FRSM-1500 - Fraco Products Ltd
Contents
1. xi In X ES M b uu p Lu noir See detail 37 ES Fils bleu d 4545 588 7 H N P 7 Jus Emergency brake lt Det 37 IS self test connector Y Fig 60 Interruptor key To re engage the brake loose the collar and insert the interruptor key and tight the collar FRACO Products Ltd User s guide FRSM 1500 IV 9 How to load the platform For road transportation 1 Position all the guardrails as illustrated on pages II 5 amp II 6 2 Lift the jacks and close the trailer outriggers and lock them in place 3 Remove the planks outriggers and place them on the platform sections along with the mast sections Fold the platform sections and secure in place as illustrated on page II 3 4 Remove the wooden jack pads fig 38 IV 10 Mast section2. O O i ii fo O ii A H 9 5 _ EN valli Fig 31 11 20 User s guide FRSM 1500 FRACO Products Ltd How to level the mast using the anchoring system IMPORTANT Do not exceed the following vertical tolerances 1 25 cm 1 2 for a mast of 3 m 10 2 0 cm 3 4 for a mast of 6 m 20 2 5cm 1 for the total height of the mast Ensure that the platform and the trailer are perfectly parallel to the wall Ensure that the platform is perfectly vertical using a bubble level of 1 2 m 4 length If the platform leans towards the building lift the front jacks and tighten in place f the platform leans away from the building lift the rear jacks and tighten in place Load the platform uniformly to prevent it from being unbalanced In case of difficulties in leveling the platform use a strap and ratchet to level FRACO Products Ltd User s guide FRSM 1500 Il 2 Installation of the first anchor When the assembly of the platform at ground level is completed
3. Acces stair bie E Hee Q Fig 61 Stabilizer 28493163 28493174 Lock GOU 5010 Removable jack pads 28493196 User s guide FRSM 1500 FRACO Products Ltd Moving on site platform transportation When moving the unit on trailer on site apply the following rules Ensure that the ground is level and that it can support the weight of the platform in the direction it will be moved Ensure that nothing will impede the moving of the platform electric wires balconies Lift and close the trailer jacks Det 40 amp 43 Slowly move the whole platform to the desired location Position the trailer and level the platform page Il 2 Transportation 1 Repeat steps 1 to 3 from the moving section above 2 Fold in the platform sections 3 Lower the platform using the manual arm located in the control panel until it rest on the rubber bumpers 4 Tie all the movable parts to prevent movement or loss during transportation SE EIS QN y Z gt Jack handle Safety pin 28491161 25490281 gt Det 41 PER gt Se Lock i GOU 5010 SSS Sw TI IE
4. g Emergency stop j TE WD button j Down button TY Generator Optional Fig 54 IV 4 User s guide FRSM 1500 FRACO Products Ltd Procedure for mast platform and anchor dismantling Warning Do not dismantle the mast in sections of more than 6 1 m 20 ft when using a forklift crane or boom truck When dismantling manually do not dismantle in sections of more than 1 5 m 5 ft Notes Unload the platform of all material that is not required for the dismantling of the mast and anchors When dismantling the maximum load supported by the platform men tools and mast sections must be 454 kg 1 000 Ibs otart dismantling the highest anchor followed by each subsequent anchor as the platform is lowered If the mast sections exceed the last anchor start by removing the mast sections that exceed the last anchor Otherwise start by removing the anchor before dismantling the masts Steps to follow when dismantling the anchors Remove the transversal tube between the anchor tubes Remove the articulated collars of the tr
5. Mast section 13060033 IMPORTANT 1 Do not add more than 6 mast sections 7 scetions total to the Fraco system The maximum freestanding height that the platform can reach is 11m 357 2 Be aware of the direction ofthe mast sections 3 Always uniformly distribute the mast sections on the platform during installation User s guide FRSM 1500 Torque 206 Newton meter 152 Foot pound Do not exceed the following vertical tolerances 1 25 cm 1 2 for a 3 m 10 mast 2 cm 3 4 for a 6 m 20 mast 2 5 cm 1 for the total mast height FRACO Products Ltd Installation of the mast sections Installation C 2 O gt o eb Be O o lt O o C O CH TB 2 a 2 Lo _ O C 2 E Same O D E oa Be ES C O 10 C Ke Ces O V 10 eb lt eb O q 2 Lift the platform to the height of the last mast section and slide the next section on the other 3 Follow the assembly instructions on page Il 12 Mast section 13060033 7 f CR gt FR
6. User s guide FRSM 1500 Access door 17490292 FRACO Products Ltd ers Outri Installation e T a c O O V E O Y b i a C O C D O Y OU L O o O C C OU Benn ab O O UN D O Be 102 C I q 2 Insert the pin and secure it in place with the the cotter pin Det 11 IMPORTANT 30 in E 00 O C O O Le c gt lt o O O C C O OU 2 D O Ben D O C o E gt C V E c S Q c O Lo 9 gt c S oa im gt Be D E T ae 8 260 x O Y vi JAM _ O Q O O O 2 D O Det 11 Det 10 Cotter pin GOU 1120 Outrigger adaptor See detail 10 See detai 111 Il 7 User s guide FRSM 1500 FRACO Products Ltd Il 8 Plank ties Installation 1 Install the ties in such a way as to hold the outriggers and the planks together 2 Nail or screw the ties to the planks in order to prevent them from moving 1 category spruce or equivalent Nominal dimensions 50 mm x 254 mm 2 x 10 for a span of less than 1
7. Fig 22 Torque 206 Newton meter 152 Foot pound Il 13 User s guide FRSM 1500 FRACO Products Ltd Installation of the mast end section Installation V C o Ces O D V jo C D V E o Be ES Qo O O O O V _ V C o TB O D V V E o E Qo O C Q Ki 2 Elevate the platform to the height of the last mast section and slide the mas tend section on the other mast section 3 Follow the installation instructions on page Il 12 End mast section 13060022 See detail 22 Fig 24 Torque 206 Newton meter 152 Foot pound Det 22 FRACO Products Ltd User s guide FRSM 1500 Il 14 Outrigger quardrails Installation at more than 40cm 16 of the work surface Installation 1 Install all the guardrails in required places in order to prevent the risk of falling 2 Secure all the gusrdrails using a pin with washer and a cotter pin 3 Insert planks 50mm X 100mm 2 X 4 in the guardrail and hold them in place using nails or screws 4 A board of 15cm 6 must be installed at the botto
