MENU List ENTER Receive ENTER 4 2 MARKS You may tag a location on the chart with a Mark symbol and number which you can record for later use 4 2 1 ADDING MARK gt ENTER MARK ENTER The new Mark appears on your cursor position An in
24. 3 FINDING PORT BY DISTANCE To select the research of Port By Distance up to 10 following the procedure gt Press any soft key Map Find ENTER Port by Distance ENTER Shows the list of ports stored on the DATA MEDIA in closest distance order Use the cursor key up down to select one of them and press ENTER or FiNp to locate it on the map 3 11 4 FINDING TIDE STATIONS To select the research of Tide Station up to 10 following the procedure gt Press any soft key Map Find ENTER Tide Stations ENTER Shows the list of Tide Stations Choose one of them and press ENTER or FiNp to display the Tide Graph page Press CLEAR to locate on the map the Tide Station chosen 3 11 5 FINDING WRECKS To select the research of Wrecks up to 10 following the procedure gt Press any soft key Map Find ENTER Wrecks ENTER Shows the list of wrecks stored on the DATA MEDIA in closest distance order Use the cursor key up down to select one of them and press ENTER or FiNp to locate it on the map 3 11 6 FINDING OBSTRUCTIONS To select the research of Obstructions up to 10 following the procedure gt Press any soft key Map Find ENTER Obstructions ENTER Shows the list of obstructions stored on the DATA MEDIA in closest distance order Use the cursor key up down to select one of them and press ENTER or Finp to locate it on the map 3 11 7 FINDING LAKES INFORMATI
25. 90 Clear Info 32 Clear VieW Aen free E 32 COG 72 222 hiussohepapakawapanqtaqa kausaita qapa 28 88 Color route 94 Color Dee EE 88 Color Bal ege deeg 74 Color SettingsS 82 CONFIG Menu 58 Config Track Menu 88 96 configuration 18 eine EE 18 21 99 Coordinate Systems 88 Coordinates 47 90 Course Over Ground 88 Eege 63 CPA Plant EE 63 64 87 CPA De EE 63 create a Waypoint 31 Creating a Route 31 Cross Track error 97 CT ISS ee 80 CURRENT eege 88 Currents Prediction 36 91 CURSOR tege 18 31 54 57 Cursor 15 17 47 90 Cursor Co trol EE 24 95 Cursor key 15 17 77 78 D Dangerous Target 64 Dangers 36 Kee eege 18 55 56 58 Data Features 32 DATA MEDIA 23 Data Menu 18 26 50 56 BR WEEN 36 Date OOS wesc uuu a ayasa kusa sas 25 26 Data Safe
26. Alarm gt MENU Devices ENTER AIS ENTER TCPA Alarm ENTER Turns Off the alarm or defines the TCPA Limit The values allowed are from 1 to 30 min The default setting is Off 64 D User Manual 5 2 3 TO SET THE PLOTTER FOR RECEIVING AIS Make sure that the AIS receiver is properly connected to the chart plotter The chart plotter reads the AIS NMEA message VMD type 1 2 3 and 5 Select the used serial port and transmission speed by following the procedure gt MENU I nput Output ENTER Port n Input ENTER m ENTER Where m NMEA 0183 4800 N81 N or AIS 38400 according to the transmission speed of your AIS receiver n 1 2 3 for O CHART5 O CHART 5F 1 2 3 4 5 for O CHART7 O CHART 7F 5 2 4 QUICK INFO ON AIS TARGET By placing the cursor over a AIS target icon this information is displayed Vessel Name MMSI number Radio Call Sign SOG COG CPA and TCPA values Note _ The selected AIS target icon is surrounded by a square frame when user places the cursor over the icon 5 3 C LINK C Link system is a feature which allows to sharing the same Navigation Data Route Name Destination ID amp Position Next Waypoint ID amp Position Total Route length Fuel Consumption Rate ETA TTG etc between two chart plotter units linked via serial I O port 5 3 1 C LINK SERIAL CONNECTION The two chart plotters should be connected via serial ports Any of th
27. DATA MEDIA SD Card 0 55 C 32 131 F 580 or 700 gr e Protective cover e Quick Disconnect Bracket e Flush mount template and kit e Fuse 2 Amp fuseholder O CHART5 e Fuse 3 Amp fuseholder O CHART5F e User Manual 103 ONLY For O CHARTS5SF FF MODULE 6o00w 50 200KHz TECHNI CAL SPECI FI CATIONS e Power Output 600W 4800W pp 50 200KHz Dual Frequency e Max Depth 213m 7OOFt at 200KHz 457m 1500Ft at 50kHz e Automatic Recognition of the AIRMAR X DUCER ID transducers for best per formance e Advanced Digital Signal Processing e Speed amp Temperature Sensor if available on transducer e Alarms shallow water depth Fish temp e Trip Log Fish Symbols e STC Interference Rejection Automatic noise reduction e A scope White Line Zoom x2 x4 e Auto range gain frequency shift ping rate INSERTING REMOVING PROCEDURE INSERTING MEDIA Open the door hold the MEDIA by the short side with the cut corner up Gently push the MEDIA into the slot as far as it will go to hold fixed into the slot and close the door REMOVING MEDIA To remove the MEDIA open the door then press gently on the MEDIA and take it out from the slot 104 D User Manual DIMENSIONS 132 8mm 5 37 lt gt 168mm__ 94 2mm 3 7 162mm 6 4 oa x x een 3 9 L E 74mm 2 9 nS lt 162mm 6 4 I NSTALLATI ON 162mm 6 4 lt 74mm 2 9
28. EDIT WAYPOINT WPT004 41 14 734N 009 29 290E Accent i dE Fig 4 1 2 4 Edit Waypoint Use the cursor key to select the field If Symbol field is selected press ENTER a window with 16 different sym bols appears Tr e oe 41 12 775N_ 009 30 195E 4 E Se vz E if Fig 4 1 2 4a Waypoint symbols Use the cursor key to select the symbol and press ENTER If Name field is selected press ENTER use the cursor key to insert the character 8 characters max then press ENTER If Color field is selected press ENTER a window with 8 different colors appears Use the cursor key to select the color and press ENTER If Coordinates field is selected press ENTER Use the cursor key to insert the value and press ENTER Press ENTER or AccEPT User Manual 53 4 1 2 5 Goto gt Adding Waypoint ENTER WAYPOINT ENTER or Place cursor on Waypoint Press GOTO select CURSOR and press GOTO again or ENTER a circle surrounds the Waypoint symbol A line is shown connecting the Target with the ship s position When the Target is placed all navigation data are referred to this Target Press GOTO select LAST GOTO and press GOTO again or ENTER a windows appears on the screen containing coordinates of the previous inserted Targets Select the desired Target and press GOTO again or ENTER the Target is placed on the selected previous Target Otherwise press GOTO
29. Fig 5 4 2 2 Example of DSC Directory page Edit Edit the fields of any existing entry in the Directory Vessel Name MMSI number contact and phone number Add Add a new entry to the Directory Delete Delete the selected entry Delete All Deletes all entries in the page 5 4 3 QUICK INFO ON DSC ICONS Placing the cursor on the Distress Call or Position Request icon the following information is displayed Vessel Name MMSI Number e Position e Date and Time e Distance and Bearing from current vessel position Pressing ENTER it is possible by selecting DELETE deletes the DSC icon from the DSC Log page otherwise by selecting DSC LOG the DSC Log page is shown User Manual 71 5 5 FISH FINDER MENU The chart plotter combined with the sonar performance of the Fish Finder is one of the most advanced marine navigation system available To select the Fish Finder menu first select one of the page related to the Fish Finder ONLY FoR O CHARTS 5F gt PAGE select the Fish Finder page you want OnLy For O CHART7 ZE gt MENU Page ENTER select the Fish Finder page you want Then to select the Fish Finder menu gt MENU Devices ENTER Fish Finder Setup ENTER 72 D User Manual Fish Finder Fo o cuartsF 0 cHART7F The Fish Finder consists of a high power transmitter sensitive receiver and a transducer The Fish Finder sends an electrical pulse to the transducer which contains an
30. Guardian Technology detects cautionary or restricted area 3 8 7 SATELLITE IMAGERY gt Press any soft key Map Satellite Imagery ENTER It is possible to overlay the satellite image for background map When it is set On the Palette is set to Normal to display the proper colors 3 8 8 CURRENTS PREDICTION gt Press any soft key Map Currents Prediction ENTER It is possible to see the variation of the Tidal arrows on the selected area at any given time A window is shown on the low left side of the chart press Ger to set data and time and Decr Incr to decrease increase the time Press Exit to exit 36 D User Manual 3 9 INFO FUNCTION Place the cursor on the desired position then gt Press any soft key Mar Info ENTER to display the Info tree and the expanded Info page 3 9 1 INFO TREE AND EXPANDED INFO PAGE This page combines the Info Tree and the Expanded I nfo pages this gives the advantage of showing the details of the object selected on the Info Tree while the cursor is moving through the Info Tree s items The upper side of the page contains the Info Tree and the lower side contains the expanded information While moving the cursor through the Info Tree all the relevant information of the selected object is shown on the lower part of the page When the selected object is a Tide Height pressing ENTER the Tide page is shown Pressing CLEAR the page is closed To select the next
31. In During a distress situation a vessel that is equipped with a DSC VHF radio and connected to a GPS has the capability to transmit a DSC Distress Call with GPS Position User Manual 69 When the VHF radio receives a DSC Distress Call the position information of the vessel in distress is transferred to the chart plotter The chart plotter logs the Distress Call into the DSC Log and also marks the position of the vessel in distress on the Chart page A pop up screen advises the user that a Distress Call has been received Within the pop up screen it asks the user if he would like to view the call on the Chart page or exit the pop up screen By selecting the item VIEW ON CHART and press ENTER two options are shown Go To Vessel Activates the navigation to the Distress Call or Position Request icon The chart plotter changes the map scale to allow showing the Distress Call or Position Request icon and the vessel s icon simultaneously on the screen The chart plotter then verifies if there are obstructions land or low water between the two positions If obstructions are found the chart plotter shows a pop up screen saying that the navigation to the Distress Call cannot be set automatically and the user must define a route to avoid the obstacles Stay on View Exits the pop up screen and remains on the selected map screen 5 4 2 DSC MENU To select the DSC menu gt MENU Devices ENTER DSC ENTER The DSC menu i
32. KEE 63 AIS DefinitionS 63 AIS ME nU EE 64 87 89 AIS receiver a 65 AIS Symbols 64 Alarm WEE 23 Alarm E EE 74 Alarms Menu 83 87 94 Altitude 28 Anchor Alarm 47 87 PAP sok Tu inn susya 91 Area of coverage 62 Arrival Alarm 47 87 ASSISTANCE 15 Attention Areas 36 39 40 92 Auto Info 42 87 95 Auto Of EE 47 87 Automatic Info 42 Automatic Route Check 51 94 Autopilot Connections 23 azimuth 28 87 B background charts 33 Backlight eebe e 100 BASICS 14 BathymetriC watannecesrear lest iasdlieseeloakite ees 32 BEACON yaya ucu zu unay una aaa 87 BeafiNg WEE 30 87 beep EE 15 Best MaD EE 36 blinking lights 35 BOD sannana EE Ee 91 Bottom Echo Profile 76 Bottom Lock Zoom 79 Bottom Range 81 EE 87 egen ge 18 21 BUOY uui
33. Lakes By Name Points of Interest Cursor Coordinates and User Points The research of these objects referes to the boat position if a valid fix is received or to the cursor position if the received fix position is not valid 3 11 1 FINDING PORT SERVICES To select the research of Port Services up to 10 i e the nearest Hospital sailmaker bank etc following the procedure Press any soft key Map Find ENTER Port Services ENTER The icons of the available services are shown Use the cursor key to select any facility and press ENTER or FiNp The list of the nearest ports containing the facility will be shown on the screen Then choose the port you want and press ENTER or Finp 44 D User Manual 3 11 2 FINDING PORT BY NAME To select the research of Port By Name following the procedure gt Press any soft key Map Find ENTER Port by Name ENTER Port by Name ENTER Shows the list in alphabetical order of all ports stored on the DATA MEDIA To select next previous page press ZOOM IN ZOOM OUT or use the cursor key up down to slide in the list otherwise press Name and use the cursor key to manually insert the name of port Press ENTER or FiNp to locate it on the map Note To filter the list select the distance range by following the procedure Press any soft key Map Find ENTER Port by Name ENTER Range ENTER Insert the desired value 3 11
34. O LL 381 0 1009 OSL 000 S780 WANITLOH 0L0 0 vJ 10 HvJ10 GKERIEKENSI n1a na1g Y31N3 VIN OOrsEsIV DOP8 SIV aas Y31N3 Y31N3 phoq nua yndu pod NA Oz I8 NOzH3HVIN A3u SI 9 lt nd no lqe eAv qii BOS gt 31l1IHAVONV 18 MOTISA ANNVE no VUWOOE AL Odd Ac YSLNA HIN nuos nug jyndinonndul NNAW NNAW User Manual YVA10 YVAT19 N L8N 008r 8LO VAIIN YsALNa LHOd IHOS N L8N 008r 8LO VAIIN YsALNa HOd ou VIN luos nu3 NNIN S IT IHOS goe O I XNV avq O 4V3 15 N L8N 008r 8L0 VAINN YSLN3 yNdjnO LHod N L8N 008r 8L0 VAINNN JLN yndu HOd JLN y yndino indu NNAW ano aaen tO ACh n1a nata 1MNId 3SOq ASDNVYO AONVEO Add NMOdd NOddVA 31IHAVONV 18 N3JH9 LY3A MOTISA ANNVE A S 0L Odd ON MOV 18 3ION ACL ACh MOV1E YION ALIHM ONV18 Add IWWER REISEN N3JH9 LY3A MOTISA ANNVE u3 OSC U 9009 uolllsoq p ACL 008rOqd euuajuy JHA di LHVHO O JHA SU UV AIZILYVHO O 0087ON efDgIOECHDUU IM 116 0L0 0 axl un sind p ului Jed O LL 38 0 1009 OSL 000 SZ80 ei 3NITLOH ON MOV 1g dION OCASE 01 q334 3S nOq NJJHX9 LHYJ3A EKERWICKERRI YV3A10 YVsd19 X3LN4 Y3LN4 OOP8ESIV Iso OOP8ESIV P9 8S YSLN3 YSLN3 kHod aan yndu LHOd YSLN3 YaLNaA alOS ae indjnosjndu sobe bay s6uljjas NNAW NNAW ALIHMW ONV1E SIV Ss q 9 p piAo1d JON q lq
35. POU ee eege 92 Formatting MEDIA 60 tee EE 81 a EE 50 UNENEE 34 D User Manual Full Info ON LAKES 44 RECKEN 87 G E EE 82 Gain Mode 80 GGA ee E E 91 LC eee ee eee ee eer eee un mans 91 Global Positioning System 90 GO TO ersero ed icee se chee 17 30 31 54 57 Goto 54 57 95 GOTO MGM eenegen 90 GoTo on Mark 92 GoTo on WPT WEE 96 GPS us mania suspsnaspa nasutus apss 17 28 90 GPS Page 47 90 GPS SETUP MENU uu usasqa aspas 90 Grounding Alarm 48 87 Grounding Alarm Range n se 48 87 Grounding Alarm Report 48 87 EE 91 Guardian Alarm uu uasaiasasssasusapan 33 Guardian Technology 36 H lw H E 48 90 91 PDO Ps age 28 48 90 HDOP Alarm 48 87 Head Up EE 30 Heading 24 90 95 Heading Alarm 48 87 High Water Temperature 84 Highway 3D EE 94 EIERE 17 92 HOME or Navigation 90 Horizontal Dilution Of Precision 90 ns eer eee oe E eer ee ss 91 elt e ne EE 62 63 I et EE 17 91 Info on Lakes
36. Place Names ENTER Name Tags Displays a tag for particular chart objects that either includes the name of the chart object or the depth of an underwater chart object Press any soft key Mar Other Map Configurations ENTER Display Mode ENTER Custom ENTER Name Tags ENTER Nav Aids amp Light Sectors Turns On Nav Aids amp Light Sectors are shown Off Nav Aids amp Light Sectors are not shown No Sector Nav Aids are shown Light Sectors are hidden Press any soft key MaP Other Map Configurations ENTER Display Mode ENTER Custom ENTER Nav Aids amp Light Sectors ENTER Attention Areas Turns On Off the displaying of the Attention Areas areas in which special attention by the mariner is required because of natural or man made hazards or sailing regulations and restrictions Press any soft key Mar Other Map Configurations ENTER Display Mode ENTER Custom ENTER Attention Areas ENTER Tides amp Currents Turns On Off the displaying of the Tides and Currents The worldwide database with tidal stream information is available with MAX DATA MEDIA When data time is available Tidal stream arrows are shown on the charts indicat ing the direction and strength of the Tide If no data time is available from the GPS or the chart plotter is not in Simulation mode the icon on the map is generic one The color of the arrow denotes the st
37. Sets the value for speed in the Simulation mode The default setting is 1 0 Kts gt MENU Simulation ENTER Speed ENTER 2 9 3 HEADING Sets the desired value for heading in Simulation mode The default setting is 000 M gt MENU Simulation ENTER Heading ENTER 2 9 4 DATE Sets the date of the simulated fix gt MENU Simulation ENTER Date ENTER 2 9 5 TIME Sets the time of the simulated fix gt MENU Simulation ENTER Time ENTER 2 9 6 CURSOR CONTROL Enables On disables Off the cursor control The default setting is Off gt MENU Simulation ENTER Cursor Control ENTER 24 D User Manual For the New User In order to get started using your chart plotter you must do the following things 1 Your chart plotter must have been installed properly according to the installation instruction 2 You must have performed the proper settings for use with your position ing instrument and inserting the DATA MEDIA for navigating in area you wish 3 You must have Power On to the chart plotter and adjust the brightness and contrast of the display Once this is done you can use your chart plotter for navigation 3 1 SCREEN DISPLAY CONFIGURATION The chart plotter screen may be displayed in several modes To select the screen configuration you wish ONLY For O CHARTS bt gt PAGE ONLY For O CHART7 ZE gt MENU Page ENTER A
38. The User Manual is divided into three main parts Chapter Before You Be gin introduces you to the basic information to get you start using the chart plotter Chapter For the New User should be read first to become familiar with your new instrument Chapter For the Experienced User introduces the advanced features of the chart plotter Throughout this User Manual the labelled keys are shown in capitals letters enclosed between single inverted commas for example MENU the software keys are shown in small capital letters enclosed in square brackets for example Accept Menu operations are in bold characters listed by keys sequence with the menu names enclosed between inverted commas for example ENTER MARK ENTER Move Accept means press the ENTER key using the cursor key select the Mark option and press ENTER to place Mark press the software key Move to change the Mark position and press the software key Accept to confirm the new position Terms underlined for example Mark are explained in the Chapter 7 Into all information windows items are displayed in gray color when there are not active it is not possible to select them and place on the cursor Any menu operation and function activation in this User Manual is related to all chart plotter models see the previous table The pictures are related to the 5 vertical chart plotters whenever it is necessary a note has been inserted for the ot
39. User Points 91 List Menu 94 Load From File 88 Load Settings 84 Loading File 60 92 LOG EE 59 70 96 Log DSC 89 LONGITUDE Zieser leiere eege 91 Lost Target 64 Low Water Temperature 84 M MAGNETIC DEVIATION 91 MAGNETIC VARIATION 91 Man OverBoard 92 Map Menu 18 34 91 Map Orientation 30 95 Map Resolution 30 Map Ne EE 19 MAP SETTINGS 39 MARK ege uu usa sasa onenei inis 18 57 91 Mark 17 56 57 90 Marker Zoom 80 Master Chart Plotter 66 MEDIA 23 59 60 84 92 103 104 107 108 MEDIA menu 92 Memory 103 107 MEMORY CARD 59 Memory Card Menu 92 94 Mixing Levels 33 35 91 MMSI ENEE 63 71 MOB eege iicr ien KEE 17 67 92 Mo
40. activated a warning message is shown gt MENU Alarms ENTER Grounding Alarm ENTER 3 12 9 GROUNDING ALARM RANGE Allows setting the length of the sector to be detected among 0 25 0 5 1 0 Nm The default setting is 0 5 Nm When any of the searched objects is found in the scanned area a tick marker is printed on the relative box in the Grounding Alarm Report page to identify which dangerous objects have been currently detected MENU Alarms ENTER Grounding Alarm Range ENTER 3 12 10 GROUNDING ALARM REPORT Allows displaying the report of the dangerous objects currently detected gt MENU Alarms ENTER Grounding Alarm Report ENTER 3 12 11 OnLy For O CHART7 ZE EXTERNAL ALARM When any alarm condition occurs the pin is switched from High Impedance to ground This signal can be used by an external device as a hooter or buzzer The default setting is On gt MENU Alarms ENTER External Alarm ENTER 48 D User Manual 4 For the Experienced User Now you have had a chance to became familiar with your new chart plotter there are a great number of advanced features that you will find helpful 4 1 MORE ABOUT CREATING AND USING ROUTES At anytime you may add or delete Waypoints see a route summary re verse the direction of the route or erase the entire route 4 1 1 ROUTES To select the Routes menu gt MENU Route ENTER The following functio
41. and use it left right to move cursor to left right Note Tide graphs are an approximation of the tide and they should be used in conjunction with traditional tide tables and navigational methods 3 9 3 GETTING PORT INFO Upon viewing the chart of a port or harbor you will see a Port Info icon that can be clicked on to query the available information immediately displayed with many details 001 30 456W Ge p E Point Sc Be Port Info Icon Fig 3 9 3 Port Info icon The available information is shown in the Automatic Info window where icons of the available services are shown 38 D User Manual gen o gt eo 001 30 456W PORT DE JARD SUR MER PORT Te JARD Py MER Fig 3 9 3a Automatic Info window To expand information on the object press Expanp otherwise press Exp Au to select all available information 3 9 4 ENHANCED PORT INFO MAX charts include additional port services that were not present before Additional attributes of Port Areas and Port Marinas have been included Location Country Region State Harbor master telephone number etc 3 10 MAP SETTI NGS This menu allows the user to customize the screen gt Press any soft key Map Other Map Configurations ENTER 3 10 1 DISPLAY MODE gt Press any soft key Mar Other Map Configurations ENTER Display Mode ENTER Selects from a predefined table what cartographic objects are displayed and which display o