8. 340 Kg 750 lbs CG lt I ES E C P gt S ES DSS HI lt gt MEET La ll E x T lt gt 5 D lt H e E gt gt FF E gt lt J AS Concrete block is to only show A how to sread the load on the platform Working area according to the platform capacity 2 workers ID DID DID DID MMO COUCO DIO COE Sy ID ID VID OD DODOO ONO O T CO OD OO DIO IO ODO DID Ol DO OMO OI DIMOIT COQCO COQCO CJ JD DID INO CU T DID COQUCO NOD Ol DINDO MMO DOID COUCO ADO e e E i U ES Fig 50 Es 28 3m 27 0 5 8 Nominal load 680 kg 1 500 Ibs including 2 workers Keep the loads as close as possible to the elevating units IMPORTANT Never place any loads in the working or circulation zones FRACO Products Ltd User s guide FRSM 1500 IV I Load Distribution Single Mast Configuration closed platform 250 Kg Concrete block is to only show how to
9. for the protection mesh Locking pin GOU 5040 Det 15 See detail Fig 15 FRACO Products Ltd User s guide FRSM 1500 Il 10 Access staircase Installation 1 Remove the access guardrail and place the staircase on the platform Replace the guardrail by aligning the hole of the platform with the holes of the staircase Det 18 2 Secure the guardrail using the safety pin Det 19 Safety pin Access guardrail GOU 5020 gt 17490292 U AAA Z f ch S Y Z Stairs 20490713 See detail 17 18 FRACO Products Ltd User s guide FRSM 1500 H 11 Il 12 Assembly of the mast sections Installation 1 Join the male and female sections 2 Loosen the mast section bolts Det 21 page Il 13 and pivot them to join the mast sections together and tighten the bolts A
10. NN d A V A IN Y I 20010 Les Produits FRACO Products lt e Ltd 2 2 EE ERACO technical Bulletin n MM FRSM 1500 2015 07 21 1 T 0003 A Locking device for FRSM 1500 mast bolts Situation Mast bolts that are incorrectly tightened can loosen further and disengage Affected parts All FRSM 1500 mast sections Corrective measures Addition of a mast bolt locking device for all three mast section bolts Changed the nut to serrated flange nut Addition if it is not already present of a cotter pin Hequired parts 1 x 28027155 Left 1 x 28027166 Right 1 x 28027177 Centre Note It is strongly recommended to follow the instruction contained in this technical bulletin to remove all risk of accident and ensure the safety of the users Important You can contact Fraco at the following email address or phone number to receive the locking devices 28027155 28017166 and 18027177 and serrated flange nuts ECZ 5065 free of charge for all FRSM 1500 mast sections in your possession Email address michel chamberland fraco com Phone number 800 267 0094 For further information or any questions please contact Michel Chamberland or Yannick St Pierre Telephone 450 658 0094 Toll free 800 267 0094 Fax 450 658 8905 20010 Les Produits FRACO Products lt e Ltd 1 2 Addition o
11. y Ny KON See detail 32 M ax YAH f FK ES IUIS RA QJ X XJ XJ V Y Y UY ei A Y ei A A AU xA 127mm 5 min Det 32 Weld Minimum welding length FRACO Products Ltd User s guide FRSM 1500 Il 29 Anchor welded to a structural beam Caution Before proceeding to the installation be sure to have all the required authorizations Installation 1 Install the wall tie and the anchor tube 2 Determine the place to drill the holes for the turnbuckles using page Il 12 3 Adjust the verticality of the tower with the turnbuckles 4 Drill the hole in the brick shelf for the anchor tube pin 5 Ensure that all the pins are in place and that they are secured with cotter pins 6 Secure the anchor by installing the transversal tube 127mm 5 min See detail 33 Ry Ka R PARAR A m RB AA m A V Vu XV XU XJ RSA XJ XJ X VJ V XJ Y X Y RS Fig 44 Anchor for structural H beam S Weld bed Det 33 Minimum welding length H 9 Fig 43 ASS Anchor fot Structural C channel 11 30 User s guide FRSM 1500 FRACO Products Ltd Angle wall tie Caution Before proceeding to the installation be sure to have all the requ
12. Z See det 40 41 T Det 42 See det 42 43 FRACO Products Ltd User s guide FRSM 1500 WII
13. User Guide FRACO All you need to know about FRACO mast climbing work platforms FRSM 1500 LE User Guide FRSM 1500 rev 01 10 2004 All rights reserved Any reproduction in whole or in part is prohibited without the written consent of FRACO Products Ltd Mast climbing work platform High priority warning Height of the first and second wall tie Amendment to all the FRACO platforms User s Guide Please read carefully the present letter and insert it in all your Fraco User s Guide Fraco is changing the anchoring procedure for all types of platforms when using ground base The most recent versions of our user s guide are available on our Web site www fraco com Please refer to them for installation procedures with regards to changes below The two first ties must be at 10 and 20 feet 3m and 6 m or at the two first accessible structural levels on the building max 20 max 6 m This new procedure is to upgrade the safety of our platform during the operation of installation and dismantling The platform must be secured by lifting equipment while installing or dismantling the two first ties Once the second tie is in place the installation continues by the usual procedure reduce load platform 1 2 load except the ACT 4 and the anchoring sequence typical for the type of platform in use as shown below FRSM 1500 FRSM 3000 FRSM 8000 20 feet 6 m ACT 8 et FRSM 20 K 30 feet 9 m ACT 4 40 fee
14. perpendicular to the wall using appropriate L distances see page Il 1 4 Postion the pads under the jacks Use the pin to secure them in place fig 6 5 Level the base using the crank and the outriggers Det 2 Stabilizer 28493163 Lock pin 28493174 D GOU 5010 Slipper l 28493196 Fig 5 Il 2 User s guide FRSM 1500 Lock pin 25490281 e el Jack handle 28491161 S Elevating unit 10050028 Trailer 14040021 Fig 4 Ns WE Lock pin e 25490281 F gt Fig 6 FRACO Products Ltd Opening up the platform sections Step 1 Installation 1 Remove the guardrails and then the pin that holds the platform section to the elevating unit see Fig 8 and Det 3 2 Pivot the platform sections towards the outside Fig 7 Guardrail to be removed 17490247 lt Lock 25490022 Ca es d S ACO 2 ECH B Det 3 See detail 3 JL Fig 8 Reg lt Platform section 15050012 X Fig 7 FRACO Products Ltd User s guide FRSM 1500 Il 3 Opening up the platform sections Step 2 Installation
15. the first anchor must be installed to be able to raise the platform The disrespect of these installation procedures can cause serious bodily and material damages including death If a situation other than one described here arises contact your Fraco representative Fraco Products Ltd and or its importer representative cannot be held responsile in any case First anchor After assembling the platform at ground level three techniques are available to install the first anchor At all times the platform cannot have more than 2 men and their tools on it 1 1st Anchor After installing the platform according to this guide lift the platform to a maximum of 9 1 m 30 above ground Eg and proceed to the installation of the first anchor LUUT v v n d lt E E a 5 CH e B E E j E j B pu i lt EE os i E 11 22 User s guide FRSM 1500 FRACO Products Ltd Installation the anchpors cont d 2 Work from inside the building and positionning in the mast At the level of the first anchor position a man in the mast and one inside the building with all the required equipment for one anchor The man inside must su
16. 1 After removing the locks and pins extend the platform sections to their position replace the locks and pins to secure the sections Det 4 Caution Never pivot the exterior platform sections towards the front lt G SENS 7 M D li Lock pin Wa 28493691 gt Lock GOU 5030 Il 4 User s guide FRSM 1500 See detail 4 Platform after openning FRACO Products Ltd Guardrails Step 1 Installation 1 Remove the safety pins Det 5 2 Remove the guardrails that must be relocated Det 6 3 Lock the guardrails Det 5 ES 7 Safety pin af GOU 5020 Det 5 lt e ANS A See detail 5 JTE 50 O Fig 10 FRACO Products Ltd User s guide FRSM 1500 Il 5 Installation 1 Place the guardrails in such a way to cover all openings to prevnt risk of falling Det 8 Guardrail to their final place Guardrails Step 2 pingle de s ret GOU 5020
17. Horizontal concrete anchor Caution Before proceeding to the installation be sure to have all the required authorizations Installation 1 Install the wall tie and the anchor tube 2 Determine the place to drill the holes for the turnbuckles using page II 12 3 Adjust the verticality of the tower with the turnbuckles 4 Drill the hole in the brick shelf for the anchor tube pin 5 Ensure that all the pins are in place and that they are secured with cotter pins 6 Secure the anchor by installing the transversal tube 11 28 The concrete must have a minimum capacity of 35 Mpa See detail 31 P lt S SS HILTI HSLG RM 12 10 or equal approved Anchor tube User s guide FRSM 1500 FRACO Products Ltd Anchor welded to a brick shelf Caution Before proceeding to the installation be sure to have all the required authorizations Installation 1 Install the wall tie and the anchor tube 2 Determine the place to drill the holes for the turnbuckles using page Il 12 3 Adjust the verticality of the tower with the turnbuckles 4 Drill the hole in the brick shelf for the anchor tube pin 5 Ensure that all the pins are in place and that they are secured with cotter pins 6 Secure the anchor by installing the transversal tube
18. Part Il Installation of the platform In This Section e Assembly of the FRACO platform O O O O 00 0 00 O Installation of the platform Positioning the elevating unit Platform sections Guardrails Outriggers Planks Plank end guardrails Protection mesh Single mast blocking system e Mast sections O O O Assembly of the mast sections Installation of the mast sections e Anchors O O O O O O 00 00000 Anchor position Anchoring system Minimal opening of the turnbuckles How to level the mast with the anchoring system Installation of the anchors Vivi Il 1 Il 2 Il 3 Il 5 15 Il 7 Il 8 Il 9 Il 10 Il 11 Il 17 Il 12 Il 13 11 14 Il 18 Il 19 Il 20 11 21 11 22 Il 25 Il 26 11 27 Il 28 Il 29 Il 30 Il 31 Il 32 Installation of the FRACO platform Verify the ground bearing capacity and ensure that it is sufficient to adequately support the trailer Jack pads Ground bearing capacity Capacit 0 m 0 to 30 5 m 100 34 kN m 700 Ib sq ft 30 5 m to 45 7 m 100 to 150 44 kN m 900 Ib sq ft Installation Type 1 Measure precisely the L distance between the base and the wall taking into consideration all the obstacles that the platform must go around Fig 3 page Il 2 2 Install the FRACO system elevating unit and trailer perfectly perpendicular to the wall at the appropriate L distance 3 Pull the hand break t
19. bolts Install the wall tie and the central tube Adjust the verticality of the tower using the turnbuckles Install the concrete anchor for the central tube pin Ensure that all the pins are in place and that they are secured with cotter pins Secure the anchor by putting tension on the turnbuckles and putting the central tube in compression Determine the place to drill the holes for the turnbuckles using page Il 12 Drill the holes at the required places and clean out any debris that may still be in the hole Inject the epoxy into the hole using an epoxy screen Ensure that the mixture has hardened in the concrete and not in the brick wall Position the treaded rod and bolt the anchor plate temporarily while the mixture hardens Once the epoxy has hardened tighten the bolts Install the wall tie and the central Determine the place to install the anchors for the turnbuckles using page Il 12 Adjust the verticality of the tower using the turnbuckles Install the concrete anchor for the central tube pin Ensure that all the pins are in place and that they are secured with cotter pins Secure the anchor by putting tension on the turnbuckles and putting the central tube in compression The concrete must have a minimum capacity of 35 MPa See detail 35 HILTI HSLG RM 12 10 or equal approved Anchor tube Il 32 User s guide FRSM 1500 FRACO Products L