42. awas apuman alikuwa 30 3 3 NAVIGATING TO A SINGLE DESTINATION rr d See ENEE een 30 3 3 1 Distance and Bearing to WK te E 30 3 3 2 Time TOGO A rte e EE senesced 31 3 3 3 Deleting EE 31 3 4 NAVIGATION ON A a KN NEE 31 3 4 1 Adding KE e e EE 31 3 4 2 Creating a ROUTE ebe deed Seege 31 3 4 3 Deleting Ee EE 31 344A Wie Ke EC e GEET 32 3 4 5 Deletimg Target EE 32 3 5 C MAP By Jeppesen MAX CARTOGRAPHY INFORMATION r 32 393 1 Data Features E 32 3 5 2 Presentation Features EE 32 User Manual D 5 3 5 3 Cartographic Data related E de 33 3 6 BACKGROUND CHARTS ebe eege e 33 3 7 PICTURES EE EE 33 3 7 1 Quick Info on Objects with Pictures r rr 34 3 7 2 Expanded Info on Objects with Pictures 34 3 7 3 E en eet 34 3 9 MAP CES 34 3 0 L ZOOM KEE 34 3 8 2 FONTS amp SYMDOIS eege ee ee 34 3 8 3 Perspective View tege ee de eege 35 3 8 4 Dynamic E u u recreen dnni p E ne tence dene EERE E TEN EE Eei peiit 35 E WEE ia NC 35 3 8 6 Safety Status Bar DSI Data Safety Indicator 35 3 8 7 Satellite Kan e Ce EE 36 3 8 8 Currents Prediction Zeene Ee EE 36 3 9 INFO FUNCTION ege ee 37 3 9 1 Info Tree and Expanded Info page rr r 37 3 92 Getting E Bee EE 37 3 9 3 Getting Port INTO eeben 38 3 9 4 Enhanced Port Info DEE 39 3 L0 MAP SETTINGS ss U
43. depth range Press any soft key Map Other Map Configurations ENTER Display Mode ENTER Custom ENTER Depth Range Max ENTER Land Elevation Turns On Off the displaying of Land Elevation gt Press any soft key Mar Other Map Configurations ENTER Display Mode ENTER Custom ENTER Land Elevation ENTER Land Elevation Values Turns On Off the displaying of Land Elevation Values Press any soft key Map Other Map Configurations ENTER Display Mode ENTER Custom ENTER Land Elevation Value ENTER Roads Turns On Off the displaying of Roads on the screen gt Press any soft key Map Other Map Configurations ENTER Display Mode ENTER Custom ENTER Roads ENTER POI Turns On Off the displaying of Points Of Interest gt Press any soft key Mar Other Map Configurations ENTER Display Mode ENTER Custom ENTER POI ENTER Lat Lon Grid Turns On Off the displaying of the Latitude and Longitude grids Press any soft key Map Other Map Configurations ENTER Display Mode ENTER Custom ENTER Lat Lon Grid ENTER Chart Boundaries Turns On or turns Off the displaying of the Chart Boundaries Selecting Auto instead if we are in background charts only the first charts level contained in the DATA MEDIA are displayed if we are in a charts level contained in the DATA MED
44. for O CHART5 O CHART BE and n 1 2 3 4 5 for O CHART7 O CHART ZE Warning After every software upgrade the RAM is cleared and the chart plotter re starts with the usual default settings Please go to the Input output menu and set the proper input format once again 90 D User Manual see Port ninput NMEA 0183 1200 N 81 N NMEA 0183 4800 N 81 N NMEA 0183 4800 N 82 N NMEA 0183 9600 N 81 N NMEA 0183 9600 O0 81 N C Com BBFF 50 200 AIS 38400 Disabled MENU I nput Output ENTER Port n Input ENTER ses Port n Output NMEA 0183 4800 N 81 N NMEA 0180 NMEA 0180 CDX Disabled MENU Input Output ENTER Port n Output ENTER see Port n Output Sentences GLL VTG BOD XTE BWC RMA RMB RMC APB WCV GGA HSC HDG MWV ZDA GSA DPT MENU I nput Output ENTER Port n Output Sentences ENTER see Internal GPS Setup Menu MENU I nput Output ENTER Internal GPS Setup ENTER C LI NK Menu MENU Input Output ENTER C Link ENTER see Cable Wiring MENU Input Output ENTER Cable Wiring ENTER E LATITUDE Angular distance North or South of the equator measured by lines encircling the earth parallel to the equator in degrees from 0 to 90 E LAT LON Coodinate system using Latitude and Longitude coordinates to define a position on earth gt LIST User Points menu Displays the User Points list on the screen
45. if an external video signal source is connected to the chart plotter To select the Video Input pages follow the procedure gt MENU Page ENTER select the Video Input page you want ENTER YEs User Manual 29 Two types of Video pages are available The Chart Video page that shows the chart at full screen and the image from the video camera on a rectangular window which can be moved up down and or left right using the cursor key to select where the window is placed Otherwise it is available the Video page displayed at full screen Note x ae Once the Video Mode is active press POWER and use the following keys to adjust video settings press the Soft Keys to adjust LCD contrast and backlight move cursor up down to adjust brightness and left right to adjust colors press ZOOM IN ZOOM OUT to adjust hue phase Press any other key to exit from Video Mode 3 2 MAP ORIENTATION Selects the orientation of your chart according to North Up the map is Shown with North upwards Head Up the map is shown with the ship s current heading upwards and Track Up the map is shown with the currently selected course leg upwards The default setting is North Up MENU Setup ENTER Map Orientation ENTER If Head Up or Track Up has been selected a window is shown to insert the Map Resolution MENU Setup ENTER Map Orientation ENTER Head Up or Track Up ENTER use cursor to insert va
46. levels resulting in optimal scale display for any situation e Dynamic Elevation Data optimized palettes including the NOAA color palette e Perspective View Real World perspective view of the chart up dated real time during navigation Smooth Zoom smooth transition of cartographic levels Enhanced Turbo Zoom extra fast cartography level change display ing the most important cartographic objects e Enhanced Mixing Levels seamless data presentation e Off line redraw cartography level transition without image construction 3 5 3 CARTOGRAPHIC DATA RELATED FEATURES e Guardian Alarm automatic control and alarm over obstacles on charts in front of your boat e Safety Toolbar interactive alarm system for situational awareness on screen e Safety Route Check sophisticated function checking dangerous ob jects along your navigation route 3 6 BACKGROUND CHARTS The internal background charts can be updated to include the MAX A and B level charts which provide improved marine data rivers lakes terrestrial data major streets highways railways etc nav aids depth areas territorial water areas etc by reading them from a special DATA MEDIA contact your local dealer 3 7 PICTURES amp DIAGRAMS The MAX data format allows assigning one or more image to any carto graphic object These Pictures are typically used to facilitate the identification of cartographic objects or places around the map they can b
47. of the map display The warning message is always displayed as long as the current zoom has no data coverage The DSI window if present will show NO CHART gt Press any soft key Mar Other Map Configurations ENTER Display Mode ENTER Custom ENTER Chart Lock ENTER Underwater Object Limit Selects the max depth value to display Underwater Objects gt Press any soft key MaP Other Map Configurations ENTER Display Mode ENTER Custom ENTER Underwater Object Limit ENTER If value is set to 0 Mt the Underwater Objects are not shown on the charts Menu options are greyed out If value is more than 0 Mt i e 10 Mt in the Range from 0 Mt to the selected value the Underwater Objects are displayed according to their setting below Rocks Turns Off con con Depth gt Press any soft key Map Other Map Configurations ENTER Display Mode ENTER Custom ENTER Rocks ENTER Obstructions Turns Off con con Depth Press any soft key Mar Other Map Configurations ENTER Display Mode ENTER Custom ENTER Obstructions ENTER Diffusers Turns Off con con Depth Press any soft key Map Other Map Configurations ENTER Display Mode ENTER Custom ENTER Diffusers ENTER Wrecks Turns Off con con Depth gt Press any soft key Mar Other Map Configurations EN
48. the cursor key to manually insert the user point name and press ENTER or CoNFIRM to locate it on the map 3 12 ALARMS MENU Sets the desired values settings for the alarms 3 12 1 AUTO OFF To set the automatic shutdown of the alarms when the alarm condition disappears The default setting is On MENU Alarms ENTER Auto Off ENTER 3 12 2 ARRIVAL ALARM To set an acoustic alarm to sound when the vessel is approaching the destination Specifies the radius of a circle around the Waypoint of a route when your vessel reaches this circle the alarm sounds You can disable Off the Arrival Alarm or insert value The default setting is 4 99 Nm gt MENU Alarms ENTER Arrival Alarm ENTER 3 12 3 XTE ALARM To set an acoustic alarm to sound when the vessel is deviating from a defined course The default setting is Off MENU Alarms ENTER XTE Alarm ENTER 3 12 4 ANCHOR ALARM This function allows inserting of the limit of anchor dragging beyond that the alarm is activated The chart plotter computes the distance between the current GPS position and the GPS position saved at the activation of the anchor alarm in the User Manual 47 menu If the computed distance exceeds the value set in the menu the chart plotter Shows the alarm message and starts the acoustic alarm The default setting is Off gt MENU Alarms ENTER Anchor Alarm ENTER 3 12 5 DEPTH ALARM This function i
49. the map screen as soon as any item con trolled by the DSI Data Safety Indicator function returns an alarm condition The Warning Icon remains displayed until the alarm condition persists When Safety Status Bar is On a status bar with six boxes showing the status of certain functions is displayed Any warning or alarm condition is identified by the red color to indicate possible risk DECLUT DANGERS CAUTIONS Fig 3 8 6 Safety Status Bar Boxes definition is as follows Zoom Normal when the chart is displayed at normal scale U Zoom red when the chart is under zoomed out more than twice normal scale gray otherwise O Zoom red when the chart is over zoomed in more than twice normal scale gray otherwise Chart Lock red when the chart is zoomed in more than twice normal scale gray otherwise 2 Best Map Red when a more detailed chart is available under the cursor position 3 Data Off Red when at least one of the following objects or layers is turned off by the user Depths soundings Wrecks obstructions Tracks routes Attention ar eas Nav Aide 4 Declutter Displays when Clear View function is On Dangers Red when Guardian Technology detects one of the following objects Land Inter tidal Depth Area Rocks Obstructions Shoreline Constructions Fishing Facility Wrecks Dredged area Diffusion area Mooring facilities Pingos and Production installations 6 Cautions Red when
50. us should you require technical advice or assistance at FURUNO France Tel 05 56 13 48 00 Fax 05 56 13 48 01 N Hotline Furuno Aftersale SAV 0825 000 150 0 18 ttc min 12 rue Laplace Espace Phare BP 90268 33698 M rignac User Manual 11 CAUTION e Please read through this manual before the first operation If you have any questions please contact the Company s customer service or your local dealer e The chart plotter is not built water proof Please give attention to avoid water intrusion into the chart plotter Water damage is not covered by the warranty e Extensive exposure to heat may result in damage to the chart plotter e Connection to the power source with reversed polarity will damage the chart plotter severely This damage is not covered by the warranty e The chart plotter contains dangerous high voltage circuits which only expe rienced technicians MUST handle e The C MAP By Jeppesen MEDIA are available from your local dealer e Exposure of the display to UV rays may shorten the life of the liquid crystals used in your plotter This limitation is due to the current technology of the LCD displays e Avoid overheating which may cause loss of contrast and in extreme cases a darkening of the screen Problems which occur from overheating are re versible when temperature decreases WARNING ON SERIAL PORTS CONNECTION Please be aware that the serial ports are not opto isolated and then the external de
51. 2 if there is a MEDIA inserted in the slot but it is a damaged MEDIA 3 if there is not any MEDIA inserted in the slot the message not present is shown 4 if there is an MEDIA inserted in the slot the message USER MEDIA is shown E MEDIA Connector Indicates if there is a malfunction in the connector It is used only in production 8 1 4 MODEM TEST To check the Modem connections Press ENTER to select the preferred Port related to the connections made to the Port that the Modem C COM is connected 8 1 5 SERIAL PORT If you are having problems receiving data from the position finding instru ment this test should help determine the problem E Change Parameters To change the parameters of the serial interface This menu allows to select the Port the Baud Rate between 4800 or 9600 the Data Bits Word Length between 7 or 8 the Parity between even odd or none the Stop Bits between 1 or 2 E Input Data Display To allow the chart plotter to act as a computer terminal and display the incoming data exactly as it received If the data displayed on the screen is unrecognizable you may have selected the wrong input parameters for your particular receiver Check your receiver manual to be sure that you have selected the proper interface format If the screen is blank you may have a broken connection and no data is being received Use ZOOM IN to stop or continue after pause data displaying ENTER to show data in hex or ASCII mo
52. 7 4 2 7 Finding Information on Marks User Points List 57 4268 Send CH EE 57 E OR eg SE 57 4 3 USING THE TRACK FUNCTIONS rrrrrrrrrsrsnsrsrrrrrsrsrsrnrnnnnnnnnnndannrrrrsasa 58 4 3 1 Enabling Track storing EE 58 4 3 2 Deleting Track EE 58 4 3 3 Config Cu SE 58 D Selecting Active Track TEE 58 4332 EK Ae EN e LE 58 4 3 3 3 Selecting Track Color r r rr rrrssrrrrrrsss 58 4 3 3 4 Selecting Track memorizing type 58 4 3 3 5 Selecting Time EE 58 4 3 3 6 Selecting Distance EE 58 4 3 3 7 Deleting All Tracks r rr 59 4 3 4 Deleting Total and Partial Distance LOG 59 4 3 5 Track To Route Conversion EE 59 4 3 5 1 Track to Route EE 59 4 3 5 2 Select Track N rmb ekF us dosucidumanirue tenes deueamatame ene naeoeransastoatanes 59 4 3 5 3 Select Route Number ege agg ee Age EE Eed ENEE ee 59 4 4 MEMORY CARD MENU eerste eege EE Ee 59 4 4 Saving File secradrcedheivenansan danas meaannreuetasaspuied EER 59 4 4 2 Loading File cuSacevinawenccmaaitevnis tdtsuduiseattaucinernaiganceriddwescemtaaitenassenaneans 60 44 3 Deleting GT 60 AAA MEDIA EEN 60 4 4 4 1 Reading Directory on MEDIA r a 60 444 2 Formatun
53. A MEDIA gt TRACK menu As long as the chart plotter is connected to a positioning instrument it stores all points in its memory The chart plotter can store a fix when the distance from its last stored position is greater than a defined distance or after a defined time A line connects such points and represents the past course called the track of the ship ewe Activate Deactivate Track MENU Track ENTER Activate Deactivate ENTER ua Delete Track MENU Track ENTER Delete ENTER Beacin ENp WHuokLE YEs sss Config Track Menu MENU Track ENTER Config ENTER EEE LOG MENU Track ENTER Log ENTER Totat TRIP 1 Track To Route Menu MENU Track ENTER Track to Route ENTER gt TRACK TO ROUTE menu This function creates a Route from a pre recorded Track sws Track To Route MENU Track ENTER Track to Route ENTER Track to Route ENTER 12 Select Track No MENU Track ENTER Track to Route ENTER Select Track No ENTER sss Select Route No MENU Track ENTER Track to Route ENTER Select Route No ENTER E TTG Time To Go Estimated time needed to reach your destination based on your current speed and the distance to destination E UTC Universal Time Coordinated Time scale based on the rotation of the earth that is used by most broadcast time services E
54. A0183 C COM BBFF C LINK AIS SIGNAL GROUND OUTPUT 1 NMEA0183 AUTOPILOT INPUT 2 NMEA0183 C COM BBFF C LINK AIS OUTPUT 2 NMEA0183 AUTOPILOT SIGNAL GROUND External Wiring for O CHART7 110 User Manual S TNC active GPS antenna DEPTH SHIELD DEPTH SPEED AUX I O CONNECTORICABLE 8 pins PIN WIRE COLOR DESCRIPTION Power output GND Power output 300mAMax Vin To power low power consumtion devices Input 4 NMEA0183 C COM BBFF C LINK AIS VIDEO IN Connector male Cable 3 pins PIN DESCRIPTION Cd Video Signal from VCAM 3 GND d R ch TRANSDUCER Connector PIN FUNCTION j L re SE 1 DEPTH MU 2 GND J me 3 TEMPI 4 POWER SUPPLY 5Vdc 1A max Ass I 6 7 8 GND GND Output 5 NMEA0183 AUTOPILOT Output 4 NMEA0183 AUTOPILOT Input 5 NMEA0183 C COM BBFF C LINK AIS External signal To GND when activated QUICK DISCONNECT BRACKET POWER amp I O CABLE WIRE COLOR Power Input GND POWER SUPPLY GND Power Input 10 35VDC POWER SUPPLY INPUT1 NMEA0183 C COM BBFF C LINK AIS SIGNAL GROUND OUTPUT1 NMEA0183 AUTOPILOT SIGNAL GROUND External Wiring for O CHART7F Note The Active GPS Antenna must be used only if the Internal GPS doesn t work User Manual 111 iagrams D
55. AP CONFIGURATIONS menu Selects from a predefined table what cartographic objects are displayed and which display options are set ewe Display Mode Full Medium Low Radar Tide Custom Press any soft key Mar Other Map Configurations ENTER Display Mode ENTER The following are the available selections only if Custom has been selected ewe Place Names On Off Press any soft key Mar Other Map Configurations ENTER Place Names ENTER ss Name Tags On Off Press any soft key Map Other Map Configurations ENTER Name Tags ENTER ess Nav Aids amp Light Sectors On Off No Sector Press any soft key Map Other Map Configurations ENTER Nav Aids amp Light Sectors ENTER ees Attention Areas On Off Press any soft key Map Other Map Configurations ENTER Attention Areas ENTER sss Tides amp Currents On Off Press any soft key Map Other Map Configurations ENTER Tides amp Currents ENTER 92 D User Manual ene Seabed Type On Off Press any soft key Mar Other Map Configurations ENTER Seabed Type ENTER wee Ports amp Services On Off Press any soft key Map Other Map Configurations ENTER Ports amp Services ENTER aa Tracks amp Routes On Off Press any soft key MaP Other Map Configurations ENTER Tracks amp Routes ENTER
56. D VMG Depth Time Date PTL TTL gt Dst Bra Route 01 Waypoint 994 51 952W AWS TWS COG Temp X x x X X X lt D Fig 3 1a Example of Data pages Databox Setup Selects the desired configuration for the data window allowing to select the number of lines max 4 and the values that are shown in the Text Area The first column says that the line is displayed or not moving the cursor up and down select the desired line and using ENTER to select it After pressing ENTER the data type has been selected User Points List Displays information on all stored User Points Marks and Waypoints Route Data Report Displays information on Routes 3 1 1 CHART PAGE It is very important to know what is displayed on the screen OnLy For O CHARTS 5F gt PAGE Chart ENTER OnLy FoR O CHART7 ZE gt MENU Page ENTER Chart ENTER shows the chart at full screen 51 41 721N den 001 46 255 frnettor a Bas Y Fig 3 1 1 Example of Chart page 26 D User Manual 3 1 2 CHART DATABOXES PAGE It is possible to display the chart and the selected Data Boxes on the screen ONLY FoR O CHARTS 5F gt PAGE Chart Databoxes ENTER OnLy FoR O CHART7 ZE gt MENU Page ENTER Chart Databoxes ENTER oles 51 41 724N 001 46 255E Fig 3 1 2 Example of Chart Databoxes page 3 1 3 ROLLING ROAD PAGE The Rolling Road page displays the navigation
57. E 83 6 5 11 5 Calibrate Aux Temperature rr r r rr ech 83 6 5 11 6 Set Default settings seggt 83 6 5 12 E ge EEN 83 6 520221 Shallow Water E 83 6 5 12 2 Deep EE 83 65 12 35 High Water Temperature ees Ae Ee AER ee ehren 84 6 5 12 4 Low Water Temperature r r r r 84 6 5 12 5 Water Temperature Rate ginn is denge ee 84 6 5 12 6 IFISI AION EE 84 6 5 13 SaAVe amp L08d MEN 84 6 5 13 Load Settings from MEDIA 84 6 5 13 2 Save Settings to MEDIA u u u siswa ssaagaspassaqipankapiaqapaqawyaayaa akha 84 6 5 13 3 Restore Current Preset Defaults r AER Bue 84 6 6 Trapsducers 1111 Ehe dree ee piqa khapu quq unpuy 84 6 6 1 Dedicated Available Transducers gen teuer Ee deeg 85 Ze Terms amp F nctions Cs Q u ssssswawssswswwwmaanwwwawanawwsasmnaxsswasamasswasasanasssasaamanasasaananaswa 87 8 System Rest weg EENS geien 99 Sech SYSTEMTEST ee 99 8 J 1 RAM Me u knees eet EE Ee ees 99 8 1 2 DIM TC EEN EE 99 Belo ER e ed gel GE 100 8 1 4 Modem e KC 100 6 15 Senal TC SE 100 Hl Ce ee EE 100 8 1 7 Onty For O CHART7 7F External Alarm r 100 app endix A Troubleshooting uu uu ua a a a aai 101 O CHART5 O CHART5F EE 103 TECHNICAL SPECIFICATIONS EE 103 OnLy For O CHART5F FF MODULE 600
58. EE Deleting e E EE 49 4 1 1 3 Finding Info on Route Route Data Report 49 Changing TEE 50 Changing Speed EE 50 Reversing Route ege ENKE NEA EE EES ES EE SEENEN SEN KEES EE EN 50 Selecting the Databoxes Setup and User Points List pages 50 4 14 Route e TEE 50 4 1 1 5 Sending ROUTE EE 50 4 1 1 6 Receiving Route EE 50 4 1 1 7 Safe Route Checking r e 51 6 D User Manual 4 1 2 EK ele e ECH 51 4 1 2 1 Adding Waypoints r r r 52 4 1 2 2 Moving Waypoint EE 52 4 1 2 3 Deleting Waypoint a 53 4 1 2 4 Editing Waypoint EE 53 D e E E CT e SEN 54 4 1 2 6 Inserting Waypoint uu u u 1 um Ee 54 41 27 FIYQIDnG Ee SE 55 4 1 2 8 Finding information on Waypoints User Points List page 55 View Waypoint on the Map r 55 Find Waypoint in the User Points List poage 56 Deleting Waypoint ER 56 Selecting the Databoxes Setup and the Route Data Report pages 56 4 1 2 9 Se erd KEE een EE 56 4 1 2 10 Receive Waypoints g t ERENNERT ASSEN Ae 56 4 2 MARKS i Oone EETA EEEN E EEEE R EEEE E EEEE uetearemnsactaiGreceieeee mes 56 4 2 1 Adding Ca GE 56 De Moving Mark EE 56 4 2 3 De eleting Ce EE 57 4 240 elei Ce SEENEN 57 Ago GOO EE 57 42 6 Finding CC SEET 5
59. EG List MENU List ENTER List ENTER oss Send MENU List ENTER Send ENTER ene Receive MENU List ENTER Receive ENTER E LONGITUDE Angular distance East or West of the prime meridian Greenwich meridian as measured by lines perpendicular to the parallels and covering at the poles from O to 180 E MAGNETIC DEVIATION Angle between the Magnetic North and the Compass North E MAGNETIC VARI ATION The angle between the magnetic and geographic meridians at any pace expressed in degrees West or East to indicate the direction of magnetic North from true North It changes from point to point and at the same point with time gt MAP menu The user may choose either to display or not on the screen the selected objects depending on his specific requirement ene ZOOM Type Standard Flexi Zoom Press any soft key Map Zoom Type ENTER see Fonts amp Symbols Normal Large Press any soft key Mar Fonts amp Symbols ENTER sss Perspective View On Off Press any soft key Map Perspective View ENTER see Dynamic Nav Aids On Off Press any soft key Map Dynamic Nav Aids ENTER st Mixing Levels On Off Press any soft key Map Mixing Levels ENTER a Safety Status Bar On Off Icon Press any soft key MaP Safety Status Bar ENTER ess Satellite Imagery On Off Press any soft key MaP Satellite I magery ENT