20. sread the load on the platform SES 550 Ibs according to the platform capacity 550 lbs Working area gt 2 workers CH TD ji NLA odio LOC JL ll LO m A a D a o El fi S S im Fig 51 Wall Nominal load 500 kg 1 100 Ibs including 2 workers The load must be distributed uniformly on the platform Important 1 Fold the platform sections and secure them to the elevating unit Section Il page 3 2 Close the rear outriggers to liberate the soace between the wall and the platform 3 Open the front outriggers to their maximum and secure Section Il page 1 The load must be placed on the platform sections that do not pivot and must be distributed along the length of the platform section IV 2 User s guide FRSM 1500 FRACO Products Ltd How to raise lower the platform Precautions to take before using the platform 1 Verify that the platform trajectory is free of any obstacles 2 Never use the platform when winds exceed 45 km h 28 mph 3 Warn personnel when the platform will travel along the mast 1 After road transportation activate the bypass system in the control panel a YN 2 Raise t
21. 50 m 5 Planks must be 15 cm 6 from the wall Only use planks that are approved by the local authorities IMPORTANT Never place any load on the planks at any time Nails screws Plank tie Det 12 20490050 Det 13 User s guide FRSM 1500 FRACO Products Ltd Plank end quardrail Installation ab C O N X pu O Be E Wa x C D a Be YA O Le C E Y O _ gt O O o ANC C D a Be WA G T q v N O Wa UN O Y O E WA 2 O D Q E Be TJ D Pus 2 O kd CN D Y O H _ E gt oa O O o gt O D O a gt Y _ O _ 2 O O Q I Co E HI _ jo a D oO C o x c c o o Mem ES 05 O D T gt O D 05 jo C o E o Sa 65 Ss O E O C o Bes ES o O C Q lt T _ O Q 2 O E gt O E C E Wa _ O Bes O C Be C _ E O C O O gt Be E D WA C O WA gt E O D Wa c O o em f Y Hd Las
22. 5010 FRACO Products Ltd User s guide FRSM 1500 IV 7 Maintenance IMPORTANT NOTE The frequency and the extent of the inspections and periodic tests depend on national rules and regulations constructors specifications the operating conditions and the frequency of use Normally it is not necessary to dismantle parts during routine examinations unless there is a doubt as to the reliability or the safety Lifting the hood inspection doors and the fact of putting the platform into transportation configuration are not considered as a dismantling Daily Daily Inspection Sheet v During verifications stop the unit and remove the key from the selector switch v Lock the the electrical box to limit the access to authorized personnel only v Verify the verticality of the mast with a 1 m 3 ft level in both directions v Clean any concrete mortar or other deposits that could impede the proper functionning of the platform Weekly v Verify the state of the different bearings v Verify that there is no distortion of the metal components in parts such as the platform sections mast sections the base etc A distortion may occur following improper equipment handling Half Yearl v Verify the proper functionning of the brakes by performing a drop test see page IV 9 Monthly Annually Preventive Maintenance Sheets v Repaint parts or touch up areas susceptible to rust v f parts must be replaced use only genuine Fraco part
23. Fax 450 658 8905 CDA 1 800 267 0094 USA 1 888 372 2648 www fraco com email fracoO fraco com DECLARATION C OF CONFORMITY N 00770077 5162 760 01 10 1304 Type Device for the lifting of persons or persons and objects involving a risk of falling from vertical height of more than 3 meters Mast climbing work platform single or twin mast Brand FRACO Model FRSM 1500 Serial Number M Technical details In single mast Rated load Number of persons 680 kg 2 persons gt Working height 11m Freestanding 100m with anchorages gt Length Width of platform 8 5m 1 65m Trailer Towable trailer This model complies with all relevant provisions of the machinery directive 2006 42 CE 95 16 CE modified on the approximation of the laws of the Member States This model complies with the essential safety and health requirements applicable to it This declaration concern exclusively the machines in the condition in which they entered the market and exclude the components that have been added and or the operations carried out afterward by the final user Notified Organism Technical file APAVE Parisienne SARL Fraco No d identification 0077 420 rue des Erables F 60710 CHEVRIERES 13 17 rue Salneuve 75854 PARIS CEDEX 17 FRANCE La Vice pr sidente St Mathias Sur Richelieu Les Produits FRACO Lt e 29 d cembre 2009 Claudette L Heureux TRANSLATED FROM ORIGINAL NOTICE AAAI AT AAV VIN
24. Il 17 Il 18 Anchor position The anchors are required when working at a height exceeding 11m 35 Maximum height allowed on trailer 30m 1007 XN N VN ISS y Ej CN y 3 A 3 Fig 28 IMPORTANT 1 The first anchor must be installed before placing a load on the platform 2 Load the platform only with mast sections required to reach the next anchor level 3 In work situation the platform may exceed the last anchor by 1 5m 5 First anchor Maximum of 9 1 m 30 above ground level Subsequent anchors Maximum of 6 1 m 20 between each anchor For the installation of the anchors only Il is permitted to exceed the last anchor by 6 1 m 20 with a maximum load of 454 kg 1 000 Ibs including 2 men with tools during anchor installation User s guide FRSM 1500 FRACO Products Ltd Anchoring system Fig 30 Anchporing system well assembly Mast section Bolt amp nut 13060022 O Eu fe Anchor adaptor Reinforced tube Anchor tube LIES Guam Locking pin with lock FRACO Products Ltd User s guide FRSM 1500 Il 19 Minimal opening of the turnbuckles anchoring tubes A 1 0m B 1 17 m VA ud Wall