60. ER User Manual 57 4 3 USING THE TRACK FUNCTIONS The chart plotter can be set up for recording your track as you move and for EE this track on the chart MENU Track ENTER 4 3 1 ENABLING TRACK STORING gt MENU Track ENTER Activate ENTER To enable the track storing It is not possible to use the track storing if you are not receiving a valid fix To disable the track storing if the track is enabled gt MENU Lt Track ENTER Deactivate ENTER 4 3 2 DELETING TRACK gt MENU Track ENTER Delete ENTER Delete the all track or only a part Wuote Becin and ENp allow to identify the begin and end points of the segment to be delete 4 3 3 CONFIG MENU gt MENU Track ENTER Config ENTER 4 gt 3 3 1 Selecting Active Track MENU TRACK ENTER Config ENTER Active Track ENTER Select the number of the active track The default setting is 1 4 3 3 2 Displaying Track gt MENU Track ENTER Config ENTER Display Mode ENTER Select to display Visible or not Hidden the track The default setting is Visible 4 3 3 3 Selecting Track Color gt MENU Track ENTER Config ENTER Color ENTER Select the desired color for the selected track The default setting is Black 4 3 3 4 Selecting Track memorizing type gt MENU Track ENTER Config ENTER Step Unit ENTE
61. ER ont Time MENU Simulation ENTER Time ENTER sss Cursor Control On Off MENU Simulation ENTER Cursor Control ENTER sss Simulation Mode On Off MENU Simulation ENTER Simulation Mode ENTER E SNR Signal to Noise Ratio Ratio of the magnitude of a signal that of the noise interference E SOFT KEY Software keys have different functions according to the modes of operation their labels for the current functions located on the front panel are shown on the screen right above the soft key E SOG Speed Over Ground Calculation of the rate of movement of the ship over the ground E SPEED Current velocity at which you are travelling relative to a ground location gt TARGET or GoTo See Golo E TIDE Periodic rise and fall of the surface of oceans bays etc due principally to the gravitational interactions between the Moon and Earth E TIDE INFO Combination of a tide heights database and features which calculate the tide graph for all primary and secondary ports world wide This function can calculate the tide heights for any past or User Manual 95 future date and as a by product of this calculation will also display the Maximum and Minimum Tide height and time for the day selected plus the times of Sunrise and Sunset At some chart levels the chart plotter will display a new Tide Diamond Symbol for every Port or tide point in the database covered by that particular DAT
62. ER ene Currents Prediction Press any soft key Map Currents Prediction ENTER see Other Map Configurations Menu Press any soft key Map Other Map Configurations ENTER ene Info Press any soft key MaP Info ENTER wee Find Menu Press any soft key Map Find ENTER gt MARK Reference points related to cursor position User Manual 91 Add Mark ENTER MARK ENTER Move Mark place cursor on Mark Move cursor ENTER Delete Mark place cursor on Mark Deeg ENTER Edit Mark place cursor on Markt Epit ENTER select field Symbol Name Color Coordinates using cursor ENTER GoTo on Mark place cursor on Mark GoTo ENTER Find Mark press any soft key MaP Find ENTER User Points ENTER Info on Mark MENU List ENTER List ENTER Send Mark MENU List ENTER Send ENTER Receive Mark MENU ListT ENTER Receive ENTER E MEDIA Also called simply cartridge gt MEDIA menu Before a new MEDIA can be used you must format it The formatting function initializes the MEDIA and prepares it for storing information Remember that if an MEDIA is not blank formatting it will destroy any data already present on the MEDIA the MEDIA must be formatted in order to be reused this operation means all old data memorized on the MEDIA will be lost ess Read MENU Memory Card ENTER MEpiA
63. ER ON AND DEE eege gege eN NEEN ENER ge ANEN dE 20 2 2238 PURGING OM Siteisiwncedcarniadandtjentidneeduseiinanhehensweseiuneidasntenanersmabdeeetiaan tien 20 2 22 e e ut e D gr SE 20 239 MIRST SETUP PAGE EEN 20 2 4 e e ERR CA CC RW 21 SEENEN 21 2 5 SELECTING THE USER INTERFACE LANGUAGE ebessen geseet ege gie ee 22 2 6 SELECTING THE CHART LANGUAGE rrr rr 22 2 7 EXTERNAL CONNECTIONS Zeie green ege leier tasha EE 23 2 7 1 Autopilot Connections EE 23 2 7 2 External NMEA Connections EE 23 2 7 3 C COM e nl gel 23 2 7 4 Onty For O CHART7 7F External Alarm Connection 23 2 8 USING C MAP By Jeppesen DATA MEDIA rr rr 23 2 9 SIMULATION MENU z usserst egen DEE ege ra Ae dee ge geed 24 2 9 1 Sim laton e TEE 24 2 9 2 ee ENEE 24 29 3 E ele e SEENEN 24 2048 Date j siiciwrsusndeconsnussnoandiunsspraiuiensdesmeneansoesseweaetoniunnGanspnemmrseieeeas 24 2 95 RNE EE 24 2 9 6 CURSOR Control tree steel ee Eeer 24 3 For the New USEF EE 25 3 1 SCREEN DISPLAY CONFIGURATION EE 25 Ge D ie et ENEE 26 3 1 2 Chart Databoxes Page ja cicientccesieeesiaroetucindcrietnridceeiteomitnantioapedakendeottuxsetesads 27 3 1 3 Rolling Road Re EE 27 3 1 4 GPS Status Page EE 28 3 1 5 Depth Graph e 28 3 1 6 Onty ron O CHART7 7F Video Input Pages 29 3 2 MAP ORIENTATION _ ees EE asnan amalaya wa
64. Finding Lakes Information 45 Finding Mark EE 57 92 Finding Obstructions 45 Finding Points Of Interest 46 Finding Ports By Distance 45 Finding Ports By Name 45 Finding Ports Services 44 Finding Tide Stations 45 Finding User Points 47 Finding Waypoint 55 56 96 Finding Wrecks 45 First Setup Page menu 19 20 Fish ass eege 80 FISPIWALQTTIYU sureness iontas nr REET EENEN 84 et lee EE 18 72 73 Fish Finder 200kHZz 77 Fish Finder Dual Frequency 78 Fish Finder Echogram 75 Fish Finder Full page 77 Fish Finder page 74 Fish Finder Setup Menu 80 89 90 Fish Finder transmission 73 Fish ICONS r 83 Fish Symb60l8_ uu ul usu in aussi kashaii 82 Fishes r r r r 75 Fishing Facility 36 51 Flexi Zoom 33 34 Focus Soft Key 79 Fonts amp Symbols 34 91 Forecast 61 62 88
65. IA the next four charts level are displayed Press any soft key Map Other Map Configurations ENTER Display Mode ENTER Custom ENTER Chart Boundaries ENTER Value Added Data The Value Added Data VAD is a collection of additional car tographic objects which are not present on the original paper chart from which the electronic chart derives These objects have been obtained from other sources and then merged to the electronic charts in order to provide more information useful for the navigation VAD object can be any cartographic objects and it can be distinguished from the official chart objects from the Quick Info A dedicated icon is shown on the Quick Info window to indicate that the object queried is a VAD The Same icon is also shown on the Full Info page and in addition the extended text Value Added Data is shown on the details of the VAD object Press any soft key Map Other Map Configurations ENTER Display Mode ENTER Custom ENTER Value Added Data ENTER User Manual 41 Chart Lock When Chart Lock is On the available zoom scales are only the ones containing cartographic data Instead when Chart Lock is Off it is possible to zoom down into zoom scales not covered by cartographic data after the last available zoom scale covered by cartographic data Note When an empty level is entered the message No cartographic coverage is shown ona window in a corner
66. It is possible to set the palette used to enhance the visibility of the screen depending on the surrounding light condition To select this option gt POWER MENU or gt MENU LCD Adjustment ENTER MENU It is possible to select Normal Sunlight Night Vision or NOAA for Palette Normal is recommended when the chart plotter is not exposed to the direct sunlight When this mode is set the maps are displayed in order to use colors as similar as possible to the ones used in the original paper charts Sunlight is designed to enhance the visibility of the screen when the chart plotter is exposed to the sunlight The maps are much brighter than in the other modes and the depth areas are filled with white color so different depth areas are not easily distinguishable Night Vision is recommended when the environment is dark in order to reduce the glare of the display The chart plotter displays maps and screen in darker colors NOAA allows setting NOAA paper chart colors presentation User Manual 21 2 5 SELECTING THE USER INTERFACE LANGUAGE It is possible to set the language to display menus data pages warning alarm messages full quick info list of objects found by find nearest function and on charts such as place s names buoy s names and so on To select the language you want gt MENU Setup ENTER Language ENTER Note If the selected language is not available on cartographic data English lan
67. ON To select the research of Lakes Information following the procedure gt Press any soft key Map Find ENTER Lakes Info ENTER Note _ An optional MAX Lake MEDIA must be inserted into the chart plotter to take advantage Lakes Information The available MAX Lake MEDIA are NA M0O17 USA North NA M018 USA East NA M019 USA South NA M020 USA West NA M029 Alaska NA M048 Canada It founds the Outdoor Recreational Area objects See the following picture User Manual 45 Port Services Port by Name Port by Distance Tide Stations Wrecks Lakes by Name Points of Interest Fig 3 11 7 Outdoor Recreational Area objects Use the cursor key to select any objects and press FiNp The list of the nearest lakes up to 10 containing the facility will be shown on the screen STRELNA LAKE STRELNA LAKE 5112 28 PAXSON LAKE 5074 66 PAXSON LAKE 5074 66 MOOSE LAKE 5141 2 MOOSE LAKE 5141 2 CROSSWIND LAKE 126 05 CROSSWIND LAKE 5126 05 LAKE LOUISE 5145 84 BI Fig 3 11 7a Nearest Lakes list Choose the lake you want and press Finp the Full Info page is shown 3 11 8 FINDING LAKES BY NAME To select the research of Lakes By Name following the procedure gt Press any soft key Map Find ENTER Lakes by Name ENTER Lakes by Name ENTER Shows the list in alphabetical order of all lakes stored on the DATA MEDIA To select next previous page press ZOOM IN ZOOM OUT or use t
68. OOWO Warning message Echogram window LA EE SOG 1 kts A Color Bar 6 B 42 08 008N Digital Depth O E SP T Water temperature E Alarm Bar 2 H Depth ruler 3 sof 9 Variable Depth Marker VDM 4 9 P A0 Zoom Bar ion i A Scope ZS E D Operating Frequency Fig 6 2 The Fish Finder page The following is a short description of terms listed in the previous Fig 6 2 Warning Message Flashing label Simulation when the echo sounder is in Simulation mode Echogram window Graphic presentation of sonar soundings recorded as a continuous profile scrolling across the screen from right to left Such recordings represent the image of the water beneath your boat items appear as they pass under your transducer the items on the right side of the screen are closer to you than those on the left The correct interpretation of the Echogram allows retrieving useful information about what is under the boat See the following Par 6 2 1 for more information 3 Color Bar Colored scale located on the left side of the screen that shows the colors used in the Echogram to represent the echoes strength The color on the top of the bar represents the maximum sonar strength while the color on the bottom of the bar represents the minimum sonar strength Digital Depth Readout of the current bottom depth Water Temperature Readout of the current water temperature returned by the TEMP 1 sen
69. Out sliding down the chart plotter recognizes a Zoom In When the movement on the Zoom Slider is from top to bottom Zoom In operation is executed Otherwise when the movement on the Zoom Slider is from bottom to top Zoom Out operation is executed A more advanced use of the Zoom Slider takes into account the movement range If the movement has a short range the Zoom operation Zoom In or Zoom Out is executed only once If the movement has a wider range the Zoom operation Zoom In or Zoom Out is executed twice or more times The Map Rotor The function associated to the Map Rotor depends on the status of the function Perspective View see the Par 3 8 3 When Perspective View is set On the Map Rotor rotates the chart in the center of the screen the rotation is proportional to the movement When Perspective View is set Off the Map Rotor scrolls the chart acts like when the cursor touches the edge of the scrollable chart and keeps moving to the same direction The Sensors Calibration menu The Sensors Calibration menu is accessible from the Setup menu gt MENU Setup ENTER Sensors Calibration ENTER Two options are available Default and Manual Default sets the sensitivity value to 7 Otherwise if Manual has been selected the screen shows an image with the two sensors Zoom Slider and Map Rotor on the page You can change the level of sensitivity by pressing ZOOM IN or ZOOM OUT keys You touche the desired sens
70. PS doesn t work 106 User Manual O CHART7 O CHART7F TECHNICAL SPECIFICATIONS Power Consumption O CHART7 O CHART7F Power Supply Display Display Resolution Video Input Cartography MEDIA Operating temperature range Memory Keyboard Weight O CHART7 O CHART7F Accessories User Manual 900 mA max 12V 12W Average 27W peak with FF on 10 35 Volt dc 11Watt max TFT LCD 7 landscape color sunlight WVGA 800 x 480 pixels PAL or NTSC video signals automatically se lected C MAP By Jeppesen MAX DATA MEDIA SD Card 0 55 C 32 131 F Non volatile Silicon rubber backlight 1150 gr 1310 gr e Protective cover e Quick Disconnect Bracket e Flush mount template and kit e Fuse 2 Amp fuseholder O CHART7 e Fuse 3 Amp fuseholder O CHART 7F e User Manual 107 ONLY For O CHART7F FF MODULE 600w 50 200KHzZ TECHNI CAL SPECI FI CATIONS e Power Output 600W 4800W pp 50 200KHz Dual Frequency e Max Depth 213m 7OOFt at 200kKHz 457m 1500Ft at 50kHz e Automatic Recognition of the AIRMAR X DUCER ID transducers for best per formance e Advanced Digital Signal Processing e Speed amp Temperature Sensor if available on transducer e Alarms shallow water depth Fish temp e Trip Log Fish Symbols e STC Interference Rejection Automatic noise reduction e A scope White Line Zoom x2 x4 e Auto range gain frequency shift ping rate INSERTING
71. R Select the Distance the chart plotter can store a fix when the distance from its last stored position is greater than a defined distance or Time the chart plotter can store a fix after a defined time The default setting is Time 4 3 3 5 Selecting Time gt MENU Track ENTER Config ENTER Time Step ENTER When the tracking function is On and the type of track storing is Time the chart plotter can store a fix after a defined time It allows to choose among 1 5 10 30 sec 1 min The default setting is 1 sec 4 3 3 6 Selecting Distance gt MENU Track ENTER Config ENTER Distance Step ENTER 58 D User Manual When the tracking function is On and the type of track storing is Distance you can store a fix when the distance from its last stored position is greater than a defined distance It allows to choose in the range 0 01 0 05 0 1 0 5 1 0 2 0 5 0 10 0 Nm the distance unit is selected by the user see Setup menu Cap 7 The default setting is 0 01 Nm 4 3 3 7 Deleting All Tracks gt MENU Track ENTER Config ENTER Delete All Tracks ENTER A warning window appears press ENTER or Yes CLEAR or No otherwise 4 3 4 DELETING TOTAL AND PARTIAL DISTANCE LOG gt MENU Track ENTER Log ENTER It is possible to reset the total and partial distance that the ship has travelled from the begin of the navigation Press Totat to res
72. RADIO OCEA 1 Chart Plotter Name Description SOFTWARE O CHART5 5 Sunlight Readeable Color Display S4xgRO5vc Internal GPS Receiver O CHART5F 5 Sunlight Readeable Color Display S4xgRO5vc Internal GPS Receiver amp Internal Fish Finder O CHART7 7 wide Sunlight Readeable Color Display S4xgRO8wc Internal GPS Receiver O CHART7F 7 wide Sunlight Readeable Color Display S4xgRO8wc Internal GPS Receiver amp Internal Fish Finder User Manual code d1620 040810e d1620 040810e Copyright 2010 Furuno France Printed in Italy All rights reserved No part of this publication may be reproduced or distributed in any form or by any means or stored in a database or retrieval system without prior written permission of the publisher Table of Contents Ir DortaritinfOrmation ebe EE 11 NEES lee 11 LIMITED WARRANTY C C le l 2 2 2ssssssissuskarusyhapaphypa yku EET paktayka asha E E EE iaer ER rE iai 11 CAUTION E E E EE E E EE 12 CLEANING PROCEDURE FOR THE PLOTTER SCREEN rrrrrr rr 12 BK de DT d LN NEE 13 1 1 FEATURES hee eats eed e tase tee Ea EE aie O n Opa aba 13 t2 BASICS E EE EE 14 1 3 IF YOU NEED ASSISTANCE EE 15 2 Before You Begin wee dRENRNNEK E wi unninn aa A a 17 2 1 THE KEYBOARD EE 17 2 1 1 Ony For O CHART5 5F The PAGE JEE ageet gege AEN eege 18 2 1 2 Onty ror O CHART7 7F Zoom Slider and Map Rotor 19 2 2 TURNING THE CHART PLOTT
73. REMOVING PROCEDURE INSERTING MEDIA Open the door hold the MEDIA by the short side with the cut corner up Gently push the MEDIA into the slot as far as it will go to hold fixed into the slot and close the door REMOVING MEDIA To remove the MEDIA open the door then press gently on the MEDIA and take it out from the slot 108 D User Manual DIMENSIONS a 18 5mm Zag 96 5mm 3 8 lt gt 256mm 10 1 80mm 3 1 lt 98 5mm 3 9 lt gt 16 5mm 0 7 74mm 2 9 D 45mm 1 8 57mm 2 2 INSTALLATION 4 5 MOUNTING HOLES 4 POS 240mm 9 8 CUTTING LINE 6 17 Flush mounting 74mm 2 9 NS Bracket mounting User Manual 109 CH M4 threaded M4 threaded 27 mm Mounting Screws EXTERNAL WIRING TNC active GPS antenna VIDEO IN Connector male Cable 3 pins PIN DESCRIPTION id Video Signal from VCAM 3 GND AUX UO CONNECTORICABLE 8 pins PIN Power output GND Power output 300mAMax Vin To power low power consumtion devices Input 4 NMEA0183 C COM BBFF C LINK AIS GND GND Output 5 NMEA0183 AUTOPILOT Output 4 NMEA0183 AUTOPILOT Input 5 NMEA0183 C COM BBFF C LINK AIS External signal To GND when activated FUNCTION POWER INPUT GND POWER SUPPLY GND POWER INPUT 10 35VDC POWER SUPPLY INPUT 1 NME
74. SI EN 301 489 1 V1 5 1 folgenden Normen KEE ETSI EN 301 489 19 V1 2 1 Es conforme a las siguientes Electrostatic discharge ESD CEI EN 60945 2002 10 normas i ETSI EN 301 489 1 V1 5 1 eee EITSLEN 301 489 19 V1 2 1 _ Conducted radiofrequency interferences CEI EN 60945 2002 10 Conducted RF immunity ETSI EN 301 489 1 V1 5 1 EE EISEN 301 489 19 V1 2 1 Compass Safe Distance CEI EN 60945 2002 10 Kee ISO R 694 _ _ i EFT Bursts Fast Transients CEI EN 60945 2002 10 _ __ DC Power Interruptions Variation and Polarity CEI EN 60945 2002 10 inversion eee EE Safety Part 1 general requirements CEI EN 60950 2004 E We nous Wir nosotros Deano OCEAN Declare that Radio Ocean is a commercial brand sole propriety of Furuno France D clarons que la marque commerciale Radio Ocean est la propri t exclusive de Furuno France Radio Ocean ist ein Markenzeichen von Furuno France S mtliche Markenrechte sind Eigentum von Furuno France Declaramos que la marca comercial Radio Ocean es la propiedad exclusiva de Furuno France On behalf of Furuno France Bordeaux the 7 January 2010 Didier BUREAU Managing Director
75. Systems There are many different Datum in use each one gives different Lat Lon positions for an identical point on the surface of the earth 88 D User Manual E Dedicated Key Key with a specified function These keys have a label printed on them E DEFAULT Indicates a value or a setting which is used if the user has not defined a particular value You can modify this value using the menu settings gt DEPTH pages Allows to display the Depth Graph if Fish Finder pages are not available and if valid NMEA0183 depth data Is available On ty For O CHART5 5F full screen PAGE Full Depth ENTER split screen chart PAGE Chart Depth ENTER split screen data boxes PAGE Depth Databoxes ENTER ONLY For O CHART 7 ZE full screen MENU Page ENTER Full Depth ENTER split screen chart MENU Page ENTER Chart Depth ENTER split screen data boxes MENU Page ENTER Depth Databoxes ENTER E DEPTH RANGE The sea area that is beyond the selected range is filled by an uniform white color the sea area that is inside the selected range is filled by ordinary multicolor shading The Spot Soundings and Depth Contours are displayed on the range only gt DEVICES menu Allows to select the following menu ss FISH FINDER SETUP Menu MENU Devices ENTER Fish Finder Setup ENTER see ALS Menu MENU Devices ENTER AIS ENTER ua DSC Menu MENU
76. TC Strength If STC is Custom it is possible to change the Strength of the Sensitivity Time Constant 6 5 9 6 Surface Noise Filter This function implements an advanced time varying filter that allows Suppressing the surface clutter efficiently while leaving fish targets visible Note Thus imposing the capability of the Fish Finder to correctly detect the weakest echoes coming from a very deep bottom 6 5 10 DISPLAY SETUP The Display Setup Menu allows you to change the color scheme of the Fish Finder display adjusts the chart scrolling rate enables or disables the White Line and allows determining the graphical representation of fishes MENU Devices ENTER Fish Finder Setup ENTER Display Setup ENTER 6 5 10 1 Color Settings Allows you to change the color scheme of the Fish Finder display The available colors are Blue Background White Background Black Background Gray Scale and Reversed Gray Scale 6 5 10 2 Scrolling Speed Adjusts the chart scrolling rate Note that the scrolling rate is limited by the sound speed and the depth according with the following relation the deeper the setting the slower the scrolling rate 100 is the maximum possible 6 5 10 3 White Line Controls how the chart plotter displays information about the bottom type hard or soft 6 5 10 4 Fish Symbols This selection allows determining the graphical representation of underwater suspended targets See the following table Ech
77. TER Display Mode ENTER Custom ENTER Wrecks ENTER Note Choose the option OFF the object is not visible independently of the selected Underwater Object Depth Value ICON the object icon is visible without tags in the range selected from Underwater Object Depth Value option ICON DEPTH the object icon and tag is visible in the range selected from Underwater Object Depth Value option 3 10 2 GETTING AUTOMATIC INFO The type of Automatic Info is user selectable gt MENU Setup ENTER Auto Info ENTER The possible settings are e Off disabled no automatic info shown at all e On Points only on points This is the default setting e On All on all objects points lines and areas The Automatic Info On Points shows information when the cursor is placed on points as Port Services Tides lights wrecks rocks buoys beacons obstruc tions land markers etc The Automatic Info On All shows information when the cursor is placed on points on lines as Depth contours Traffic Separation Territo rial Sea Cartographic Lines etc on areas Depth Built up Sea Attention Re stricted etc and on names on the beginning of the text hot spot or on any of the characters of the name name message box The details on Land Source of Data 42 D User Manual Cartographic Area and Spot Soundings are not shown If you press ExPAND you get the information about that obj