25. ansversal tube that connect to the anchor tubes Continue to release the tension on the anchor tubes until the pins can be easily removed Do not hit the cotter pins to remove them Remove the anchor tubes Remove the wall plates from the lateral arms and repair the wall if necessary SEL Rusia Trasversal tube BOGE Anchor tube Anchor tube e Re Wall w 4 Fig 58 FRACO Products Ltd User s guide FRSM 1500 IV 5 Procedure for mast platform and anchor dismantling Steps to follow to remove the mast sections Manually 1 Bring the platform just under the joint of the mast section you wish to dismantle 2 Do not remove more than 1 5 m 5 ft at a time 3 Loosen the three 3 tower bolts Remove the mast section and place it on the platform Ensure that the load is evenly distributed on the platform 4 Repeat steps 1 to 4 to the following anchor With a crane or forklift or boom truck otrap the top of the mast to the crane forklift or boom truck and apply a light tension to the strap Remove the required anchor s for the length
26. be 20490353 Safety pin Det 27 GOU 5040 Locking pin With washer 25090088 N AN A EAS 4l e A fi Z A RE V EX ANA S A YNNA N ANNE NANA NAA NEI ASIS NO AY NY FE Ww H y N y lt L WAW WE I ELE um gt gt gt gt m f Det 26 ell Cotter pin Het joe GOU 1120 lt l See detail Outrigger guardrail 05 06 97 17490056 User s guide FRSM 1500 FRACO Products Ltd Il 16 Single mast locking system Installation 1 Insert the outrigger lock in the outriggers located at each extremity of the platform Det 28 2 Insert the locking wheel at the end of the outrigger Det 29 3 Secure the wheel to the outrigger using a pin with washer and a cotter pin Det 29 4 Adjust the length of the outriggers so that the distance with the wall is at least 3 cm 1 12 5 Tighten the bolts on the outrigger lock at the base of the platform section Det 28 IMPORTANT Never place a load on the outriggers at any time l Icom Locking pin with wahser 25490088 Outrigger lock Cotter pin 20490072 GOU 1120 Wheel 20490263 ns Mn V A i E Fig 27 See detail 28 FRACO Products Ltd User s guide FRSM 1500
27. ent vertical O 13 8 pi min Velocidad de elevaci n 0 4 2 m min Verticale verplaatsingsnel heid MADE IN FABRIQU AU S VERVAARDIGD IN CANADA C C O S rial number XX XX XXXX Model number Platform number Year of manufacturing user s guide FRSM 1500 FRACO Products Ltd General View 10 11 3 SE Ner 5 Z S 7 l LACS i Fig 2 8 17 mE 6 14 6 1400021 Trailer _ _ EE 08 Jack 9 19010007 Outrigger O gt Guardrail Elevating unit guardrail gt Pas SSS S OO gt T Anchor system O oO FRACO Products Ltd user s guide FRSM 1500 15 Technical Information Trailer ae Europe 205 R 14 C FRSM 1500 Width of the lower work zone 0 in to 27 in 0 m to 0 8 m Width of the upper circulation and loading zone Lifting speed 13 7 ft minute 4 2 m minute Maximum mast height without anchors Maximum mast height je mn o emo Motor specifications Required power Type FA77BDT90LABMG2HR Electric motor power 2 CV 220V AC 20A 1phase Europe 50 cycles Amp 3 1 Volt 230 460V 3 phase North America 60 cycles 50 HZ EECH user s guide FRSM 1500 FRACO Products Ltd FHACO Les Produits Fraco Lt e 91 Chemin des Patriotes St Mathias Sur Richelieu Quebec Canada J3L 6B6 Tel 450 658 0094
28. f portable crane monorail hard roof or weather enclosure is forbidden without adding ties The outriggers of the base back must be fully open For further information or any question please contact Jean Fran ois Laurin T P or Jean S bastien Lasnier T P Telephone 450 658 0094 Toll Free 800 267 0094 Fax 450 658 8905 20010 Les Produits FRACO Products lt e Ltd 1 2 l Technical FRACO Mast climbing work platform Type Max height Capacity ACT 4 6070 18 3m 4000 lbs 1 815 kg 45 0 13 7m 8 000 lbs 3 630 kg 45 0 13 7m 10 000 Ibs 4 535 kg FRSM 8000 42 0 12 8m FRSM 3000 350 10 7m S FRSM 1500 35 0 10 7m 1 500 Ibs 680 kg HC Vi A 95 A M M p A W JN N i7 M IN IN y Ys lt y mU E i is Den H BS TID TET TI ES N Buceo E hp red ue SA FRACO FRACO AO 11 EE jo o 1 MESES EE 1j DD FIRI RNN RAN j IN LIN LL 77 NN
29. f the cotter pin If the rod ends do not have a hole to install the cotter pin a hole with a diameter of 4mm 5 32 must be drilled The cotter pin GOU 1117 must then be installed 5 32 Installation of the locking device Serrated flange nut 5 8 Gr 5 ECZ 5065 Locking device FRSM 1500 28027155 or 28027166 or 28027177 Washer 1 1 2 X 5 16 28016175 5 8 Rod ends 28015770 Cotter pin 1 8 x 3 4 GOU 1115 The locking device must be installed between the serrated flange nut and the washer It will prevent the rod ends from pivoting if the nut is installed incorrectly The cotter pin must secure the assembly During the assembly of the mast section the serrated flange nut must be tightened as specified in the user guide to prevent it from loosening during use of the platform 20010 Les Produits FRACO Products lt e Ltd 2 2 Congratulations You are about to use the excellent FRACO hydraulic mast climbing work platform system FRACO provides you with the ultimate in SAFETY STABILITY and FLEXIBILITY while reducing your labor costs by up to 36 Due to the advanced technology of FRACO Products You can be assured of the OPTIMUM QUALITY in all our products TOTAL QUALITY FRACO is an ISO 9001 registered company The instruction manual and safety rules presented on the following pages will safely guide you through all the possibilities of this system The platform cannot be sold or rented without t
30. from the platform Subsequent anchors Raise the platform to the level of the next anchor and install it by working from the platform The maximum load allowed is 454 kg 1 000 lbs uniformly spread out and including the workers and their tools 11 24 User s guide FRSM 1500 FRACO Products Ltd Anchor bolted to a brick shelf Caution Before proceeding to the installation be sure to have all the required authorizations Installation 1 Install the wall tie and the anchor tube 2 Determine the place to drill the holes for the turnbuckles using page II 12 3 Adjust the verticality of the tower with the turnbuckles 4 Drill the hole in the brick shelf for the anchor tube pin 5 Ensure that all the pins are in place and that they are secured with cotter pins 6 Secure the anchor by installing the transversal tube u Structural iron angle FRACO Products Ltd User s guide FRSM 1500 Il 25 Anchor bolted to a structural beam Caution Before proceeding to the installation be sure to have all the required authorizations Installation 1 Install the wall tie and the anchor tube 2 Determine the place to drill the holes for the turnbuckles using page Il 12 3 Adjust the verticality of the tower with the turnbuckles 4 Drill the hole in