78. TER Allows selecting the Layer of specific weather data to be displayed on the screen and to change date and time of the forecast preview The following functions are available e Panning Default usage of the cursor key is the normal panning function Zoom In Out allowed as usual by using ZOOM IN ZOOM OUT e Set type of data Tyre to choose data among Wind Wave Data Wheater Humidity Temperature Visibility Set Date and Time Date Time to choose date and time among the pre set one by the server e Exit Exit to close the weather prediction page 5 1 1 4 Real Time View gt MENU C Weather ENTER Real Time View ENTER The following selections are available e Real Time View On The data is shown the area of the download at the current date and time received from the GPS e Real Time View Off The weather data is not displayed The layer displayed is the one selected into the previous menu item 62 D User Manual 5 1 1 5 Type of Data gt MENU C Weather ENTER Type of Data ENTER Allows selecting the type of data among Wind Wave Data Wheater Hu midity Temperature Visibility See the previous Fig 5 1 5 2 AIS MENU AIS is an Automatic Identification System It has been introduced to im prove the safety of navigation by assisting in the efficient operation of ship to ship ship reporting and VTS applications The system should enable operators to obtain information from
79. U Setup ENTER Temperature Units ENTER sss Time Reference UTC Local time MENU Setup ENTER Time Reference ENTER ees Daylight Saving Time On Off MENU Setup ENTER Daylight Saving Time ENTER set Time Format 24 hour 12 hour MENU Setup ENTER Time Format ENTER sua Date Format MM DD YY DD MM YY MENU Setup ENTER Date Format ENTER aa Bearing Auto Mag True MENU Setup ENTER Bearing ENTER sat Visual COG Bar On Off MENU Setup ENTER Visual COG Bar ENTER see Map Orientation North Up Head Up Track Up MENU Setup ENTER Map Orientation ENTER ess Auto I nfo Off On Points On All MENU Setup ENTER Auto Info ENTER aaua Nav Aids Presentation International US MENU Setup ENTER Nav Aids Presentation ENTER ene Keypad Beep On Off MENU Setup ENTER Keypad Beep ENTER ene Sensors Calibration Default Manual MENU Setup ENTER Sensors Calibration ENTER gt SIMULATION menu Used in order to use your chart plotter without input data It generates a display with a moving vessel so that you can practice using the controls in safety sss Speed MENU Simulation ENTER Speed ENTER ees Heading MENU Simulation ENTER Heading ENTER EEE Date MENU Simulation ENTER Date ENT
80. USER POINT Place on the chart identified by its coordinates and displayed on the screen with a reference symbol see Mark Waypoint gt VIDEO pages Ony For O CHART7 O CHART7F It is possible to see images on the chart plotter display captured from an external video signal source if connected to the chart plotter Two types of Video pages are available full screen MENU Page ENTER Video ENTER chart video MENU Page ENTER Chart Video ENTER E WAAS Wide Area Augumentation System The Federal Aviation Administration FAA in cooperation with other DOT organizations and DOD is augmenting the GPS SPS with a satellite based augmentation system the WAAS It will provide a Signal in Space to WAAS users to support en route through precision approach naviga tion After achieving initial operational capability the WAAS will then be incrementally improved over the next years to expand the area of coverage increase the availability of precision ap proaches increase signal redundancy and reduce operational restrictions gt WAYPOINT Any point to which one intends to navigate A sequence of Waypoints makes up a route plan Add WPT ENTER WAYPOINT ENTER Move WPT place cursor on WPT Move move cursor ENTER Delete WPT place cursor on WPT Deeg ENTER Edit WPT place cursor on WPT Epit ENTER select field Symbol Name Color using cursor ENTER Insert WPT place cursor on
81. W 50 200KHz TECHNICAL SPECIFICATIONS 104 INSERTING REMOVING PROCEDURE EE 104 inserting MEDIA ate x eas ocenuscnaaecamanceauseudss consent tcaat et vat ENEE ISEENESES ELAT EEEE 104 Removing MEDIA ee eereieieeetndnexenceetantcyenetauasSeceesens Ser Ea ESRR ITRE PERENAISE RITENE D 104 DIMENSIONS EE 105 INSTALLATION EE 105 EXTERNAL WIRING gt misnsaeuccevoasascmnsdedcues died pire ele deg 106 O CHART7 O CHART F EE 107 TECHNICAL SPECIFICATIONS sls sususssasassasmanahasapasqahasashanawssqansasknah AE 107 OnLy For O CHART7F FF MODULE 600W 50 200KHz TECHNICAL SPECIFICATIONS 108 INSERTING REMOVING PROCEDURE secccseccchcacisuse Ee RENE Eege SE 108 inserting 4767 108 REMOVING MEDIA elesgteiieeug Ce See dE ENEE Ed ENEE eet Ee dE 108 STOT EK e KEE 109 ae SE une CHE 109 EXTERNAL 2 522382 2ssssssasasssasasadhussushashanhhipss aqashayakhasqhaspusanqayaatasaqtusssa 110 Wiring Diagrams gt yQ ssssuwsswuwuwwwawwwawananaanannanananananananaananananananananananananaa 113 Analytical I ndex _ sssssssswawawawawawananananaawnananaananaaaaananaananaanaaaaananananananana 119 User Manual D 9 Important Information WARNING Electronic charts displayed by the chart plotter are believed to be accurate and reliable but they are not intended to replace official charts which should remain your main reference for all the matters related to the execution of a safe navigation For this reason we would lik
82. ay point MOB and finds Information on Objects The CLEAR key Excluding specific situations returns to the previous menu or leaves a menu without making changes If you are not into a menu if the GPS computing a valid fix position and the chart plotter is not in Home mode pressing CLEAR sets Home mode When Home called also Navigate mode is set the cursor is not shown anymore and all cartographic functions zoom scroll etc are leaded by the fix position The fix is centered in the map display and the map scrolls underneath as the fix position changes To deactivate Home mode move the cursor The GOTO key Allows to select the main navigation functions to a Target The GOTO key is an auto diagnostic type because the associated menu disables automatically the menu items that are not allowed in that moment A menu item is disabled when the label is shown in User Manual 17 light grey color otherwise if the item label is shown in black color the item is enabled An item is automatically disabled when the associated function is not allowed The Goto menu that appears after the GOTO key pressing shows the follow ing 6 items LAST GOTO CURSOR MARK ROUTE PORT SERVICES CLEAR GOTO The LAST GOTO item when selected shows a window with the coordinates of the previous inserted Target The CURSOR item is disabled when in Navigation mode for the Navigation Home mode meaning see the CLEAR key in this para
83. but just the information relative to the navigation Such information will be removed from the Slave chart plotter as soon as the navigation is terminated C Link Navigation Data is exchanged by using two NMEA 0183 C MAP proprietary sentences PCMPN 1 and PCMPN 2 When the navigation is activated on the Master it starts outputting the C Link Navigation Data If the Slave is connected all C Link Navigation Data received are stored in its memory and the navigation is started The information sent by the Master consists of the following values e Navigation mode To Single Destination to a Route Route Name Destination ID Destination Position Next Waypoint ID Range from Destination to next Waypoint Bearing from Destination to next Waypoint Route Length Distance from Destination to Last Route Waypoint Remaining Route Legs Planned Cruising Speed Average Fuel Consumption Initial Fuel Load Values identified by are sent only for Route Following navigation The Destination Icon Navigation leg Fix Position to Destination the Next Waypoint Icon and all other relevant C Link Navigation Data will be shown on the Slave chart plotter Any variation of the C Link Navigation Data on the Master will be communicated to the Slave so to keep data aligned on both devices 5 3 3 1 Master Chart Plotter Operating mode To select the Master mode Primary Station follow the procedure gt MENU Input Output ENTER C Link ENTER
84. change of chart whilst a long ZOOM push press and hold causes a pop up window to be displayed on a corner of the screen The window shows the current Zoom Factor By pressing ZOOM IN ZOOM OUT the map is expanded or compressed according to the zoom factor selected The Window is automatically closed if ZOOM is not pressed for 2 seconds and the selected zoom factor will be used at the next zoom in out 3 8 2 FONTS amp SYMBOLS gt Press any soft key Map Fonts amp Symbols ENTER It is possible to set the size of all names and symbols drawn on the charts selecting between Normal size the regular characters size and Large size NORMAL size LARGE size Fig 3 8 2 Example of Normal size on the left side and Large side on the right side settings 34 D User Manual 3 8 3 PERSPECTIVE VIEW gt Press any soft key Map Perspective View ENTER Chart data may be projected in perspective mode during navigation This function allows setting the panoramic view of the chart As the upper side of the map is more compressed than the lower side a wider map area is visible The perspective view allows showing more chart information immediately ahead and around the cursor Fig 3 8 3 Perspective View Note 0 ONLY For O CHART7 O CHART ZE See also the Rotor usage on Par 2 1 1 3 8 4 DYNAMIC NAV AIDS gt Press any soft key Mar Dynamic Nav Aids ENTER This function allows settings b
85. d Fish Finder mode pressing any Soft Keys and then Focus changes the focus the active window from the Chart window to the Fish Finder window and vice versa Note When the focus is on the Chart all keys behave as in standard chart mode 6 4 ZOOM MODES 6 4 1 THE BOTTOM LOCK ZOOM The Bottom Lock Zoom mode is activated when the Fish Finder is in Auto Range or Bottom Lock mode see Par 6 5 3 and the Variable Depth Marker VDM is not displayed on the screen In Bottom Lock Zoom mode the Fish Finder Echogram is automatically moved up down as to keep the Bottom Line always visible in the lower half of the screen Note Moving the Cursor key up down displays the Variable Depth Marker VDM switching the Fish Finder in Marker Zoom mode User Manual 79 6 4 2 THE MARKER ZOOM The Marker Zoom mode is activated either when the Fish Finder is in Manual Range mode see Par 6 5 3 or the Depth Cursor is displayed on the screen In Marker Zoom mode the Fish Finder Echogram position is controlled by moving the Variable Depth Marker VDM and pressing and holding ENTER for 1 second on the selected position Moving the Variable Depth Marker VDM over the top or below the bottom of the screen automatically moves up down the current zoomed Echogram view and re position the Variable Depth Marker VDM at the center of the screen Note Pressing CLEAR hides the Depth Cursor and if the Fish Finder is in Auto Range or Bottom Lock mode switches
86. data in graphic mode It is possible to set the information in the page according to the user requirements ONLY For O CHARTS bt gt PAGE Rolling Road ENTER ONLY FoR O CHART7 ZE gt MENU Page ENTER Rolling Road ENTER Alphanumeric identifier Mk 006 lt of the target if set Fig 3 1 3 Example of Rolling Road page Zoom Scale User Manual 27 3 1 4 GPS STATUS PAGE The GPS data page shows in graphic mode GPS data ONLY FoR O CHARTS 5F gt PAGE GPS Status ENTER ONLY FoR O CHART7 ZE gt MENU Page ENTER GPS Status ENTER Date and UTC U or Local L time Fix coordinates Fix Status Tracked but not used Satellite Speed Over Ground rse Over Groun Course Over Ground Course Over Ground Altitude Used Satellite Horizontal Dilution Of Precson 7 Vertical Dilution Of Precision _ L 11 20 Bars to indicate S N Ratio 2o Fig 3 1 4 Example of GPS Status page On the top side of the screen there is a polar representation of the azimuth and elevation of each satellites The circle contains a number indicating the PRN of the satellite and it is filled when it is used for the fix solution On the bottom side there are histograms indicating the S N ratio SNR The bar is filled when the satellite is used for solution When a valid fix is received the Lat Lon Date Time HDOP VDOP SOG COG and Altitude are shown in
87. de normal or small and CLEAR to exit 8 1 6 VIDEO TEST Allows a full text on the functionality of the screen 8 1 7 ONLY For O CHART7 ZE EXTERNAL ALARM To check if the External Alarm has been transmetted 100 D User Manual appendix A Troubleshoot ng THE CHART PLOTTER DOES NO TURN ON Make sure that the correct voltage 10 18 volt dc is present Check also that the polarity is correct Refer to the Par 2 2 THE CHART PLOTTER DOES NOT GET A VALID FIX Make sure that no metal obstacle is placed around the chart plotter acting as a shield for the antenna If after 15 minutes the chart plotter does not get the fix turn it Off and On again THE SCREEN BECOMES DARK AFTER SOON EXPOSITION Adjust contrast see Par 2 4 THE CHART PLOTTER DOES NOT RESPOND TO ANY COMMAND Try to turn Off and then turn On If the problem persists erase the memory see Par 8 1 1 User Manual 101 O CHARTS5 O CHARTS5F TECHNICAL SPECIFICATIONS Power Consumption O CHART5 O CHART5F Power Supply Display Display Resolution Cartography MEDIA Operating temperature range Non volatile Silicon rubber backlight Memory Keyboard Weight O CHART5 O CHART5F Accessories User Manual 600 mA max 12V 12W Average 24W peak with FF on 10 35 Volt dc 7Watt max TFT LCD 5 vertical color sunlight QVGA 320 x 240 pixels C MAP By Jeppesen MAX
88. dem C COM 23 100 Modem Test 100 leien e ME 51 Mooring facilities 36 Moving Mark 56 92 Moving Waypoint 52 96 Multilanguage 32 geet 91 N Name SID eege cieetetvncusavartenss 63 Name Tags 39 40 92 E EE 36 Nav Aids amp Light Sectors 40 92 Nav Aids Presentation 21 95 Navigate uu sus EE 17 NAVIGATION 92 navigation data 27 Navigation Speed 90 Night Vision palette 2 VI 50 65 NMEA input port 50 56 NMEA output port 50 56 NMEA 0183 23 66 NOAA palette 21 Normal palette 21 Nor e A JD uu usu uu teenie ates 30 O O ZOO RE 36 Obstructions 36 40 42 45 51 89 93 121 Off line redraW 33 Official data source 32 Operating Frequency 75 Operating temperature range 103 107 ORIENTATION RESOLUTION 92 93 Other Map Configurations 39 Other Map Conf
89. dem C COM to the chart plotter Port 1 verify that the Port 1 setting is the following MENU Input Output ENTER Port 1 Input ENTER C COM ENTER Note The connection is valid for the C COM IR and C COM RS232 too Also the modem C COM can be connected to the other ports in this case set the format for the selected Port 2 7 4 OntyFrorO CHART7 7F EXTERNAL ALARM CONNECTION Once the connection is active to enable the External Alarm follow the procedure gt MENU Alarms ENTER External Alarm ENTER On ENTER Note The connection is available also on the AUX IN I O Port 2 8 USING C MAP By Jeppesen DATA MEDIA The chart plotter has a built in world map To use the chart plotter as a navigation aid DATA MEDIA with detailed information for the area you wish to navigate are required See the technical details of your chart plotter for inserting removing DATA MEDIA procedure User Manual 23 SEs During normal operations the MEDIA should not be removed since the chart plotter may lock up 2 9 SIMULATION MENU Used in order to use your chart plotter without input data It generates a display with a moving vessel so that you can practice using the controls in safety gt MENU Simulation ENTER 2 9 1 SIMULATION MODE Enables On or disables Off the Simulation mode The default setting is Off gt MENU Simulation ENTER Simulation Mode ENTER 2 9 2 SPEED
90. e 50 Sensitivity Menu 77 81 SensorsS ee 19 Sensors Calibration 19 95 SEHR E 12 23 100 Set Default settings 83 SETTINGS menu 94 Settings MENU 18 SETUP Meri EE 94 Shallow Water 51 83 SIMUL EE 81 Shoreline Constructions 36 51 Signal to Noise Ratio 95 SIM PIN EE 62 Simulation 74 Simulation Menu 94 95 Simulation Mode 21 24 95 Slave Chart Plotter 67 Sleeping Target 64 Eeer 19 SINOO EMH 2 OOM eebe 33 CN AEE 28 95 Soft Key Abee EES 14 18 95 software key 14 18 19 SO ei 28 95 D User Manual Sort By MEDIA eneen eegen 92 Sorting Directory 60 Special Functions 61 SD860 E 24 50 95 Speed Over Ground 95 Spot Soundings 32 Standard zoom 34 doesent aera u 77 82 STC Length eege l waa seers 82 STC Strength 82 AER EE 88 ig leg TEE 76 Sunlight pal
91. e Every time you place the cursor on a Waypoint the following functions are available 4 1 2 2 Moving Waypoint gt Adding Waypoint ENTER WAYPOINT ENTER or Place cursor on Waypoint Press Move Use the cursor key to move the cursor a dotted line connecting the Waypoint to the new position is shown SY i e Z LS SI Santee R re 3 On ie P omain i agen uis Se SC gd bal ee Sub fans r Fig 4 1 2 2 Moving Waypoint function 1 Press ENTER or Accept CLEAR or CANcEL otherwise and the Waypoint will be placed in the new position Sis o ie ulls Bay Ze IK Ze bal g A sans 32 45 935N 073 039 321w Fig 4 1 2 2a Moving Waypoint function I1 The old Waypoint remains on the screen shaded until the screen is redrawn 52 D User Manual 4 1 2 3 Deleting Waypoint gt Adding Waypoint ENTER WAYPOINT ENTER or Place cursor on Waypoint Press Deeg A window is opened press ENTER or Accept CLEAR or CanceL otherwise The Waypoint is deleted and a new line between previous and next Waypoint is shown The deleted Waypoint remains shaded until the screen is redrawn 4 1 2 4 Editing Waypoint gt Adding Waypoint ENTER WAYPOINT ENTER or Place cursor on Waypoint Press Epit A window will be shown with Symbol Name Color and Latitude Longitude of the Waypoint r N L L as JN _ 359 41 12 754N 009 30 195E
92. e pue 6gq sjebiel SIV JUSI O inJiuinoq 914289 19 64d O Dis OD O O CH O 3 5 Di CH gt oO oo CH Di OD ooz OO SIV 4Z 5S9 Z SLYVHO O guu uv AHA JHA uu luv LVLVG 4Z SS Z GLYVHO O UesICOIPeY SIV oafDpIOgHDUU IM 117 User Manual 0102 90 ON MOV 1g dION OGASE 0l qaq 3S nOq N3SY9 LYAA sV319 4V319 EKERWIEKERR au un sindep ull Jed O11 38L 0 1N09 OSL 000 SZ80 e ANITLOH MOV 18g dION t131N3 d72INZ JLIHWONY19 00F8 SIV 1 souO 00r8 SIV 1919S YALNA YSLNA HOd 3914744 yndu LHOd YSLNA YALNA SIHOS nud jndino nndul sobe bay s6unjas NNAW NNAW O Dis oO n CH CH CO F D Sr Di CH gt oO La CH Di a oO AL AS Z SLYVHO O WLVG AZ SS Z GSLYVHO O LUBZDOOIPENSIV b5e qeO BulAA Soit r FONVYO sjebel SIV yos uoneuweibold 6gd Od MOVIE MION a ACL qa33q 3S nOq L100SSIV SdS dHA User Manual 118 Analytical I ndex A A Scope r 75 About page 94 ACCESSONES NEEN 103 107 Activation Range 64 Active Target 63 Active Track 58 88 96 Adding Mark 56 92 Adding Waypoint 31 52 96 Advanced rr 96 AIRMAR EEN 85 e
93. e avail able ports can be used the software will recognize automatically the serial ports used A typical connection is as follows Chart Plotter 1 Chart Plotter 2 TX s axs I gt RX RX lt TX GND lt gt GND 5 3 2 C LINK NAVIGATION DATA TRANSFER The chart plotters can be set to operate in two modes e Master mode Primary chart plotter e Slave mode Secondary chart plotter When the navigation is activated on the Master chart plotter the C Link navigation data will be continuously sent to the Slave until the navigation is active If the Master is navigating to a Single Destination the Slave will show the Destination position and activate the navigation to it If the Master is navigating to a route the Slave will show the route leg User Manual 65 composed by the Destination and the Waypoint after the Destination Next Waypoint and activate the navigation to it Any variation to the current C Link Navigation Data will be transferred from the Master to the Slave The Slave will be provided with a dedicated page to show the C Link Navigation Data received from the Master selected from the Route menu gt MENU Route ENTER Report ENTER A data page different from the Route Data Report page appears on the screen that shows the C Link Navigation Data sent from the Master 5 3 3 OPERATIONS It is important remark once more that this function does not transfer the whole route
94. e can be set Inhibit Navigation operation As soon as Slave mode is set the Destination cannot be placed anymore either the C Link Navigation Data is received from the Master or not Also when the C Link Navigation Data is received from the Master it will not be allowed to deac tivate the Navigation Inhibit Route following While navigating to the route received from the Master and the Destination is reached the Destination will be moved to the next Waypoint on the route MOB handling If the Navigation to the external Destination is active and the MOB is set gt ENTER MOB ENTER on the Slave Chart Plotter the MOB is placed but the navigation to the MOB is not activated Note While navigating to the external Destination the operating mode is switched to Master the navigation to the external Destination will be terminated 5 3 3 3 C Link navigation data Acquisition and Display As soon as the C Link Navigation Data is received the Slave parses the information received and executes the relative actions depending on its current working status Ad When the Navigation to the external Destination is activated the Slave chart plotter will show all relevant C link Navigation Data exactly like when the destination is not the external one Destination Name DST and BRG to Destination calculate XTE calculate TTG etc These values will be displayed all places where required and they will be used to format NMEA 0183 outpu
95. e the landscape layout nearby a harbor the shape of a bridge or of a buoy etc On some objects such as bridges the image associated can represent the Diagram representing the shape of the objects and the various characteristics length height type of bridge etc Lef I i i n t 2 kg J E b lt we 7 td ig L MEA ou Lana e a 5 e ate hE 2 wes Qa Fig 3 7 Pictures and Diagrams User Manual 33 3 7 1 QUICK INFO ON OBJECTS WITH PICTURES On the Quick Info there will be the camera icon on the top bar of the window if at least one of the objects found has one or more pictures associated 3 7 2 EXPANDED INFO ON OBJECTS WITH PICTURES On the Full Info there will be the small camera icon on a corner of the square containing the object icon or a big photo icon centered on the square for the object without icon To see the picture press Picture when the object with a picture is high lighted 3 7 3 CHANGE PICTURE SIZE When the picture is shown it is possible to fit it to screen by pressing ENTER 3 8 MAP MENU To select the map configuration available only from the chart page gt Press any soft key MaP 3 8 1 ZOOM TYPE gt Press any soft key Mar Zoom Type ENTER Allows larger expansion or compression of the chart scale while zooming in or out Zoom Type has two options Standard default or Flexi Zoom When in Flexi Zoom mode a short ZOOM push causes a
96. e to remind you that you are required to carry on board and use the officially published and approved nautical charts LIMITED WARRANTY FURUNO France warrants every RADIO OCEAN units to be free from defects in material and workmanship under normal use and service for a period of 24 months from original retail purchase During the warranty period FURUNO France will repair or replace any component which fails in normal use without charges for parts or labour Are not concerned accessories and consumables Given technological developments modifications and upgrades of software are not covered by warranty except commercial decision After troubleshooting and repair of an antenna parts and changed the relevant labor are guaranteed for a period of three months To receive warranty service contact your local authorized dealer for shipping instructions The chart plotter should be securely packed with its tracking code clearly written on the outside of the package shipping to be paid by the customer Include a copy of the original sales receipt as the proof of purchase This limited warranty does not extent to any chart plotter which has been subjected to misuse neglect accident incorrect wiring or improper installation FURUNO France reserves the right to repair or replace the chart plotter at its sole discretion For more warranty information please see the web site www furuno fr GarantieMondiale web FURUNO France invites you to contact
97. e while a hard bottom returns a strong echo that causes a wide white bottom line 4 Surface Clutter Appears like noise at the top of the screen extending many feet below the surface It s caused by many things including air bubbles bait fish plankton and algae 5 Structures Generally the term structure is used to identify objects like wrecks and weeds rising from the bottom Bottom Echo Profile Bottom profile recorded by the Fish Finder When the echo sounder is set in auto range mode it is automatically kept in the lower half of the screen Other Elements Large anchoring cables are returned by the echo sounder as very long and narrow arcs on the screen 6 3 DISPLAYING THE FISH FINDER PAGE This section will take you through the frequently used operations and assist you to customize the look of the chart plotter using the Fish Finder 6 3 1 HOW TO SELECT THE FISH FINDER PAGE The Page Selection menu allows you to change the Fish Finder page displayed To access this menu ONLY rop O CHARTS5F gt PAGE ONLY rop O CHART7F gt MENU Page ENTER The Page selection menu with current page selected is shown on the screen see also Fig 3 1 Moving cursor selects the desired Fish Finder page and then press ENTER to select 76 D User Manual 6 3 1 1 Fish Finder Full page To display the Fish Finder Full page Echogram follow this procedure ONLY For O CHART5F gt PAGE Fish Finder ENTER
98. ect Otherwise press Exp A to select all available information 3 10 2 1 Quick Info on Lakes Upon viewing the chart of a lake you will click on to query the available information immediately displayed with many details Example see the following picture Lakes Info icon Fig 3 10 2 1 Example of Lakes info When the cursor is placed over the icon the icons of the available services are shown S CRYSTAL LAKE anam scam O CRYSTALLAKE pagua d aii Fig 3 10 2 1a Quick Info available services If you press Expanp all available information about the cartographic point under the cursor will be shown See the next paragraph User Manual 43 3 10 2 2 Full i nfo on Lakes The following is an example of Full Info on Lakes Objects OUTDOOR RECREATIONAL AREA FISHING SIZE AND DEPTH STATE Lei FISHING RECORDS HUNTING OUTDOOR RECREATIONAL AREA FISHING INFORMATION TROUT RAINBOW MULTIMEDIA INFORMATION MultiMedia Object Fig 3 10 2 2 Example of Full Info page To see the Fishing object press Picture when the Fishing object is high lighted On the screen appears Rainbow Trout Fig 3 10 2 2a Example of picture associated to the Fishing object 3 11 FIND FUNCTION The chart plotter allows to find and display on the screen the nearest and available objects Port Services Port By Name Port By Distance Tide Stations Wrecks Obstructions Lakes Information
99. element that converts the pulse into acoustic sound wave which is sent through the water As this wave travels from the transducer to the bottom it may strike fish structures thermal clines temperature changes in the water When the wave strikes an object s a certain amount of the wave is reflected back to the transducer depending on the composition and shape of the object When the reflected wave is returned to the transducer it is converted into an voltage and is amplified by the receiver processed and sent to the display The speed of sound in water is roughly 4800 ft sec so the time lapse between the transmitted signal and the received echo can be measured and the distance to the object determined Fig 6 Fish Finder working principle 6 1 SETTING THE INTERNAL FISH FINDER ON The Fish Finder driver is embedded on the chart plotter it is connected directly to the dedicated serial Port2 To switch the internal Fish Finder transmission On follow the procedure gt MENU I nput Output ENTER Fish Finder ENTER On ENTER Note It is not possible to connect any external Fish Finder unit to the chart plotter User Manual 73 6 2 UNDERSTANDING THE FISH FINDER PAGE The display on chart plotters shows a history of time of the echoes received by the transducer The chart plotters have a menu that allows adjustments to receiver sensitivity depth range and scrolling speed of the Fish Finder display DOO QWOO
100. eport MENU Route ENTER Route Check Report ENTER E RTCM Radio Technical Commission for Maritime Services Data format created by the Radio Technical Commission Maritime to transmit Differential GPS corrections gt SETTINGS menu Allows to select the following menu aus PAGE Menu OnLy ror O CHART7 7F MENU Page ENTER sas SETUP Menu MENU Setup ENTER see Input Output Menu MENU I nput Output ENTER oat C WEATHER Menu MENU C Weather ENTER aaa DEVICES Menu MENU Devices ENTER ss Memory Card Menu MENU Memory Card ENTER aaa List Menu MENU List ENTER san rack Menu MENU Track ENTER aua Route Menu MENU Route ENTER ess Alarms Menu MENU Alarms ENTER ess Simulation Menu MENU Simulation ENTER see LCD Adgiustment MENU LCD Adjustment ENTER u About page MENU About ENTER gt SETUP menu Allows to select the folowing menu 94 D User Manual aua Language MENU Setup ENTER Language ENTER ess Chart Language MENU Setup ENTER Chart Language ENTER ene Distance Speed Units Nm amp Kts Sm amp Mph Km amp Kph MENU Setup ENTER Distance Speed Units ENTER ene Depth Altitude Units Ft Feet Mt Meter MENU Setup ENTER Depth Altitude Units ENTER sss Temperature Units C F MEN
101. er ENTER Copy from Media ENTER Allows the C Weather data loading from the MEDIA 5 1 1 2 Download gt MENU C Weather ENTER Download ENTER Allows to connect the software to the Jeppesen Marine weather server and to download Jeppesen Marine weather data directly via C COM It activates the following sub menu User Manual 61 Select Country to Call Allows the selection of the country to call The whole telephone number set is automatically updated after every download Telephone number Shows the telephone number to get through to the server SIM PIN Allows inserting of the PIN relating of the SIM Download Area Allows the weather download a squared grey area where the weather data will be downloaded is centered on cursor position Cursor is locked to the gray area Moving the cursor also moves the gray area allowing locating it over the area where the user wants to download the Meteo forecast Area of coverage of downloaded data is located by default with its center on the cursor position Soft Keys to manage the download procedure Indicates the LAT LON position of the cursor Fig 5 1 1 2 Area of coverage Press Loap to activate the C Weather Download the whole data package see the previous Weather data package table are downloaded At the end of the operation press Exit to close the window 5 1 1 3 Weather Forecast gt MENU C Weather ENTER Forecast EN
102. ergert 69 e ER GC oC GENEE 70 E DD E o WE 70 Locate arstina ener eer er reer er tet eer TC rere ete en E anasu a sa 70 EISEN gereegelt 70 al EE 71 PCS SOW ao su u mu msn mu i aa yma an E a asya 71 Distress Call Position Request 71 5 24 2 2 Directory E 71 e IN 71 ele ONE 71 Delete ee ee 71 Delete Al Ate 71 5 4 3 Quick Info on DSC MOINS EE 71 5 5 FISH FINDER MENU gtt Gahan wa EEEE E EEE EEEE E 72 Fish Finder For O CHART5F O CHARTZT7F ssswsmwwawawanawananaananan 73 6 1 SETTING THE INTERNAL FISH FINDER ON n t ee Eege 73 6 2 UNDERSTANDING THE FISH FINDER PAGE rr ee ebe 74 6 2 1 Understanding the Echogram display 2 Sese te ski eied E Seet Seelebt See SN e geed ai 75 6 5 DISPLAYING THE FISH FINDER PAGE 3 22c cciccxccccncdenceccmasesatectentitadesceesetsasnesmeteesscanonnrs 76 6 3 1 How to select the Fish Finder page rrr 76 6 3 1 1 FishFinder Full page u u EEN 77 THe ee 77 The CLEAR KOY s ssssasuspahungayayanapananaynanpunpaqascuashawgasquphisaiaqa 77 The ZOOM IN and ZOOM OUT kees r 77 6 3 1 2 Fish Finder Full Databoxes page 78 6 3 1 3 Dual Fish Finder page E 78 THe C rsor key uu ee 78 The ZOOM IN and ZOOM OUT keys
103. es for example are often used in filenames however they take up several characters leaving you with little flexibility The secret is to find a compromise a point where you can combine a date with a word creating a unique filename The maximum length of the filename is 8 characters The characters may be numbers 0 9 letters A Z and spaces for example legal identifiers are ABC AA 12121212 A B C 1 A 1 and so on 4 4 2 LOADI NG FILE gt MENU Memory Card ENTER LoAp In the list choose the file name using the cursor key and press Loan 4 4 3 DELETING FILE gt MENU Memory Card ENTER DELETE A warning window is shown press ENTER or Accept CLEAR or CANCEL otherwise This operation remove old or unnecessary files to clean up your MEDIA Remember that this option permanently erases the file 4 4 MEDIA MENU Memory Card ENTER Mepia 4 4 1 Reading Directory on MEDIA MENU Memory Card ENTER MEpiA Reap Appears the list of the files present on the MEDIA inserted During the reading if it is going well the message READING DIR OK appears in the frame in the right bottom corner 4 gt 4 gt 4 4 4 2 Formatting MEDI A gt MENU Memory Card ENTER MEpIA Format A warning window is shown press ENTER or Accept CLEAR or CANCEL otherwise The formatting of the MEDIA must be done before using a new MEDIA
104. et the total Log or Parz to reset the partial Log 4 3 5 TRACK TO ROUTE CONVERSION This function creates a Route from a pre recorded Track To select this menu gt MENU Track ENTER Track To Route ENTER A new window appears on the screen with the following options 4 3 5 1 Track to Route Executes the function that converts the given Track into a Route gt MENU Track ENTER Track To Route ENTER Track To Route ENTER 4 3 5 2 Select Track Number Selects the Track input number gt MENU Track ENTER Track To Route ENTER Select Track No ENTER 4 3 5 3 Select Route Number Selects the Route output number gt MENU Track ENTER Track To Route ENTER Select Route No ENTER 4 4 MEMORY CARD MENU The chart plotter allows to copy information to a MEDIA You can also return the information to internal memory at a later time This allows virtually unlimited storage gt MENU Memory Card ENTER 4 4 1 SAVING FILE gt MENU Memory Card ENTER Save Select the data type to save pressing respectively Mark Event RouTE or Track A window is opened with a default name shown use the cursor key to insert the desired name and press ENTER or Accept CLEAR or CANcEL otherwise User Manual 59 MOTO When naming a file you may have trouble finding a name that uniquely identifies the file s contents Dat
105. ette 21 Surfac Clutter sees Set Ee 76 Surface Noise Filter 77 82 System Information page 15 System Test 15 99 T Target 17 30 31 54 57 63 90 95 Ee 63 TCPA Alarm 63 64 87 TCPA Limit u aaa asasayasanawqasnanhuis 63 TECHNICAL SPECIFICATIONS 103 107 Telephon number 62 Temperature 62 63 Temperature Unit 20 95 Terms 87 Thermoclines 76 Tidal arrows 36 Tidal Stream ss z usss stusssiisssasssasamhuq askush 40 Rol 37 40 95 te GraD iisz x o suu terre reer etree tre 38 Tid NfO EEN 37 95 Tide Stations 45 89 Tides amp Currents 39 40 92 Tides Preview 32 iii ayer vert Terre eter rr er Te rer err 24 95 Time ee WEE 58 Time Format 21 95 Time Reference 21 95 TIME TEE 88 Time To Go 31 32 96 title page 20 Track 36 58 59 Track Color ebe qaspa aspa 58 Trac
106. fo window containing Mark symbol name and Latitude Longitude is shown Every time you place the cursor on a Mark the following functions are available 4 2 2 MOVING MARK gt Adding Mark ENTER MARK ENTER or Place cursor on Mark Press Move Use the cursor key to move the cursor a dotted line connect ing the Mark to the new position is shown Press ENTER or Accert CLEAR or CanceL otherwise and the Mark will be placed in the new position The old Mark remains on the screen shaded until the screen is redrawn 56 D User Manual 4 2 3 DELETING MARK gt Adding Mark ENTER MARK ENTER or Place cursor on Mark Press Deeg A window is opened press ENTER or Accept CLEAR or CANCEL otherwise The deleted Mark remains shaded until the screen is redrawn 4 2 4 EDIT MARK gt Adding Mark ENTER MARK ENTER or Place cursor on Mark Press Epit A window will be shown with Symbol Name Color and Latitude Longitude of the Mark Use the cursor key to select the field If Symbol field is selected press ENTER a window with 16 different sym bols appears Use the cursor key to select the symbol and press ENTER If Name field is selected press ENTER use the cursor key to insert the character 8 characters max then press ENTER If Color field is selected press ENTER a window with 8 different colors appears Use the cursor key to select the color and press ENTER If Coo
107. for improved chart reading Bathymetric amp Spot Soundings additional Data Base with depth and bathy information for an extraordinary view of the seabed depth Detailed Port Plan complete port and marina charts with detail Search amp Find quickly locates chart contents and objects Tides Preview dynamic simulation of tides Dynamic Currents current arrows dynamically display direction and speed e Dynamic Nav Aids displays Nav Aids in true color and with real in terval lighting e Port Info all the information of the available services in the ports and how to contact them Enhanced Port Info amp Roads details of the available facilities and services in ports and surrounding areas e Object Info indicates restricted area details and related information e Quick Info full information on objects buoys wrecks shoals and Nav Aids e Photos amp Diagrams high definition pictures of ports piers bridge diagrams and nav aids e Multilanguage Support displays charts in the local character set e True Type Font improves text on chart for optimal reading 3 5 2 PRESENTATION FEATURES e Clear View advanced legibility techniques providing more chart data on the screen e Clear Info sophisticated Human Dictionary to translate Nav Aid ab breviations found on paper charts e Dynamic Nav Aids an innovative and dynamic presentation mode 32 D User Manual e Flexi Zoom increased Under and Over Zoom between chart
108. g EE EEN 60 4443 SOMO OMB e EE 60 5 Special F ctiOnS 9 srsssswamawnuwswaxamanuwasanawawwamnanaawwsananaawamawa assaswawanasawwawaanawwa 61 5L GeWEATHER EE 61 5 1 1 C Weather TEE 61 5 1 1 1 COBY from Medid EE 61 5 1 1 2 DOWNOAO EE 61 Select Country to Call tege Eege EE 62 Telephone umber ienke nnii a 62 SIM PIN geed 62 Download RE EE 62 5 1 1 3 Weather EE 62 5 1 1 4 Real Time TEE 62 5 1 1 5 KREE 63 5 2 KE AC E ONE 63 5 2 1 AlS System Definitions EE 63 52 2 AlS Menu SEENEN 64 52 2 E e EE 64 on ae ae E i ee ee eee ee en eee oe ere en eee ee eee ee ee eee 64 5 2 2 3 TCPA Alarm EE 64 User Manual 5 2 3 To Set the Plotter for Receiving AlS r 65 5 2 4 Quick Info on AIS Target eebe ee eebe ett 65 573 rE EE 65 5 3 1 C Link EECH Ra ele de EE 65 5 3 2 C Link Navigation Data transfer a 65 53 3 ee Lg ee GE 66 5 3 3 1 Master net lee E 66 Operating MOdE cet oats tae ees EE 66 e e Slave Eet ee EE 67 Operating mode EE 67 Stop current navigation ee ee eebe iere DEER 67 Inhibit Navigation operation EE 67 Inhibit Route following DEER 67 MOB Nanding EE 67 5 3 3 3 C Link navigation data Acquisition and Display 67 5 3 3 2 Route RER a e EE 68 5 3 3 5 Quick Info eege 69 SA DSG i Cds ee 69 5 4 1 Distress Call and Position Request gei
109. graph this item is enabled only if the cursor is moved to the desired position for inserting Target The MARK item is disabled if no Mark has been stored The ROUTE item is disabled if no Waypoint has been stored The PORT SERVICES item is disabled if no MEDIA with charting data has been inserted The CLEAR GOTO is enabled only if a Target has been inserted and all other items are disabled because the Target is present yet Another characteristic of the GOTO key is the following to confirm selection it is possible to press ENTER or GOTO So you can set many navigation functions without moving finger from the GOTO key For example to set navigation to cursor pressing GOTO twice or to delete navigation pressing this key for 3 times The MENU key Press MENU to open the Settings menu The software keys soft keys The software keys soft key have different functions according to the modes of operation their labels for the current functions located on the front panel are shown on the screen right above the soft key When the soft key labels are shown by pressing the associated soft key the relative function is executed By pressing CLEAR the four soft key labels disappear When the soft key labels are not shown and any menu is not open by pressing one of the four soft keys their labels for the current functions are shown on the screen immediately above the soft keys Map selects t
110. gt MENU Route ENTER Receive ENTER It saves Route information received from the NMEA input port The received route is saved on the Active route overwriting it The NMEA WPL amp RTE messages are sent to the input port 50 D User Manual 4 1 1 7 Safe Route Checking This function checks the presence of particular cartographic objects see the list below on a range set by the user for all Route legs e Land Areas e Shallow Water e Intertidal Areas e Rocks e Wrecks e Obstructions e Shoreline Constructions e Fishing Facility e Dredged Areas e Diffusers e Mooring Warping Facility e Production Installation e Pingos e No Data Available If any of these alarm conditions is detected then the chart plotter highlights the list of dangerous objects and the correspondent dangerous Route leg The Route leg is then drawn in a different color It is possible to make the Safe Route Check from menu following the rocedure MENU Route ENTER Route Check Report ENTER or gt Place the cursor on the desired Route leg CHEck The list of the dangerous objects found on the charts crossed by the Route is shown in the Route check report It is also possible to activate this function in automatic mode gt MENU Route ENTER Automatic Route Check ENTER On ENTER If Automatic Route Check is activated the modified Route legs are checked everytime a Waypoint is added inserted edited or moved
111. guage is used instead WARNING gt If you have accidentally selected an incomprehensible language and you don t be able to reselect your language the above procedure is not of help to you follow this procedure press MENU then move the cursor to highlight For O CHART5 5F the first item and For O CHART7 7F the second item starting from the top which corresponds to the Setup menu and press ENTERT Then a window appears with Language message press ENTER now select your language and press ENTER again Anyway if you in trouble see Chapter 8 System Test for a RAM Clear operation the chart plotter will also return all selections in particular language to original default values 2 6 SELECTING THE CHART LANGUAGE To select the language you want gt MENU Setup ENTER Chart Language ENTER The possible choices are listed below e LANGUAGE Allows setting the language to display chart information The language is chosen among the list of languages available on the cartographic data DATA MEDIA or embedded charts e MODE Defines how objects are translated It is possible to choose between the three following options Off Uses the same Language used for LANGUAGE If the selected language is not present on the objects information English is used instead English Always uses English Local Uses the first Local language present on data If no Local language is available English is used instead Note
112. hart plotter does not operate properly please refer to System Test see Chapter 8 Most common operating difficulties can be diagnosed using these tests If you still need assistance call your local dealer reporting the information available in the System Information page selected following the procedure MENU About ENTER User Manual 15 2 Before You Begin This chapter provides basic information to get you start using the chart plotter it will help you to become familiar with the chart display and the functions of the controls before you start using the chart plotter 2 1 THE KEYBOARD The cursor key Moves the cursor about on the display screen quickly and accurately It also scrolls the desired option in the menu page s up down move the current menu selection right executes the function assigned to the active selection in the menu Same as ENTER Up down in the number character input procedure changes the value left right move the cursor on the previous next position If in Home Navigate mode it allows to exit from Home mode The ZOOM IN and ZOOM OUT keys Press ZOOM IN shows more details of a smaller area by changing the chart scale and zooming in on your display Press ZOOM OUT to operate similarly to the ZOOM IN except in reverse by changing the scale and showing a wider otherwise less detailed view The ENTER key Selects the desired option confirms selection creates Objects Mark W