31. he platform at least 152mm 6 to liberate the limit switch Emergency stop 3 Desactivate the bypass then turn the circuit key to ON Then press the appropriate button to raise or lower the platform as desired 5 Up button 4 Release the button when the desired height is reached ACC Down button Important After using the emergency stop button you must rearm Y the system by using the contact circuit found in the control panel Fig 52 Fig 53 Starting Procedure 1 Place the selector button to 220V 2 Place the circuit key to ON Groupe lectrog ne 220V R armement Arr t a On Start M mM Off Generator D faut Fault On ll Marche Off li Hors tension Circuit S lecteur Selector j D rive By pass Tension 220 V FRSM 1500 gt e 9 TS TS G O Na I pen Fig 52 The buttons are of 2 phase type A light pressure will use the unit s first speed Press completely and the unit s second speed will engage FRACO Products Ltd User s guide FRSM 1500 IV 3 Emergency Procedures Generator WARNING In case of involuntary stopping of the platform 1 Turn the selector key tp generator 2 Turn the circuit key to on 3 Use the raise or lower button as desired 1 Verify if the Tension 220V light signal is lit If so go to 2 If not verify the pla
32. his user s guide FRACO Products Ltd reserves the right to modify the platform or its manual without notice and will not assume any responsibility for any prejudices that may occur The FRACO FRSM 1500 system meets the ANSI OSHA CE EN 1495 1997F requirements except for the following points rack and pinion Manufacturer Distributor ERACO CE Les Produits FRACO Lt e APPAVE Certified 91 Chemin des Patriotes St Mathias sur Richelieu Qu bec Canada J3L 6A 1 www fraco com fraco fraco com If you have any questions do not hesitate to call us at 450 658 0094 Canada 1 800 267 0094 Europe 33 0 3 44 91 03 53 U S A 1 888 372 2648 Or fax us at 450 658 8905 INS NININININ IIS VLL 21212177 ENEE ENEE E Table of Contents Part I What You Need To You General Information Part Il Assembly and Installation of the FRACO System Part IIl Options Miscellaneous Part IV Operating of the FRACO System AVIVA NW NK NN NN VLALLLL TSNUVVVVV Part What You Need to Know General Information Warnings Identification plate General View In This Section C N A WARNING SAFETY IS OUR PRIMARY CONCERN Q For this reason never remove or alter any part in order to adapt the platform to fit a specific area of the building USE ONLY GENUINE FRACO PARTS PLEASE READ THE FOLLOWING INSTRUCTIONS CAREFULLY BEFORE INSTALLATION FRACO and or its importer representative cannot be re
33. in use 10 It is the responsibility of the operator to ensure that the maximum load and the number of people allowed on the platform are respected Refer to the standard load distribution chart 11 This platform should never be used specifically as an elevator Always wear your safety harness when installing and dismantling the mast sections and when manipulating the planks when passing the wall ties O Before raising or lowering the platform make sure 1 That the base is properly fixed in position and leveled see the allowable tolerance in the user s guide 2 That all guardrails are in place 3 That a visual inspection above and below the platform is done before each vertical move to ensure no protrusions will impede or inhibit the proper movement of the FRACO Special attention is needed to verify proper clearance for the walk boards planks 4 Not to exceed the freestanding height 11m 35pi from the ground and that the platform never exceeds the last anchor 5 That all persons have been alerted FRACO Products Ltd user s guide FRSM 1500 l I Identification Plate This plate must be visible at all times O Q FRACO 91 CHEMIN DES PATRIOTES ST MATHIAS SUR RICHELIEU QU BEC CANADA J3L 6A1 SERIAL NO NO SERIE NO SERIE SERIE NR Patent pending no PTC CA01 01125 MODEL MOD LE Mesum MODELO FHSM 1500 MODEL ANC BOUWJAAR Vertical travel speed Vitesse de d placem
34. ired authorizations Installation 1 Install the wall tie and the anchor tube 2 Determine the place to drill the holes for the turnbuckles using page II 12 3 Adjust the verticality of the tower with the turnbuckles 4 Install the concrete anchor for the anchor tube pin 5 Ensure that all the pins are in place and that they are secured with cotter pins 6 Secure the anchor by installing the transversal tube The concrete must have a minimum capacity of 35 MPa See detail 33 127mm 5 min E Fig 44 Anchor for structural H beam amp E E SA mm F R R M gp D f Ww WW V X XJ XJ V VJ V XJ VJ XJ Y v X D Weld bed Det 33 Minimum welding length Y Fig 43 Z ES Anchor fot Structural C channel FRACO Products Ltd User s guide FRSM 1500 Il 3 Epoxy anchor Caution Before proceeding to the installation be sure to have all the required authorizations Installation on concrete wall slab Determine the place to drill the holes for the turnbuckles using page Il 12 Drill the holes at the required places and clean out any debris that may still be in the hole Inject the epoxy into the hole using an epoxy screen Position the treaded rod and bolt the anchor plate temporarily while the mixture hardens Once the epoxy has hardened tighten the
35. m of the guardrail to prevent debris from falling Caution Never place any load on the planks at any time E Plank Locking pin with washer 25490088 qui L Outrigger guardrail Dei 17490067 Det 24 Cotter pi Plinthe 15 cm 6 GOU 1120 See detail 24 N SUIT N See detail 23 FRACO Products Ltd User s guide FRSM 1500 Il 15 Work zone outrigger quardrails Installation at less than 40cm 16 from the work surface Installation 1 Insert the front handrail supports in all the work zone outriggers Det 26 2 Secure the front handrail supports using a pin with washer 11mm and a cotter pin Det 26 3 Install the front handrails on the supports and secure thatm inplace with a locking pin Det 25 4 To join two handrails insert the handrail junction tube on two handrail extremities and secure them with a locking pin Det 27 5 A board of 15cm 6 must be installed at the bottom of the outrigger guardrail to prevent debris from falling It is important to install guardrails at any place required to prevent the risk of falling IMPORTANT Never place any load on the planks at any time Locking pin Cotter pin 25490011 GOU 1120 Junction tu