113. he Map Menu DATA selects wrap around the User Points List the Route Data Report and the Databox Setup pages Focus is active only if the Fish Finder mode has been selected Allows to select the active page among the Chart page and the Fish Finder page The POWER key Press and hold POWER down for 1 second to turn the chart plotter On Press and hold POWER down once the chart plotter has been turned On for 3 seconds turns the chart plotter Off Press POWER adjusts brightness and contrast and handles the Palette 2 1 1 ON ty For O CHARTS 5F THE PAGE KEY The PAGE key Press PAGE to select the configuration After pressing PAGE the Page selec tion menu with current page selected is shown on the screen 18 D User Manual 2 1 2 ONLY For O CHART7 ZE ZOOM SLIDER AND MAP ROTOR On the front panel of the chart plotter there are two special controls or sensors Zoom Slider and Map Rotor Both sensors became active by keeping the finger on the sensible area for more than 2 seconds When the sensors are active you will see a little icon on the lower right bottom of the display see the following picture If you don t touche any sensor for 5 seconds this icon disappears from the screen Slider Gk Rotor Fig 2 1 2 Zoom Slider and Map Rotor The Zoom Slider The Zoom Slider is always used to change the chart scale Zoom In and Zoom Out sliding up the chart plotter recognizes a Zoom
114. he cursor key up down to slide in the list otherwise press Name and use the cursor key to manu ally insert the name of lake Press ENTER or FiNp to locate it on the map Note To filter the list select the distance range by following the procedure Press any soft key Map Find ENTER Lakes by Name ENTER Range ENTER Insert the desired value 3 11 9 FINDING POINTS OF INTEREST To select the research of Points of Interest POI following the procedure gt Press any soft key Map Find ENTER Points of Interest ENTER 46 D User Manual A sub menu is shown to find different categories of POIs Use the cursor key to select the category and press ENTER to display the list of points Press ENTER again to locate the point on the map 3 11 10 FINDING CURSOR To select the research of Cursor position following the procedure gt Press any soft key Map Find ENTER Cursor ENTER Shows the cursor placing it on the center of the screen 3 11 11 FINDING COORDINATES To select the research of Coordinates following the procedure gt Press any soft key Map Find ENTER Coordinates ENTER Use the cursor key to manually insert the coordinates and press ENTER o CoNrIRM to locate them on the map 3 11 12 FINDING USER POINTS To select the research of User Points following the procedure gt Press any soft key Map Find ENTER User Points ENTER Use
115. he cursor key to select the desired test this will display in reverse video and with the relative menu window To choice the test press ENTER To exit from any submenu press CLEAR To exit from the System Test turn Off the chart plotter 8 1 1 RAM Menu This test verifies the integrity of the memories and if desired during this test all the internal memory can be erased and the default setting restored E RAM Clear To clear internal memory If the chart plotter exhibits unusual behavior or appears to be malfunctioning it may be possible to correct the problem by clearing RAM This operation will erase all Marks Events Routes stored track plots and destina tions It will also return all selections Input Data Format Autopilot selection etc to original default values 8 1 2 DIM Menu To select the desired value for keypad light E Contrast The first option allows to adjust the contrast Each time you pressed the cursor key to right the screen will decrease brightness instead of to left it will increase brightness User Manual 99 E Backlight The second option allows to set the keyboard backlight 8 1 3 CARTRIDGES To check the MEDIA E Internal Data Base Test The first option allows to check the background cartography m MEDIA Test To test the MEDIA There are the possible situations 1 if there is a MEDIA inserted in the slot and there is not a malfunction the name of the MEDIA zone and the message OK are shown
116. her models 1 1 FEATURES The chart plotter is a computer specifically designed for nautical use but more precisely to ease and speed up all calculations which so far have been done manually If connected to a positioning instrument the chart plotter displays the current position the speed and the heading of the boat and its Track The user information like Waypoints Marks and Tracks can then be stored on a MEDIA and can be recalled at any time On the screen are shown navigation data and cartographic information obtained from electronic charts of C MAP By Jeppesen DATA MEDIA e C MAP By Jeppesen MAX electronic charts object oriented chart system with enhanced functionality including Guardian alarm Safety Status Bar Safe Route Checking Perspective View Satellite Image coverage Turbo and Smooth Zoom User Manual 13 Multilanguage Enhanced Port Information database Tides amp Currents data Photos amp Diagrams Automatic Information on all chart objects and User Points Find function for Ports Services Ports By Name Ports By Distance Tide Stations Wrecks Obstructions Lakes Information Lakes By Name Points Of Interest Cursor Coordinates and User Points e Positional information from GPS e Depth Graph pages e Navigation Data page e Rolling Road page e GPS Status page e AIS Report List page e DSC Log and DSC Directory pages e O CHART7 7F Video Input pages e Fish Finder pages e O CHART5 5F 500 Waypoints Mar
117. igurations Menu 91 92 VSI 200M EE 36 P Deeg 18 76 Page Selection menu 18 76 Palette wass atasa paipa se 18 21 36 93 panoramic View 35 PG Enn E 61 Perspective View 19 33 35 91 PICU e ee eege 33 PIN WEE 62 MIO EE 36 51 Place Names 39 40 92 POI gebeten 39 41 93 Points Of Interest 46 90 93 Port By Distance 45 89 Port By Name 45 89 POrt NIO EE 32 38 93 Gate e e WEE 38 Port Input EE 91 Port n Output 91 Port n Output Sentences 91 PORE PISI EE 32 Port Services 18 44 89 90 Ports amp Services 39 41 93 Position Request 69 Eed eebe 18 Power CONSUMPTION 103 107 Power Supply 103 107 powering On chart plotter 20 Presentation Features 32 Preset Mode 80 press a key r 15 Primary Chart Plotter 65 PRN WAAS SATELLITE 90 Production Installations 36 51 Q Quick INFO 32 34 43 65 69 71 R Radio Call Sign
118. into Bottom Lock Zoom mode 6 5 FISH FINDER SETUP MENU The Fish Finder Setup menu provides access to additional functions setup and layout data field options From the Fish Finder page access this menu by pressing gt MENU Devices ENTER Fish Finder Setup ENTER Preset Mode Gain Mode Manual R ange Mode Manual Depth Shift Bottom H ange Frequency Interf Reject Sensitivity Menu Display Setup Transducer Setup Alarms Save amp Load Fig 6 5 Fish Finder Setup menu 6 5 1 PRESET MODE Preset modes are pre defined settings of the Fish Finder operating parameters You can use them to quickly set the Fish Finder in the most commonly used operating modes These are Cruise sets the Fish Finder in full auto mode with the sensitivity settings optimized for displaying at best the bottom and Fish sets the Fish Finder in full auto mode with the sensitivity setting optimized for target searching See the following table MENU Devices ENTER Fish Finder Setup ENTER Preset Mode ENTER Fish Gain Mode Auto Range Mode Auto Frequency do not change Shift 0 STC Short if Freq 200kHz and Mid if Freq 50kHz Scrolling Speed 10 Fish Symbols Echo A Scope On Surface Noise Filter Off Cruise Gain Mode Auto Range Mode Auto Frequency do not change Shift 0 STC Short if Freq 200kHz and Mid if Freq 50kHz Scrolling Speed 10 Fish Symbols Echo A Scope On
119. ions ENTER Rocks ENTER sss Obstructions Off Icon Icon Depth Press any soft key Map Other Map Configurations ENTER Obstructions ENTER sss Diffusers Off Icon Icon Depth Press any soft key Map Other Map Configurations ENTER Diffusers ENTER see Wrecks Off Icon Icon Depth Press any soft key Map Other Map Configurations ENTER Wrecks ENTER ENTER E ORIENTATION RESOLUTION Resolution angle for the Map Orientation range 5 30 degrees The default setting is 30 gt PALETTE It is possible to select Normal NOAA Night Vision or Sunlight for Palette Normal is recom mended when the chart plotter is not exposed to the direct sunlight When this mode is set the maps are displayed in order to use colors as similar as possible to the ones used in the original paper charts NOAA allows setting NOAA paper chart colors presentation Sunlight is designed to enhance the visibility of the screen when the chart plotter is exposed to the sunlight The maps are much brighter than in the other modes and the depth areas are filled with white color so different depth areas are not easily distinguishable Night Vision is recommended when the environment is dark in order to reduce the glare of the display The chart plotter displays maps and screen in darker colors BONNERT MENU Or MENU LCD Adjustment ENTER MENU E PORT INFO Combination of a Po
120. iring YvV310 eva 19 YSaLNA 00r88SIV YILNI ZHOd nu3 N L8N 008r 8LO VAWIN dsaLNa LHOd HOS N L8N 008F 8LO VAWIN da LNa LHOd 1lud YI1N3 nuos nua NNIN GSLUYVHO O 008rO H OLOZ ZO avq 1O 1V319 YaLNa OOV8ESIV 199l8S SIN yndu zue N L8N 008r 81L0 VSWN YJ3LN3 Nd nO Hod N L8N 008r 8L0 VAWN SIN ndu Lod daLNa yndynoAnduy NNAW GLYVHO O exy un sindep ultu O11 3810 W00 OGL 000 S780 ei ANITILOH MOV1E YION 31LIHAVONV 18 AJYO SIYD REIWEN El SE CTAIHOS ASSaal N3JH9 LYJA AZ MOTISA ANNVE Ach Au OSA U DOOD uolisoq B euusjuy JHA 008rOq 4HA uu luv Be qeO BulIAA 113 User Manual 0L0 0 EKERWIEKENSI OOrge SIV Y31N3 LHOd nu3 Xa3LNa nuos nua NNIN vJ 10 AYJ10 YV3A10 eV3AT19 OOP8E SIV Y31N3 yndu Hod YSLNa y yndino nndu NNAW YV3A190 eVAT19 N L8N 008r 8L0 V3INN N L8N 0087 8L0 V3INN z31N3 kod alos VIN ndinO LHod N L8N 008r 8L0 V3INN N L9N 008r 8L0 V3INN Y31N3 LHOd nu3 YALNa nuos nua NNIN ASLYVHO O 4 GLYVHO O 0087ON ebelqeo Bulin Y31N3 yndu Hod Y31N3 yndjnoA ndu NNAW NMOY YJ NOYYYIN YNId ISOH ASDNVYO AONVYO Add9 SIeS WEIEN 31IHAVONV 18 N3JH49 LYJA MOTIAA ANNVE A S 0L dJY 39NOY ON MOV 19 HION NMOYHE NOYYYN MNId ASOY AONVYO SAONVEO Add WEIEN 1LIHAVONV 18 N3SY9 LYSA MOTIAA ANAVE
121. is is the time remaining before the CPA is reached TCPA Alarm Occurs if TCPA is less or equal to TCPA Limit This test is done for active targets only and if CPA value is less or equal to CPA Limit Radio Call Sign International call sign assigned to vessel often used on voice radio Name Name of ship 20 characters MMSI Maritime Mobile Service Identity MMSI number A unique 9 digit number that is assigned to a DSC radio station It primarily registers the boat information in the U S Coast Guard s national distress database for use in emer gency situations Active Target Target located within the Activation Range Active target is User Manual 63 represented by oriented triangle with COG and Heading vec tors Rate of turn may also be displayed Dangerous Target Target detected by CPA or TCPA Alarm Dangerous target is Active Target by definition For better visibility Dangerous Tar get symbol is flashing Sleeping Target Target located outside the Activation Range Sleeping target is represented by a small oriented triangle Lost Target When the AIS info is not received from that vessel for 3 5 minutes The presentation will be a flashing black triangle with a cross through Activation Range Range around your boat where targets become active AIS target become active within this range Activation Range should be greater than CPA Limit by definition Note A target is removed from the screen if data is not
122. ishes Fishes are represented as arcs because of the cone angle of the transducer In fact as the boat passes over the fish the leading edge of the cone strikes the fish causing a display pixel to be turned on As the boat passes over the fish the distance to the fish decreases turning each pixel on at a shallower depth on the display When the boat is directly over the fish the first half of the arch is formed and since the fish is closer to the boat the signal is stron ger and the arch is thicker As the boat moves away from the fish the dis tance increases and the pixels appear at progressively deeper depths forming the remaining half of the arch User Manual 75 2 Thermoclines Are the zones where two layers of different water temperatures meet The greater the temperature differential the thicker the thermocline is shown on the screen Thermoclines are represented as horizontal stripes of noise They are very important for fishing since often many species of game fish like to Suspend in just above or just below the thermoclines 3 White Line The White Line shows the difference between hard soft bottoms and even distinguishes between fishes and structures located near the bottom In this way it is easier to tell the difference between a hard and soft bottom and even to distinguish fishes and structures located nearby the bottom For example a soft muddy or weedy bottom returns a weaker echo that is shown with a narrow white lin
123. k memorizing type 58 Track Menu EE 94 96 Seel EE 58 Track To Route 59 96 Track To Route Menu 96 Tracks amp Routes 39 41 Ela Ee WT EE 84 Transducer Setup menu 83 Troubleshooting 101 True Type Font 32 ee 31 32 96 TURBO ZOOM NEE 33 turn chart plotter On 18 T rmingrOffr zu u tere rre etree errr Terry tre rt tT 20 Turning KA EE 20 Type of Data 63 88 TYPICAL CONNECTIONS 111 p User Manual U U ZOOM a a ssassatuss chikanta nE E papanpis 36 under zoom WEE 36 Underwater Objects Limit 40 42 93 Universal Time Coordinated 96 User Interface Language 22 User Point 55 57 96 User POINTS eet 47 90 User Points List 55 57 R KEE 96 V VAD NEE 41 Value Added Data 40 41 93 Variable Depth Marker 75 d EE 75 VDOP eege Sege 28 VIDEO pages 96 Video INPUT u uuu uu uuu sasa 107 Video Input Menu 96 VIDEO Pages 29 Vido TeSt sagin vitesin ri 100 View Waypoint ON map
124. ks and 25 Routes 1000 Track Points and 3 Tracks e O CHART7 7F 10000 Waypoints Marks and 50 Routes 10000 Track Points and 5 Tracks e Create Move Insert Edit Delete Send Receive Waypoint e Create Move Edit Delete Send Receive Mark Event e Navigation to Goto e Create Save Name Edit Delete Send Receive or Follow a Route e Route Data Report and User Points Marks Waypoints List pages e Display vessel s position direction and Track e Alarms Handling Auto Off Arrival Alarm XTE Alarm Anchor Alarm Depth Alarm HDOP Alarm Heading Alarm Grounding Alarm Ony For O CHART7 7F External Alarm e Man OverBoard MOB to navigate back to a missing person or object e C Link and C Weather Service e R B function e Simulation Mode with cursor control e O CHART5F 7F Internal Fish Finder 1 2 BASICS The chart plotter is controlled by a keyboard there are labelled keys and software keys soft keys The labelled keys are dedicated to specific functions the soft keys have different functions according to the modes of operation their labels for the current 14 D User Manual functions located on the front panel are shown on the screen right above the keys There is also a cursor key to move a cursor across the screen As you press a key a single audio beep confirms the key action every time the key pressed is not valid three rapid beeps sound indicates that no response is available 1 3 IF YOU NEED ASSISTANCE If your c
125. l Housing Mount Plastic Plastic Plastic Plastic Bronze Bronze Transom Transom In hull Thru hull Thru hull Thru hull Funct Power D S T 600W D S T 600W D 600W D 600W D S T 600W D T 600W 85 7 Terms amp Functions This section explains the terms that may be unfamiliar to the reader The symbol m indicates that the term is followed only by an explanation while the symbol indicates that the term is more widely explained you will also find a briefly description on how to select the related menu option listing the operation a keys sequence with the menu names enclosed between double apices For example ENTER Waypoint ENTER means that you must press the ENTER key using the cursor key to select the Waypoint item and press the ENTER key to place it gt AIS menu Automatic Identification System It has been introduced to improve the safety of navigation by assisting in the efficient operation of ship to ship ship reporting and VTS applications ene Display MENU Devices ENTER AIS ENTER Display ENTER ene CPA Alarm MENU Devices ENTER AIS ENTER CPA Alarm ENTER ost TCPA Alarm MENU Devices ENTER AIS ENTER TCPA Alarm ENTER gt ALARMS menu Sets the desired values settings for the alarms ss Auto Off On Off MENU Alarms ENTER Auto Off ENTER sat Arrival Alarm value Off MENU
126. lable before the navigation was started Liters Volume of remaining fuel DST Distance from ship to Destination calculated TTG Estimated Time to travel the Distance to Destination calculated using Cruising Speed ETA Estimate Time of Arrival to the Destination point calculated as Current Time TTG To Destination CONS Fuel consumption calculated DST Distance to travel from ship to the Wpt after the Desti nation calculated Distance to Dest Next Route Leg length TTG Estimated Time to travel the Distance to Next Waypoint calculated using Cruising Speed ETA Estimate Time of Arrival to the Waypoint after the Destination calculated as Current Time TTG To Next Waypoint CONS Fuel consumption calculated DST Distance to travel from ship to the end of the route TTG Estimated Time to travel the Distance to Last Waypoint calculated using Cruising Speed ETA Estimate Time of Arrival to the end of the route calculated as Current Time TTG To Last Wpt CONS Fuel consumption calculated D User Manual 5 3 3 5 Quick I nfo In the following picture an example of Quick Info on the Destination into an external route is shown EXTERNAL WAYPOINT 04 03 10 12 WPT001 4 5 DST TTG Cons Nm HH MM lit 4 2 0 25 2 5 gt 999 gt 99h gt 999 Route Length gt 999 Nm Fig 5 3 3 5 Quick Info on Destination Also in the following picture an example of Quick Info on
127. leg lNsER move cursor ENTER GoTo on WPT place cursor on WPT GoTo ENTER Find WPT press any soft key Map Find ENTER User Points ENTER Info on WPT MENU List ENTER Send WPT MENU List ENTER Send ENTER Receive WPT MENU List ENTER Receive ENTER E WGS 84 World Geodetic System 1984 Coordinate System or Datum developed by the Defense Mapping Agency DMA E ZOOMIN Shows more detail in a smaller area 96 D User Manual E ZOOM OUT Operates similarly to zoom in but in the reverse showing a wider but less detailed view E XTE Cross Track error Distance from the ship s present position to the closest point on a line between the origin and destinations Waypoints of the navigation leg being travelled User Manual 97 8 System Test 8 1 SYSTEM TEST If you have connected your position finding device according to the instruc tions and chosen the proper menu selection for your device and are still having problems with your chart plotter the extended auto test should help determine the problem Make sure the chart plotter is turned Off While pressing and holding any other key turn the chart plotter On A new menu will appear on the display XXXX V Software name oor bess NTSL V xyyzz Ry and version Dim menu Media Modem Test Serial ports Video Test NT Software Library Version and Date Fig 8 1 System Test Use t
128. linking lights on Nav Aids The blinking period and color of each Nav aid is read from the Nav Aid attributes available on the data cartridge When the ship is inside the Nav Aid nominal range the light of the Nav Aid will start blinking 3 8 5 MIXING LEVELS gt Press any soft key MaP Mixing Levels ENTER When the map coverage at the current zoom level does not fill the entire screen the chart plotter draws the rest of the map expanding the cartographic information read from at most two zoom levels above the current zoom level For this reason the map is drawn three times firstly it draws the two levels before the current level and then the current level The area covered by the cartographic data read from the previous levels is identified by a grayed pattern When the cursor is moved on an area not covered by data of the current level the chart plotter zooms out to the first level covered by cartographic data The default setting is Off Note The Mixing Levels function affects the speed of the redraw of the screen If this function is not used it maybe disabled 3 8 6 SAFETY STATUS BAR DSI Data Safety I ndicator gt Press any soft key Map Safety Status Bar ENTER The possible choices are listed in the table below e ON the Safety Status Bar is shown e OFF the Safety Status Bar is not shown User Manual 35 e ICON the Safety Status Bar is not shown but a Warning alarm Icon will blink on the corner of
129. lues ENTER The resolution angle which may be selected in the range 5 60 degrees defines the maximum variation of the reference angle after which the map changes its orientation 3 3 NAVIGATING TO A SINGLE DESTINATION 3 3 1 DISTANCE AND BEARING TO TARGET Place the cursor on location to navigate to and press GOTO select CUR SOR and press GOTO again or ENTERT A straight line is shown on the screen connecting the Target with the ship s position When the Target is placed all navigation data are referred to this Target Charting or Navigation Icon Map scale ae LO _ 3585 40 08 458N 012 39 267E Fix recived Icon To MRK oo Gel 8484 Course Over Ground Speed Over Ground Distance To GO Target Bearing A EN Time to Go Fix to Destination I I Fix to Destination Fig 3 3 1 Navigation to a single destination 30 D User Manual 3 3 2 TIME TO GO When the Target is set the TTG value if selected is displayed in the Text Area see Fig 3 3 1 3 3 3 DELETING TARGET Place cursor on Target icon press Stop A window to confirm the navigation interruption appears on the screen Press ENTER or GOTO the symbol that identifies Target remains on the screen until it is redrawn 3 4 NAVIGATION ON A ROUTE It is possible to define several positions Waypoints in a sequence called route and to navigate follow the route towards the end point 3 4 1 ADDING WAYPOINT To create a Waypoint
130. n Allows to set the Nav Aids presentation as US Draw Nav Aids using NOAA symbology or INTERNATIONAL Draws Nav Aids using international symbology When selected it affects Lights Signals Buoys amp Beacons display The default setting is INT Keypad Beep Enables or disables the single audio beeps emitted any time the chart plotter keypad is pressed If the incorrect key is pressed or the function required cannot be executed the chart plotter emits three beeps The default setting is On Input Output Allows to setup the devices that needs a dedicated port as C Com BBFF 50 200 and AIS 38400 The default setting is None for all Simulation Mode Allows to setup the simulation data before use the Simulation function 2 4 LCD AD USTMENT To adjust the brightness and contrast of the LCD screen follow the procedure gt POWER or gt MENU LCD Adjustment ENTER On the screen two control bars appear that indicate the actual values for contrast and brightness The screen brightness can be controlled using the BricHt and BRIGHT soft keys adjusting the control bar the backlight reaches the desired level Press ENTER to confirm the new value the soft key and the graphic windows disappear from the screen To modify the contrast value follow the same procedure using the Contr and Contr soft key The new values for contrast and brightness are retained until they are reset 2 4 1 PALETTE
131. n icons menu appears on the screen it shows the available pages Move the cursor to select the page you want and the press ENTER In the following paragraphs are displayed examples of these pages Fig 3 1 Example of Page Selection menu Note that if the Fish Finder pages are not available the Chart Fish Finder full Fish Finder and Fish Data boxes pages are respectly replaced by Chart Depth full Depth and Depth Data boxes pages if valid NMEA0183 depth data is available If the Fish Finder is present then the Depth pages are not shown in this page User Manual 25 At the same time as these pages displayed it is possible to show on the screen the display of chart and or navigation information gt Press any soft key Data to select wrap around the User Points List the Route Data Report and the Databox Setup pages see the following figure DATABOX SETUP USER POINTS LIST ROUTE DATA REPORT r DST and BR G from Cursor 49 53 579N Route 01 Data Report 04 12 03 00 07 we we een Speed 10 0K ts Fuel Flow 10 0L Hr Lat Lon Scale 50 13 086N COG Icon 7 a O Lat Lon SoG MRK001 002 54 345W MRK002 MARK BU DO SEE 002 54515W Latitude ini pusak 49 53 579N 32 09 Nm i I 002 43 730W Baum Waypoint 992954 SEW va e e M BRG 49 53 579N Dest DST WPT004 49 53 579N 001 51 952W Route 01 Waypoint 992 43 730W eege x WPT005 49 53 579N Lat Lon XTE STR VMG HDOP VDOP Time Date Sat AW
132. ns are used for the route management 4 1 1 1 Selecting Route gt MENU A Route ENTER Select ENTER A window appears with the route number list and the related route name Select the route number The following functions are available Changing Notes MENU A Route ENTER Select ENTER Notes Another window Is opened insert the notes it is possible only if the route is already created Press ENTER or Conrirm CLEAR or Cance_ otherwise Route Color gt MENU Route ENTER Select ENTER Coton A window allows to choose the color by using the cursor key Press ENTER or Confirm CLEAR or CANcEL otherwise Displaying Route MENU A Route ENTER Select ENTER HipE SHow The function allows to hide show the segment that joins the Waypoints 4 1 1 2 Deleting Route gt MENU Route ENTER Delete ENTER A window is opened press ENTER or Conrirm CLEAR or Cancec other wise The route remains on the screen shaded until the screen is redrawn 4 1 1 3 Finding Info on Route Route Data Report gt MENU A Route ENTER Report ENTER User Manual 49 Route 01 Data Report 04 12 03 00 07 Speed 10 0K ts Fuel Flow 40 0L Hr Lat Lon Dst Brg 49 30 953N 002 54 315W 49 53 579N 32 03 Nm 002 13 730W 048 M 49 53 573N 17 30 Nm 001 51 352W 033 M Nm Fig 4 1 1 3 Route Data Report page The following f
133. nsibility that the finished product D clarons sous notre propre responsabilit que le produit fini Erklaren voll verantwortlich dass nachfolgendes Produkt Declaramos bajo nuestra sola responsabilidad que el producto mentionado a continuacion Chart Plotter for Marine Navigation with internal GPS receiver Model Radio Ocean O CHART 5 amp 7 Constituting the subject of this declaration conforms to the essential requirements and other relevant stipulations of the directives 2004 108 EEC EMC 1999 05 EEC R amp TTE Faisant l objet de la pr sente d claration satisfait aux exigences essentielles et toute autre stipulation pertinente des directives 2004 108 EEC EMC 1999 05 EEC R amp TTE auf das sich diese Erlarung bezieht den grundlegenden Anforderungen und anderen relevanten Vereinbarungen der Richtlinie 2004 108 EEC EMC 1999 05 EEC R amp TTE Cumple los requisitos esenciales y las otras estipulaciones relevantes de las directivas 2004 108 EEC EMC 1999 05 EEC R amp TTE The product conforms to the Conducted emissions CEI EN 60945 2002 10 ETSI EN 301 489 1 V1 5 1 ETSI EN 301 489 19 V1 2 1 following standards e ETSI EN 301 489 19 V1 2 1 Le produit est conforme aux Radiated emissions CEI EN 60945 2002 10 ETSI EN 301 489 1 V1 5 1 normes suivantes eege ETSLEN 301 489 19 V1 2 1 Radiated interferences CEI EN 60945 2002 10 i Das Produkt entspricht den Radiated RF immunity ET
134. o shows echoes Echo Icon shows the Fish icon and echoes Echo Icon Depth shows the Fish icon depth values and the fish echoes Echo Depth shows depth values 82 D User Manual Icon shows Fish icons Icon Depth shows Fish icons and their depth accordingly to currently selected depth unit The Fish icons displayed are among four different shapes depending on the size of the Target Small Med Big Huge 6 5 10 5 Water Temperature Allows you to choose the Water Temperature label displayed over the echogram between Primary and External 6 5 11 TRANSDUCER SETUP Selects the Transducer Setup menu that contains the settings that should not require frequent change MENU Devices ENTER Fish Finder Setup ENTER Transducer Setup ENTER 6 5 11 1 Keel Offset It is the transducer depth offset from the surface This makes it possible to measure depth from the surface instead of from the trasducer s location 6 5 11 2 Calibrate Sound Speed Allows calibrating the value of Sound Speed in the water depending on the water temperature and salinity 6 5 11 3 Calibrate Water Speed Allows calibrating the value of Water Speed sensor The calibration value in the range between 10 to 10 will be applied to the water speed from the transducer 6 5 11 4 Calibrate Water Temperature Allows the calibration on the Water Temperature sensor Using the readings from a precise temperature measuring device insert he
135. or Zoom Slider or Map Rotor The screen shows an indicator green line over the image of the relative sensor The position of the indicator corresponds to the touched location on the physical sensor You can save the selected level and exit by pressing ENTER otherwise pressing CLEAR you can exit without saving settings User Manual 19 2 2 TURNING THE CHART PLOTTER ON AND OFF Before powering On the chart plotter check for the correct voltage 10 35 volt dc and the correct connections with the positioning instrument 2 2 1 TURNING ON gt Press and hold POWER for 1 second The chart plotter emits one rapid beep sound and a title page is opened After a few seconds the Caution Notice pages is displayed reminding you that the chart plotter is only an aid to navigation and should be used with appropriate prudence The electronic charts are not intended to substitute for the official charts 2 2 2 TURNING OFF Press POWER and hold for 3 seconds a countdown timer appears on the screen if you release the key before the countdown timer reaches zero the chart plotter will remain On 2 3 FIRST SETUP PAGE This menu allows you to configure the chart plotter and the external devices the first time the chart plotter is powered On This information can be changed at any time either from the Setup menu see Chapter 7 or by resetting the chart plotter Select the correct setup option and press ENTER when complete press Ox to exit
136. page press Pace Dn Home restarts the Expanded Info function 3 9 2 GETTING TIDE INFO To obtain Tide Info JL 5 Nm F amp Sm Re 1032 002 30 17 349N 087 25 913W ON A 30 26 234N P 087 07_089W p ae Tide Info Icon Tim f Garcon Pt ze L II 063 ang E Fig 3 9 2 Tide Info icon Place the cursor on the Tide symbol an automatic Info window is opened Re doe 002 30 17 436N 087 25 913W Ki 4 Escambia Bay H SE ae A Garcon Pt sP T Pe H a WARRINGTON 2 MILES SOUTH OF PENSACOLA Fig 3 9 2a Automatic Info on Tide User Manual 37 To display the Tide Graph page press Expanp then ENTER otherwise press Exp Ai to select all available information WARRINGTON 2 MILES SOUTH OF PENSACOLA VERTICAL cursor Values referred to the VERTICAL cursor x ai iene 0 28 Mt 30 20 698N 0 18 Mt 087 46 324wWw Values referred to the HORIZONTAL cursor High Water max 0 34 Mt 15 00 L Low Water min 0 02 Mt 24 00 L Sunrise 06 37 L Sunset 17 28 L ZOOM IN OUT to change day HORIZONTAL cursor Fig 3 9 2b Tide Graph Using the cursor key it is possible to move the cursor anywhere on the graph and display the time height vertical cursor and drought horizontal cursor on a particular graph point Also use ZOOM IN or ZOOM OUT to go to previous or next day and ENTER to set date move the cursor key up down to insert the desired number
137. partment of Defence It gives the navigator a position 24 hours a day 365 days a year under any weather conditions gt GPS Status page Shows in graphic mode GPS data ONLY For O CHARTS 5F PAGE GPS Status ENTER ONLY For O CHART7 ZE MENU Page ENTER GPS Status ENTER gt GPS SETUP menu Sets the your preferred configuration for the connected GPS sua Restart GPS MENU Input Output ENTER GPS Setup ENTER Restart GPS ENTER sua Differential Correction None WAAS EGNOS RTCM 104 MENU I nput Output ENTER GPS Setup ENTER Diff Corr ENTER ess Navigation Speed High Low MENU input Output ENTER GPS Setup ENTER Navigation Speed ENTER aua PRN WAAS SATELLITE Selection Auto 120 Active IF DIFFERENTIAL CoRRECTION Is WAAS EGNOS MENU Input Output ENTER GPS Setup ENTER PRN WAAS Satellite ENTER E HDG Heading Horizontal direction in which a ship actually points or heads in any moment see also COG E HDOP Horizontal Dilution Of Precision Index for position fixing accuracy The smaller the HDOP value the more accurately the position can be fixed gt HOME or Navigation See Navigation mode CLEAR gt INPUT OUTPUT menu Allows to select the following options Port Input n Port Output n Port Output Sentences n C Link and the Cable Wiring pages Note SS Where n 1 2 3
138. place the cursor on the desired position press EN TER select WAYPOINT press ENTER again The Waypoint is shown on the screen and it becomes the first point of the first route A window with information on route number symbol and name Latitude Longitude of Waypoint is shown on the screen Also it is indicated the distance to cover and or covered if there are several Way points refer to the next Waypoint 3 4 2 CREATING A ROUTE Repeat the Adding Waypoint procedure described in the previous Par 3 4 1 The sequence of moving the cursor and pressing ENTER is continued to create the route until you have reached the last Waypoint your final destination Segments connecting the Waypoints are shown and the starting point is identified by a circle Surrounding the first Waypoint of the route the distance to cover is shown too 3 4 3 DELETING WAYPOINT To delete the Waypoint place the cursor on the desired Waypoint press Deeg Press Accept to confirm the deletion The Waypoint is deleted and a new line between previous and next Waypoint is shown The deleted Waypoint remains Shaded until the screen is redrawn When the cursor is placed on the desired starting Waypoint it can be the first Waypoint of the route or not press GOTO select CURSOR and press GOTO again or ENTER The Waypoint symbol is shown enclosed in a circle and a dot line connecting the Target with the ship All navigation data are referred to the Targe
139. presents the direction to follow User Manual 87 E BUOY Floating object moored to the sea bottom in a particular charted place as an aid to navigation gt Cartridge Also called MEDIA gt CHART page Shows the chart at full screen ONLY For O CHARTSD bt PAGE Chart ENTER ONLY For O CHART 7 ZE MENU Page ENTER Chart ENTER gt CHART DATABOXES page Shows the chart and the Text Area ONLY For O CHARTSD bt PAGE Chart Databoxes ENTER ONLY For O CHART 7 ZE MENU Page ENTER Chart Databoxes ENTER E C LINK Allows to sharing the same navigation data between two chart plotters linked via serial I O port E COG Course Over Ground Direction of the path over ground actually followed by a vessel gt CONFIG Track menu Handles track settings ene Active Track MENU Track ENTER Config ENTER Active Track ENTER insert the number of the desired Track 1 5 ENTER ewe Display Mode Visible Hidden MENU Track ENTER Config ENTER Display Mode ENTER Visible Hidden ENTER sws Track Color MENU Track ENTER Config ENTER Color ENTER select color ENTER ase Step Unit Time Distance MENU Track ENTER Config ENTER Step Unit ENTER Distance Time ENTER sss Time Step 1 sec 5 sec 10 sec 30 sec 1 Min MENU Track
140. ptions are set Preprogrammed settings are user selectable from Full Medium Low Radar Tides Custom The table below shows the selections for each mode Setting Full Medium Low Radar Tides Custom Default values Place Names On On On On On On Name Tags On off off off Off Off Nav Aids amp Light Sectors On No Sector No Sector No Sector Off No Sector Attention Areas On On Off Off Off On Tides amp Currents On Off Off Off On On Seabed Type On Off Off Off Off Off Ports amp Services On On Off On Off On Tracks amp Routes On Off Off Off Off On Depth Range Min 0 Mt 0 Mt 0 Mt 0 Mt 0 Mt 0 Mt Depth Range Max 9999 Mt 9999 Mt 9999 Mt 9999 Mt 9999 Mt 10 Mt Land Elevation On On Off Off Off On Land Elevation Values On Off Off Off Off Off Roads On Off Off Off Off On POI On off off off off off User Manual 39 Lat Lon Grid On Off Off Off Off Off Chart Boundaries On Auto Off Off Off Auto Value Added Data On Off Off Off On On Chart Lock On On On On On On Underwater Objects Limit 304 Mt 10 Mt 10 Mt 10 Mt 10 Mt 10 Mt Rocks con Depth Icon Icon Icon Icon Icon Obstructions Icon Depth Icon Icon Icon Icon Icon Diffusers Icon Depth Icon Icon Icon Icon Icon Wrecks Icon Depth Icon Icon Icon Icon Icon The following are the available selections only if Custom has been selected Place Names Turns On Off the displaying of the names gt Press any soft key MaP Other Map Configurations ENTER Display Mode ENTER Custom ENTER
141. r r 79 6 3 1 4 Fish Finder and Chart page EE 79 The Focus Soft Key to change the active window 79 6 4 ZOOM MODES whetasntdarauise ances a rrr rrr rtrt ceraciecieue a paceadecnesterewenuacmecmmeccarmecemeties 79 6 4 1 The Bottom Lock Zoom rr rrssrsssssssssssssssrssssssasasa 79 6 4 2 The Marker ZOOM get 80 6 5 FISH RPINDER SETUP MENU tes Ee sence Ee AS bebe EE ee 80 6 5 1 Preset Mode sivssineedsnsiadicacedactan EE Ee EENS EEN 80 6 5 2 Gal Mode eege 80 6 5 3 Range MODS suyana a spessr ranaqa NOE E EEEE E EREE sya wapsi akupana 81 6 5 4 e Ce RE 81 0 55 Shift E EEN 81 6 3 6 Bottom Range ebe BEE Eege 81 Dos E Ce UTC te GENEE 81 6 5 8 Interference Rejection EE 81 6 5 9 Sensitivity Menu EE 81 6 5 9 1 Freg ENCY E 81 e E EE CC e WEE 82 65 92359 eo KO 82 6 5 9 4 STC Length EE 82 6 5 9 5 STC Strength EE 82 D User Manual 6 5 9 6 Surface Noise Filter as uenug eg ageu ged s DEENS ENNEN 82 Doo LO Display SClUD eege 82 6 5 10 1 Color Settings EE 82 6 5 10 2 Scr lling Speed EE 82 6 5 10 3 White EE 82 6 5 10 4 Fish E dene e 82 6 5 10 5 Water Temperature r rrr sssssssssssassss 83 E a E De Ne ere WE 83 6 5 11 1 Keel en EEN 83 6 5 11 2 Calibrate Sound Speed BEE 83 6 5 11 3 Calibrate Water Speed EE 83 6 5 11 4 Calibrate Water Temperature rr RR
142. rdinates field is selected press ENTER Use the cursor key to insert the value and press ENTER Press ENTER or Accept 4 2 5 GOTO gt Adding Mark CENTER MARK ENTER or Place cursor on Mark Press GOTO select CURSOR and press GOTO again or ENTER a circle surrounds the Mark symbol A line is shown connecting the Target with he ship s position When the Target is placed all navigation data are referred to this Target Otherwise press GOTO select MARK and press GOTO again or ENTER the User Points List is shown on the screen Select the desired User Point the Mark and press GOTO again or ENTER the Target is placed on the selected User Point 4 2 6 FINDING MARK gt Press any soft key Map FIND ENTER USER POINTS ENTER A window is shown to find the Mark inserting label Use the cursor to insert the name and press Accept CANcEL otherwise 4 2 7 FINDING INFORMATION ON MARKS USER POINTS LIST gt MENU List ENTER List ENTER A full page window is shown with information on stored User Points Mark e Waypoint Moving cursor up down select the desired User Point See the previous Par 4 1 2 8 4 2 8 SEND MARKS To transmit all User Points onto the NMEA output port gt MENU List ENTER Send ENTER 4 2 9 RECEIVE MARKS To save all User Points received from the NMEA input port gt MENU List ENTER Receive ENT
143. re a positive negative offset to display right value on Fish Finder screens 6 5 11 5 Calibrate Aux Temperature Allows the calibration of the Aux Temperature sensor Using the readings from a precise temperature measuring device insert here a positive negative offset to display right value on FF screens 6 5 11 6 Set Default settings Restores the default values 6 5 12 ALARMS The Alarms menu allows you to define additional sonar alarm settings for Fish Alarm Shallow Alarm Depth Alarm and Temperature Upper Lower Rate MENU Devices ENTER Fish Finder Setup ENTER Alarms ENTER 6 5 12 1 Shallow Water Triggers an alarm when depth becomes shallower than the value set 6 5 12 2 Deep Water Triggers an alarm when depth becomes deeper than the value set User Manual 83 6 5 12 3 High Water Temperature Triggers an alarm when the transducer reports a temperature from TEMP 1 sensor above the value set 6 5 12 4 Low Water Temperature Triggers an alarm when the transducer reports a temperature from TEMP 1 sensor below the value set 6 5 12 5 Water Temperature Rate Triggers an alarm when the transducer reports a temperature from TEMP 1 sensor variation rate above the value set 6 5 12 6 Fish Alarm The options for Fish Alarm set the size of the fishes that if detected by the unit switches an alarm to sound These options are Off Small Medium Big and Huge The alarm sounds if the set size or bigger i
144. received for 10 minutes The maximum number of tracked targets is 200 Depending on the scale the presentation of the targets change to remove clutter on the screen This information is updated every 3 seconds to 6 minutes depending on speed and rate of turn enabling the track of the vessels in range to be plotted TARGET STATUS DESCRIPTION SYMBOL ACTIVE TARGET Target located within the Activation Range D Target detected by CPA or TCPA Alarm zy i f Dangerous Target is Active Target by definition Flashing SLEEPING TARGET Target located outside the Activation Range A LOST TARGET Ais info is not received from that vessel for 3 5 minutes A Fig 5 2 1 AIS Symbols 5 2 2 AIS MENU To configure the chart plotter to receive AIS data follow the procedure gt MENU Devices ENTER AIS ENTER The AIS menu is shown on the screen the items are described in the follow ing paragraphs 5 2 2 1 Display gt MENU Devices ENTER AIS ENTER Display ENTER Turns Off the display of AIS targets overlay on the cartography or defines the range from the fix within which the AIS Target becomes active The values allowed are from 0 1 to 20 Nm The default setting is 5 Nm 5 2 2 2 CPA Alarm gt MENU Devices ENTER AIS ENTER CPA Alarm ENTER Turns Off the alarm or defines the CPA Limit the values allowed are from 0 1 to 10 Nm The default setting is Off 5 2 2 3 TCPA
145. rength of the current as follows O to 0 1 kn 0 2 to 1 0 kn 1 1 to 2 0 kn 2 1 to 3 0 kn 3 1 to 9 9 kn gt Press any soft key Map Other Map Configurations ENTER Display Mode ENTER Custom ENTER Tides amp Currents ENTER 40 D User Manual Seabed Type Turns On Off the displaying of the Seabed Type Press any soft key Map Other Map Configurations ENTER Display Mode ENTER Custom ENTER Seabed Type ENTER Ports amp Services Turns On Off the displaying of the nearest available facilities of a particular type i e the nearest Hospital sailmaker bank etc The icons list of the available services is shown on the screen Press any soft key Map Other Map Configurations ENTER Display Mode ENTER Custom ENTER Ports amp Services ENTER Tracks amp Routes Turns On Off the displaying of Tracks and Routes recommended and established routes for ships at sea including traffic separation schemes deep water routes Press any soft key Map Other Map Configurations ENTER Display Mode ENTER Custom ENTER Tracks amp Routes ENTER Depth Range Min Allows to insert a minimum value for the depth range Press any soft key Map Other Map Configurations ENTER Display Mode ENTER Custom ENTER Depth Range Min ENTER Depth Range Max Allows to insert a maximum value for the
146. rt Info database containing all the relevant Safety and Navigational information normally found in good pilot books and a presentation software which displays special Port Facility Symbols User Manual 93 gt ROLLING ROAD page Allows to display the Navigation plane in prospective mode ONLY For O CHART5 5F PAGE Rolling Road ENTER ONLY For O CHART 7 ZE MENU Page ENTER Rolling Road ENTER gt ROUTE Sequence of Waypoints connected by segments Among the available routes only one is the active route which is shown by a straight line and arrows to indicate the direction The first Waypoint of the active route is surrounded by a circle sss Select MENU Route ENTER Select ENTER SELEcT Note Coop HipE 11 Delete MENU Route ENTER Delete ENTER sss Report MENU Route ENTER Report ENTER aaa Color MENU Route ENTER Color ENTER sez Send MENU Route ENTER Send ENTER wn Receive MENU Route ENTER Receive ENTER ess Automatic Route Check On Off MENU Route ENTER Automatic Route Check ENTER sss Route Depth MENU Route ENTER Route Depth ENTER ess Route Width MENU Route ENTER Route Width ENTER ss Route Check Accuracy Minimum Low Medium High Maximum MENU Route ENTER Route Check Accuracy ENTER ene Route Check R