36. o keep the trailer from moving Always install the wooden jack pads under the outrigger jacks 4 Open the front outriggers and deploy them 25 cm 5 Ensure that the outriggers are perfectly secured before continuing with the installation fig 6 d t 1 6 Extend the outriggers to a maximum rear at least 1 15 m 59 Lower the jacks onto the wooden jack pads see instructions on the outriggers 7 Level the trailer using a bubble level After leveling the wheel on the trailer should turn freely no load must rest on the trailer tires 8 Ensure that the mast is perfectly vertical and that the trailer is level and stable 9 Electric power required 220V AC 20A 1 phase 50 cycles Europe or 60 cycles North America 10 Use a power cable of sufficient length of type HO7RNF or equivalently protected against the weather or mechanical deterioration 11 The platform may be used in an interior or exterior environment where the temperature is between 20 and 40 degrees Celsius FRACO Products Ltd User s guide FRSM 1500 Il I Positioning the elevating unit Fig 3 Important If the platform is not in fornt of a structure extend the front outriggers to their maximum Important Installation 1 Extend the rear outriggers to 1 15 m 3 3 2 Extend the front outriggers to 25cm 10 and adjust the angle of the opening using the pin Det 1 3 Install the elevating unit on the trailer perfectly
37. of mast to be removed by starting with the highest anchor Bring the platform just under the joint of the mast section you wish to dismantle Do not remove more that 6 1 m 20 ft at a time Loosen the three 3 tower bolts Remove the mast section using the crane Repeat steps 1 to 6 as many times as required So EI IV 6 User s guide FRSM 1500 FRACO Products Ltd Procedure for mast platform and anchor dismantling To remove the anchor closest to the ground on ground base 1 otrap the top of the mast section to a crane forklift or boom truck and apply a light tension on the strap 2 Remove the last anchor 3 Lower the platform to the ground 4 Remove and replace all the guardrails fold the platform closed page Il 3 remove the plank ties the planks and the outriggers 5 Loosen the three 3 tower bolts 6 Remove the mast section using the crane forklift or boom truck IMPORTANT These instructions are for the dismantling of a regular FRSM 1500 using a crane forklift or boom truck If you have any questions or doubts as to the sequence of steps or in the procedure contact your FRACO representative Fig 58 28493163 Stabilizer 28493174 Removable jack pads 28493196 Lock Det 38 GOU
38. paa AN NA WEE La A Se V z N WYYYY NX PUN NYY NRX XX ENA WA AAR NAP NU Wu MAN 44 du j PAT AV VIAA SE Ze A c 7 A 77 SS Y 2 2i ANS WY Z Hu V end A Guradrail anchoring area Plank Guardrail 1790045 adi Z DL LEZ AA NONI lt iY Det 14A Nails screws Fig 14C Il 9 See detail 14C d J Fig 14A lt gt E EX ACA ps 4 LLAVE lg A a 1 User s guide FRSM 1500 See detail 14A amp 14B FRACO Products Ltd Protection mesh Installation Be O O _ oa O Lo q ud a Wa C O O lt C C 2 O gt D E Y O Wu E O a _ O Re O c E E Be WA 9 O o O _ a Be T WA E 72 v Be O E WA E _ e q personnel from risk of injury Secure the mesh in place using a locking pin Det 16 Protection mesh 20490634 17 VV MP d y Det 16 Anchoring point
39. pply the man outside with the equipment to proceed to the installation of the forst anchor ALWAYS wear a safety harness securely fastened to the structure when executing this procedure JVVVVVVVVVYVYVYVYVYVYVYVYVYVYVYVWLIVYVYVYVYVYVYVYVYVYVYVYVVYVYVVVVVVVVVVYVIVIVIVIYIIIPIIIIPIPIVIPIPIPIINMIWIWY WY 7 C 1 ji TOMO O g Vv LLEDCEEDTEDCTETCTEDCTHETE EHEE ECT d v g S A ESE OOOO FRACO Products Ltd User s guide FRSM 1500 11 23 Installation of the anchors cont d 3 Held with a crane boom truck or forklift Applicable only for single unit on ground base Strap the extremity of the mast to the crane boom truck or forklift and apply a light pressure to the strap Raise the platform to the level of the first anchor and install it from the platform Wm D METER OOO O N D H D 1 N Ase impelli E e AAA R i With trailer Raise the platform to the level of the first anchor and install by working
40. s In case of doubt or anomalies contact your FRACO representative IV 8 User s guide FRSM 1500 FRACO Products Ltd See detail 38 Drop Test Procedures 1 Place the main switch to the STOP position 2 Open the electric panel and replace the key Det A so that the section with the blue wires is connected 3 Close the electric panel 4 Place the main switch to the ON position An alarm will sound indicating that the platform is in TEST mode 5 Load the platform with the required nominal load 6 Ensure that there is no one on the platform and that there are no obstacles in the platform trajectory 7 With the lever raise the platform to a height of about 3 m 10 ft 8 Press on the descent button The unit will free fall until the centrifugal brake is activated on its own 9 If the centrifugal brake does not activate or if there is an improper functioning release the descent button immediately The platform will stop 10 If the test is conclusive and the centrifugal brake engaged turn the key to OPERATION mode red and black wire and restart the platform 11 However in case of improper functioning contact your FRACO representative 12 The centrifugal brake must engage when the platform has fallen between 1 m and 2 5 m 3 4 and 8 2 Operating connector