147. s detected 6 5 13 SAVE amp LOAD Insert the MEDIA into the slot then follow the procedure gt MENU Devices ENTER Fish Finder Setup ENTER Save amp Load ENTER 6 5 13 1 Load Settings from MEDIA Load the complete settings from the MEDIA and changes the active menu settings 6 5 13 2 Save Settings to MEDIA This is useful to avoid the user having to retune up Fish Finder after a Clear RAM operation or a software update 6 5 13 3 Restore Current Preset Defaults Restors the default values only for the current presets see Par 6 5 1 Preset Mode and does not affect the other presets 6 6 TRANSDUCERS The transducer is a device that transmits and receives sound waves into the water The active component inside the transducer is commonly referred to as an element but actually is a piezoelectric ceramic material Please refer to installing instructions of the transducer manufacturer Note In the following tables related to the transducer functions in the Funct column these abbreviations are used D Depth S Speed and T Temperature 84 D User Manual 6 6 1 DEDICATED AVAILABLE TRANSDUCERS Ac AIRMAR Model Designation P58 31 492 1 01 P58 Low cost Transom Mount 31 680 1 01 P66 Hi Performance P79 31 494 2 01 P79 Plastic P319 31 495 2 01 P319 Plastic 31 658 2 02 B744V W Hi Performance Fairing B45 31 696 1 01 B45 W Hi Performance Fairing User Manua
148. s shown on the screen the items are described in the following paragraphs 5 4 2 1 Log gt MENU Devices ENTER DSC ENTER DSC Log ENTER Selecting Log shows the Distress Call Log page or Position Request Log page it depends which of the two was selected NTER to change mode Position Request Fig 5 4 2 1 Example of DSC Log page Pressing GOTO activates the navigation on the selected DSC position Other available operations are Locate Centers the map on the selected DSC position Cir One Deletes selected DSC position 70 D User Manual Cir All Deletes all entries Hide Show Allows hiding showing the selected DSC position on the chart display Distress Call Position Request Shows Position Request Distress Call page When Position Request page is active this message changes to Distress Call 5 4 2 2 Directory gt MENU Devices ENTER DSC ENTER DSC Directory ENTER Selects the DSC Directory page From this page the user can assign the Vessel Name Contact Name and Phone number to any MMSI Maritime Mobile Service Identity so that when a DSC Distress Call or Position Request is received the name of the vessel is displayed in place of the MMSI number a unique number that is assigned to a DSC radio station for use in emergency situations TIZIANA TIZIANA 0000000055 11342939439 VITTORIA 0000004265 21843605 4CQUARIO FILI 7300400407 0013454 6578
149. s used to set an acoustic alarm automatically triggered when the depth value read by the depth transducer is too shallow The default setting is Off MENU Alarms ENTER Depth Alarm ENTER 3 12 6 HDOP ALARM This function is used to show a warning when the received HDOP value exceeds the Alarm Limit for more than 2 seconds The default setting is Off gt MENU Alarms ENTER HDOP Alarm ENTER 3 12 7 HEADING ALARM This function is used to show a warning when the HDG sentence is not received from a magnetic sensor reading The default setting is Off gt MENU Alarms ENTER Heading Alarm ENTER 3 12 8 GROUNDING ALARM The chart plotter is provided with a function that by querying the map s data verifies potential danger to navigation due to shallow water land rocks obstructions and shoreline constructions The maps are scanned periodically every 10 seconds When the Grounding Alarm is active the chart plotter scans an area in front of the boat This area is identified by a triangle drawn in front of the boat icon whose direction is determined by the current boat heading The length of the triangle is user selectable and its angle is 30 degrees If any of the above objects are found the chart plotter notifies the danger on a dedicated warning message box in the Grounding Alarm Report page The Grounding Alarm is switched Off by default after a Master Reset Once the Grounding Alarm has been
150. select ROUTE and press GOTO again or ENTER the Target is placed on the first Waypoint of the route Press GOTO select MARK and press GOTO again or ENTER the User Points List is shown on the screen Select the desired User Point and press GOTO again or ENTER the Target is placed on the selected User Point 4 1 2 6 Inserting Waypoint Every time you place the cursor on the segment connecting two existing Waypoints of a route the following function is available Place cursor on route leg pag ge Ku 009 30 195E Fig 4 1 2 6 Placing Kam between two existing ones I Press Insert The line between the two Waypoints is turned into a dotted line move the cursor to the new position When the cursor is stationary for one second or two the line will rubberband drawing a dotted line between the last Waypoint and the cursor and another dotted de between the cursor and the next Waypoint 41 13 ZER EE 195E Fig 4 1 2 6a Placing Waypoint between two existing ones II 54 D User Manual Once you have positioned the cursor at new location press ENTER or AccEPT CLEAR or CANcEL otherwise TE STO 359 41 13 069N 009 30 195E Waypoint WPT006 41 14 328N 009 30 869E Past 4 326 Nm Total TTG Ty Ca d e Fig 4 1 2 6b Placing Waypoint between two existing ones III 4 1 2 7 Finding Waypoint gt Press any soft key Mar FIND ENTER USER POINTS
151. single Destination is shown EXTERNAL DESTINATION MRK006 DST 1 4 Nm Fig 5 3 3 5a Quick Info on Single Destination 5 4 DSC The DSC Digital Selective Calling is a method of establishing a VHF radio call it is used to announce urgent maritime safety information broadcasts This system allows mariners to instantly send Distress Call or and Position Request to the other vessels equipped with a DSC transceiver within range of the transmis sion The Distress Call that allows to receive a position of the vessel in distress and the Position Request a great feature for anyone wanting to know the location of another vessel for example you buddy that is catching fish or finding the location of a person you are cruising with are performed by an external device the DSC VHF radio The chart plotter interfaced with a DSC VHF radio prompts the user to see the GPS position of the vessel in distress and also allows for easy navigation to the vessel The Distress Call and the Position Request icons that are displaying on the screen are shown in the following table DESCRIPTION SYMBOL Position Request icon Distress Call icon Fig 5 4 Distress Call and Position Request icons Note NN The label can be the MMSI or the corresponding vessel s name If in the DSC Directory the MMSI has been associated to its relative vessel name the vessel s name is shown in the label instead of the MMSI 5 4 1 DISTRESS CALL AND POSITION REQUEST
152. sor included into specific transducers Alarm Bar 74 Bars showing the shallow water and deep water alarm values The alarm is triggered when depth is outside the range D User Manual OG Depth ruler Vertical graduated bar It is a scale which reflects the depth of the area being displayed Variable Depth Marker VDM Horizontal line on to the Echogram window with a depth label The up down cursor keys can move it up and down The label displays the depth of the cursor position It can be moved to any location pinpointing the depth of a target 9 Zoom Bar Bar showing the portion of the Echogram currently represented in the zoomed window on the left part of the screen It is turned on selecting Zoom Full display page A Scope A real time representation of fish and bottom features passing through the beam of the transducer It is drawn as horizontal lines whose length and hue IS proportional to the sonar strength returned When the default palette is selected the strongest sonar returns will be shown as the color displayed of the top of Color Bar while the weakest as the bottom color G Operating Frequency Readout of the selected operating frequency 6 2 1 UNDERSTANDING THE ECHOGRAM DISPLAY The main elements that can be easily distinguished into an Echogram are Fishes Thermoclines 4 White Line Surface Clutter Structures Bottom Echo Profile Fig 6 2 1 The Fish Finder Echogram OR F
153. t placed The Target automatically is moved on the next Waypoint on the route when the Target is reached Otherwise placing the cursor on Target and pressing Next the Target is moved on the next Waypoint on the route The cursor is moved on the actual Waypoint Target if the Target is placed on the last Waypoint on the route Next is not active When the cursor is on the Target pressing Previous the Target is moved on the previous Waypoint in the route The cursor is moved on the actual Waypoint Target if the Target is on the first Waypoint of the route Previous is not active User Manual 31 3 4 4 TIME TOGO When the Target is placed the TTG value if selected is shown in the Text Area 3 4 5 DELETING TARGET Place cursor on Target icon press Stop Press ENTER or GOTO the symbol that identifies Target remains the screen until it is redrawn 3 5 C MAP By eppesenMAX CARTOGRAPHY I NFORMATION MAX is a major evolution of the product technology Key points are 3 5 1 DATA FEATURES e ISO Certification electronic chart production process with quality cer tification Extra Large Coverage all the C MAP By Jeppesen electronic chart detail and a huge coverage without having to change cartridge e Official data source data based on use of official data sources e Detailed World Background worldwide background chart with details e Depths amp Land Elevation color shading of sea depth and land alti tude
154. t data DESCRIPTION SYMBOL External Destination RED Icon D WPT002 Next Waypoint GREEN Icon Navigation Leg RED Line Fig 5 3 3 3 Graphical Displaying User Manual 67 5 3 3 4 Route Data Report On the Slave chart plotter when the navigation to the External route is received it is possible to display the information related to the External route by entering the Route Data Report MENU Route ENTER Report ENTER EXTERNAL NAVIGATION 25 01 10 Cruising Speed 10 0Kts Total Route length gt g99Nm Waypoints in Route Remaining Waypoints Fuel Consumption Rate Total Fuel Consumption Initial Fuel Load Remaining Fuel DST TTG ETA Cons Nm HH MMHH MM lit To Dest 20 9 2 05 03 03 20 9 To Next Wpt 48 5 4 51 05 49 48 5 To Last Wpt gt 999 gt 99h 10 01 gt 999 Fig 5 3 3 4 Route Report on the Slave chart plotter External Route Cruising Speed Total Route Length Waypoints in Route Remaining Waypoints Fuel Consumption Rate Total Fuel Consumption Initial Fuel Load Remaining Fuel To Dest To Next Wpt To Last Wpt 68 Name of the external route da PCMPN 0 Planned cruising speed da PCMPN 1 Length from First to Last Wpt da PCMPN 1 No of Wpts in the Route da PCMPN 1 No of Wpts from Dest to Last Wpt da PCMPN 1 Planned Fuel Consumption Rate da PCMPN 1 Calculated fuel consumption to navigate the whole route Volume of fuel avai
155. the page 3 1 5 DEPTH GRAPH PAGES The Depth Graph can be selected in three different modes in a reduced form with chart in a reduced form with Databoxes or at full screen To select the Depth Graph with chart follow the procedure ONLY For O CHART5 5F gt PAGE Chart Depth ENTER ONLY For O CHART7 ZE gt MENU Page ENTER Chart Depth ENTER 50 Nm Poor gt gt N i 28 S 31 JL r G s LM 40 06 680N 012 39 267E 28 D User Manual and to select the Depth Graph with Data Boxes ONLY FoR O CHARTS 5F gt PAGE Depth Databoxes ENTER OnLy For O CHART7 ZE gt MENU Page ENTER Depth Databoxes ENTER Re UI _ 358 N 40 06 875N 012 39 267E Fig 3 1 5a Example of Depth Graph with Data Boxes Otherwise to select the Depth Graph at full screen select ONLY FoR O CHART5 5F gt PAGE Depth ENTER ONLY FoR O CHART 7 ZE gt MENU Page ENTER Depth ENTER Fig 3 1 5b Example of Depth Graph at full screen Notet If valid NMEA0183 depth data is not available or the Fish Finder is present Chart Depth full Depth and Depth Data boxes pages are respectly replaced by the Chart Fish Finder full Fish Finder and Fish Data boxes pages 3 1 6 ONLY For O CHART7 7F VIDEO INPUT PAGES It is possible to see a video input picture on the chart plotter screen This is allowed only
156. the ship automatically requiring a minimum of involvement of Ship s personnel and should have a high level of availability AIS transponders installed on IMO vessels use VHF frequencies to e Transmit details of their own vessel e Receive details from other vessels or navigation aids within VHF range Information being transmitted from vessels over 300 tons that due to re cent worldwide legislation are required to fit Class A AlS transponders Connecting to the chart plotter an AIS receiver please contact your local dealer vessels with AIS transponder within VHF range are displayed on screen giving the skipper or navigator a visual interpretation of the data of nearby vessels This improves safety and specifically for collision avoidance reasons 5 2 1 AIS SYSTEM DEFINITIONS Target t is a vessel equipped with AIS Information about the tar gets is being received by AIS Receiver and displayed on the screen CPA Closest Point of Approach is the closest distance that will be achieved between your vessel and the tracked target based on your vessel s speed and direction and the target s speed and direction CPA Limit This is the distance from your vessel that a target may reach before a target is deemed a threat CPA Alarm Occurs if CPA is less or equal to CPA Limit This test is done for active targets only TCPA Time to closest Point of Approach is the time remaining until the CPA will occur TCPA Limit Th
157. this operation prepares the MEDIA to receive and store information 4 4 4 3 Sorting Directory gt MENU Memory Card ENTER MEpiA Sort By Sort files in the directory This is possible in the following modes e Press Name to sort using file name e Press Time to sort using the file creation time e Press Type to sort using the file data 60 D User Manual Special Functions 5 1 C WEATHER C Weather is an innovative meteorological forecasting system with the ability to visualize the weather forecast overlaying it on cartography The weather data is held on Jeppesen Marine s weather server which can be accessed via a C COM modem connected to the chart plotter or by using the PC Planner or the DPS Dealer Programming System saving the weather data on a MEDIA The weather data are overlaid on a map page as layers The weather format data available are Data Type Display WIND Speed amp Dir WAVE Height amp Dir TEMPERATURE HUMIDITY VISIBILITY WEATHER TYPE Sun WEATHER TYPE Rain WEATHER TYPE Fog WEATHER TYPE Snow WEATHER TYPE Clouds WEATHER TYPE Partly Cloudy WEATHER TYPE Thunderstorm Fig 5 1 Weather data package 5 1 1 C WEATHER MENU To select the menu gt MENU C Weather ENTER The C Weather menu is shown on the screen the items are described in the following paragraphs 5 1 1 1 Copy from Media gt MENU C Weath
158. ty Indicator 35 119 Databoxes Setup 56 Date un us Eege 95 Date simulation 24 Date Format 21 95 DATUM u nn iinne 88 Daylight Saving Time 21 95 Declutter ua pu 2 ussss seiaya asphyupapa sha 36 Dedicated Key 89 Deep Water 83 DEFAULT RE 89 Deleting all stored User Points 56 Deleting All Tracks 59 88 Deleting all User Points 56 Deleting File 60 92 Deleting Mark 57 92 Deleting MOB 92 Deleting Route 49 94 Deleting Selected Waypoint 56 Deleting Target 31 32 Deleting Track 58 Deleting Waypoint 31 56 96 Depth 28 29 36 81 DEPTH page uu u ul E ut 89 Depth Altitude Units 95 Depth Alarm 48 87 Depth Area 36 Depth Graph 89 Depth Graph Pages 28 29 DEPTH RANGE
159. unctions are available Changing Fuel values MENU Route ENTER Report ENTER Fuet e Initial Fuel insert value by using the cursor key Press CLEAR to confirm e Fuel insert value by using the cursor key to insert the forecast consump tion liters per hour Press CLEAR to confirm Press CLEAR to confirm and to return to the previous menu Changing Speed values MENU A Route ENTER Report ENTER SPEED e Manual insert value by using the cursor key Press ENTER or Accept CLEAR or CANcEL otherwise e Auto is used the value automatically computed Reversing Route MENU Route ENTER Report ENTER REvERsE Reversing a route plan is most typically used to return to the point where the route Originally started Selecting the Databoxes Setup and User Points List pages MENU Route ENTER Report ENTER Data To select wrap around the Databox Setup the User Points List and the Route Data Report pages see also Par 3 1 and Par 4 1 2 8 4 1 1 4 Route Color gt MENU Route ENTER Color ENTER A window allows to choose the color by using the cursor key Press ENTER or Conrirm CLEAR or Cance_ otherwise 4 1 1 5 Sending Route gt MENU Route ENTER Send ENTER It transmits the Active Route information onto the NMEA output port The NMEA WPL amp RTE messages are sent to the output port 4 1 1 6 Receiving Route
160. usss EE ege d 88 BWO ee EE 91 C CHC eege ee 23 61 100 C COM Connections 23 C COM modem EE 61 e Et s u umami yasa 66 67 88 C LINK Menu 91 C MAP By Jeppesen 13 32 C WEATHER 88 C Weather Service 61 User Manual C Weather Service Menu 61 94 Cable WINNO 2asiteasatensteasnysseasstasatengaccaats 91 Calibrate Aux Temperature 83 Calibrate Sound Speed 83 Calibrate Water Speed 83 Calibrate Water Temperature 83 Cartography 103 107 Cartridge 100 H 1 EE 11 12 36 Caution Notice page 20 change active window 79 Change Picture Size 34 Changing Fuel values 50 Changing Speed values 50 Chart essre sassa sasssiassa 26 27 28 29 Chart Boundaries 40 41 93 Chart Language 20 22 95 Chart Lock 36 40 42 93 Chart page 79 88 chart plotter On 18 CLEAR ee 17 77 Clear GOTO uuuu ss asawesasnputupapana eee 18
161. usus ssqisapaspai as asasaa saa aaa ka E EREE e ai 39 3 10 1 Display Mode ere EE 39 3 10 2 Getting Automatic e WEE 42 3 10 2 1 Quick INTO om ARGS EE 43 3 10 2 2 F ll Info Or Lakes ENEE 44 3 11 FAND CRT e ut el ME 44 3 11 1 Finding Port Services EE 44 3 11 2 Finding Port CAE EE 45 3 11 3 Finding Port By Distance EE 45 S112 Finding THOS GEET ee tee uuu sis ae Age 45 3 15 eet re Ree EE 45 3 1 1 6 Finding Oost CHO EEN 45 3 11 7 Finding Lakes InformatiON EEN 45 3 11 8 Finding Lakes BY Name EE 46 3 11 9 Finding PointS Of Mate 46 3 11 10FIndirg Re EE 47 3 11 1 teil le Te Coordinates EEN 47 3 11 12Findinog User POINTS EE 47 3 12 ALARMS CC E ME 47 312 1 AUTOM aedehecimertenatcxceteeotanenttegetdcabovent cbtieantaseneauebewndutiscdenceiseeeaxedes 47 3 12 2 e SE 47 3 123 a OCH EE 47 SZ Anchor AIAN ONE 47 3 12 5 Depth A f ON 48 3 126 HDOP Alarmi beer eer 48 3 12 7 Heading Alarm EE 48 3 12 89 Grounding Alar EE 48 3 12 9 Grounding Alarm Range ee ee hee eee eee mer aes yee er nee eae 48 3 12 10Grounding Alarm Report EE 48 3 12 110OnLy FoR O CHART7 7F External Alarm r 48 4 For the Experienced User s swwwwwmwwwwwawawwawawaananaananananaanawaanaanananaanan 49 4 1 MORE ABOUT CREATING AND USING ROUTES tte EES 49 A T MOUs ENEE 49 ALTI Selecting ROUS EE 49 Changing Bu Tei 49 Rout Color ebe ee eet 49 Displaying Route EE 49 Du
162. vice is electrically connected to the chart plotter This allows the connection of high speed devices like Fish Finder If you are connecting a NMEA0183 device and you would like to isolate it from the chart plotter you have to add the opto isolator externally CLEANING PROCEDURE FOR THE PLOTTER SCREEN Cleaning your chart plotter screen is a very important operation and must be done carefully Since the surface is covered by an antireflective coating the procedure for cleaning all the surfaces can be performed in the following way You use a tissue or lens tissue and a cleaning spray containing sopropanol a normal spray cleaner sold for the PC screen for example PolaClear by Polaroid Fold the tissue or lens tissue into a triangular shape moisten the tip and use the index finger behind a corner to move the tissue across the surface in overlapping side to side strokes If the tissue is too wet a noticeable wet film will be left in its path and you will need to repeat the process If too dry the tissue won t glide easily and may damage the surface We will not be liable for errors contained herein or for incidental or consequential damages in connection with the performance or use of this material 12 D User Manual Introduction If you have not used a position finding instrument before and intend to use your chart plotter for navigating we suggest you should read this User Manual and make sure you are familiar with its contents
163. ween Auto 50 kHz or 200 kHz when single frequency page is selected MENU Devices ENTER Fish Finder Setup ENTER Frequency ENTER 6 5 8 INTERFERENCE REJECTION Selects a filter to remove interference from other Fish Finders gt MENU Devices ENTER Fish Finder Setup ENTER I nterf Reject ENTER 6 5 9 SENSITIVITY MENU The Sensitivity menu is accessible both from the Fish Finder Setup menu and by pressing ENTER when in Fish Finder pages All settings in the Sensitivity menu are related to the Frequency selected gt MENU Devices ENTER Fish Finder Setup ENTER Sensitivity Menu ENTER 6 5 9 1 Frequency It allows you to select the Frequency to which the Sensitivity parameters are applied User Manual 81 6 5 9 2 Gain Allows you to control the Gain of the unit s receiver To see more details on the screen increase the receiver sensitivity by selecting a higher gain percentage If there is too much detail or if the screen is cluttered lowering the sensitivity may increase the clarity of the display 6 5 9 3 STC Sensitivity Time Constant it is a time varying gain curve which attenuates the sonar receiver gain in shallow water increasing the gain gradually as the depth increases This is for the purpose of filtering out surface clutter 6 5 9 4 STC Length If STC is Custom it is possible to change the Length of the Sensitivity Time Constant 6 5 9 5 S

o.chart5 o.chart5f

Contents

Download Pdf Manuals

Related Search

Related Contents