41. sponsible for any property damage severe injury or death that may result from failure to comply with the following safety recommendations and local rules and regulations Before operating this FRACO System the following safety rules must be read and completely understood 1 Mark out with beacons or barricade tape and forbid the access around the base and the platform This should be done according to the local rules 2 If you use a gasoline engine do not work in an explosive surrounding refineries etc 3 The operator should be familiar with the user s guide and understand all the functions of the platform before operating the platform 4 Never assume anything If you have any questions concerning the operation of the FRACO STOP Refer to the user s guide If you are still unsure do not continue and call FRACO immediately 5 In order to use install or dismantle a minimum of 2 persons should be on the platform at all times in case of a breakdown or rescue 6 The maximum freestanding height is 11m 35ft when in use and 3m 10ft when not in use 7 This platform must be maintained periodically as well as inspected where required by local laws and regulations Refer to the user s guide 8 Incase of an electric storm DO NOT USE the platform and GET OFF it 9 For personal safety when wind exceeds 12 5m s 28 mp h do not use install or dismantle the platform Make sure that the platform is lowered to the minimum height when not
42. t 12 m For more information contact our Technical Department Julie Rainville Technical Service Director Fraco Products T 800 267 0094 450 658 0094 F 450 658 8905 2001 Les Produits FRACO Products It e Ltd 1 l Technical New specifications for use of free standing bases for 20k FRSM 8000 FRSM 3000 FRSM 1500 ACT 4 and ACT 8 Amendment to FRACO platforms User s Guides for models indicated above Please read the following carefully and insert 1t in your Fraco User s Guides Here are the new specifications for use of free standing bases for 20K ACT 4 and ACT 8 FRSM 3000 FRSH 1500 The outriggers of the deck must not be extended longer than the outriggers of the base maximum 3 planks 30 76 cm See attached drawing Do not extend the top deck outriggers if the bottom ones are already extended The maximum wind speed for use and installation 1s 22 mph 35 km h Use of portable crane monorail hard roof or weather enclosure is forbidden without adding ties The outriggers of the base back must be fully open Here are the new specifications for usage of free standing bases for FRSM 8000 The outriggers of the deck must not be extended longer than the outriggers of the base maximum 5 planks 60 152 cm See attached drawing Do not extend the top deck outriggers if the bottom ones are already extended The maximum wind speed for use and installation 1s 22 mph 35 km h Use o
43. td SSSSSSSSSNSBIEENINISISSTRINS WAZ 7 7 See Part Ill Options Miscellaneous In This Section e Configuration options IDN Confiquration options Dimensions of the platform 4 5m x 1 7m 176po x 68po Use the platform in transportation configuration See Fig 5 page Il 3 z Ee IMPORTANT Fig 4 7 Always balance out the platform Do not extend the platform sections on one side only When installing in front wall covering the whole length of the platform Dimensions of the platform 8 2m x 0 9m 324po x 34po Extend the platform sections as illustrated on pages 3 4 5 6 for complete use of the platform FRACO Products Ltd User s guide FRSM 1500 Ill AVIVA IN IN INN INS TAZA SA 2227212717 Part IV Operating the platform In This Section Load distribution 8 3 m 27 27 IV 1 Load distribution closed platform ed IV 2 How to raise lower the platform IV 3 Emergency procedure IV 4 Procedure for mast platform and anchor dismantling 11 11 1 1 1L H IV 5 Maintenance A IV 8 Drop te IV 9 How to load the platform IV 10 Moving on site platform transportation Load Distribution 8 3m 27 2 Configuration 340 Kg 750 lbs
44. tform power supply or use the self rds descent device in the control panel Apply gentle pressure to control your descent to the nearest exit For use with the generator see 5 See detail 37 2 If the light signal is on start the system with the circuit key in the E Start position e 3 Verify if the Fault light signal stays on lower the platform to the ground by activating the by pass key N 4 If none of these procedure work use the manual descent O ICP 5 Contact your FRACO representative for verification of your platform Z Control panel Fig 56 Manual descent 1 Place the selector key to the Off position 2 Activate the lever located in the control panel in intermittent fashion to reach the desired level 3 The platform must be inspected by a Fraco technician before it is used again Groupe lectrog ne a E 220V R armement O Arr t n Start Off Generator D faut Fault E Note For each emergency stop proceed to starting the lors tension Circuit H H 11 Dee platform as described above in Involuntary stop 1 D rive By pass i dus yp Be careful not to engage the emergency brake during your descent If this occurs you must contact a Fraco technician to reset the circuit FRSM 1500 gt u o C D A 0 30010161 03 Generator access door Fig 57
45. the brick shelf for the anchor tube pin 5 Ensure that all the pins are in place and that they are secured with cotter pins 6 Secure the anchor by installing the transversal tube ADS Fig 37 Structural H beam ES Anchor for structural H beam Fig 38 Structural C channel Anchor for structural C channel 11 26 User s guide FRSM 1500 FRACO Products Ltd Anchor for structure or concrete beam Caution Before proceeding to the installation be sure to have all the required authorizations Installation 1 Install the wall tie and the anchor tube 2 Determine the place to drill the holes for the turnbuckles using page Il 12 3 Adjust the verticality of the tower with the turnbuckles 4 Drill the hole in the brick shelf for the anchor tube pin 5 Ensure that all the pins are in place and that they are secured with cotter pins 6 Secure the anchor by installing the transversal tube The concrete must have a minimum capacity of 35 Mpa Concrete anchor Fig 39 See detail 30 HILTI HSLG RM 12 10 or equal approved Anchor tube FRACO Products Ltd User s guide FRSM 1500 Il 27
Download Pdf Manuals
Related Search