Home

AgeMotion Datasheet V20121202

1. ACL ACL1 gt gt Step motor AC Supply acn Air break ACNI e i Switchi N Step motor M AC20V Swi witching o Dawer ETH witch ETH1 P Power Supply ve L3 5V 12V gt Switching ANC5150 Power Supply O 0 L4 lt gt Water Pump L5 gt l Air l Refresh L6 K gt Gas Pump o 7 17 AAA 1 I Or 6 gt Bg 0 I Laser Power IZ e S T fit EMC 133 o z Rs A a s Ass Z N eg ee a eens of ie ee l I I I I O Q Outside Relay s E B In 2 8 IZ iS og lt gt x Laser Power S unfit EMC i I o J ANC5150 NC Laser System AC220V Anti jamming Connection Connection and system Specification l 58 If there is serious interfere the control system or the motor driver will restart ANC5150 and AHD serial step motor driver will not halt When serious interfere restart is that the software takes steps to prevent datum errors and process chaos The external interfere of system is lied on the environment of electricity usage It is uncertain The main interfere sources are invert equipments arc welding linear power supply and power grid surge The internal interferes is mainly the laser power The laser power is invert equipment So the laser machine tool must adopt AC220V anti jamming
2. ee p NO 13 14 15 16 17 18 19 20 21 22 25 24 25 26 27 28 29 30 52 AgeMotion Datasheet Chapter8 Notice In order to install current connect operate and maintain correctly please read this user s manual carefully and understand all contents The manual should be keeped by ultimate user The manual should be maintained until the system rejected The technical specification will be likely to modify and forgive us no notify Please store this manual with the system appropriately after use so that you can use it at any moment Please don t close with combustible material whenever installation or use Please fetch and put gently Dust and metal dross cannot drop into the controller otherwise will occur short circuit Please don t use or operate the system when it has been destroyed or some equipments have bugs Power must be down when connect system connections Suggest turn off main power 20 minutes before connect high voltage connections This time is different for relative laser power Please keep a proper distance as the laser high voltage operating The laser high voltage is 15KV 20KV generally We suggest keeping 20cm distance If the weather is moist the distance should be farther Assure that the laser power connect with ground reliably Please check whether waterway is in good condition and water quality is clean and periodically check the water swi
3. Eu AgeMotion SH Hangzhou AutomaticAge Co Ltd http www AgeMotion com ERE AgeMotion Datasheet AgeMotion Contents Chapterl ANC5150 Numerical Control Laser System 1 A iso A MAA A E o A l ES C OTM OTN TIS uuu EE PO RO I Ou ENER EEE SES EEREN I jJ o s hl j ARAS o PE e o o I Chapter2 AgeMotion for Numerical Control Laser System 3 DP o AAA uu u 22 o Ao 3 Deg e TAA MN TU pect acoso eee QUE E A 3 2 alan SAE u uuu u uy sesnssyaspaiesisassnaahyspashipssspakspyqspwsipabiwpasnyasusaqayaqasassyaqusaiyyiqusdasyaswaaqyyisyaqayyasuaaqyyiquwqa 3 o O cased ea cen oer oe aa eee sac fst RU S E 3 ASA ET TTT 4 Aa o AAA 4 2 1 E ACE epiniai E EE E ESE O dele qupa saspasakuwppushpsaspasspusaka 4 PE AA AP o VA A A A T 6 AE A o E E E E E uu uu E u s 13 LIM ile M eene Nr e E 13 Zo T Ad IT Ma ii S uuu A san Sa EE O E A 13 2 5 2 Machine s Step Distance Selling uuu ul l l i E a 14 Or J Ali u o e 18 AA jj E POPOP sas 19 S Do SU EMS LAS INTO unan aasan aun sua 19 DO BSS kusana A eo PEE sss ns ns 20 AMA PP PP 21 PA A AAA II II A A E A T EE 21 A e o E EE nanpaq 22 Ol Oe D O sss EE E E arse setae ae E as 23 ZO VOC SS a uuu A EE E E E E E A E E EA E E EE E 23 Chapters ANC5I50 Coniroliipu k u uuu anasu as Gia ciai aee ni ena 25 Pe EU ss ase soe A 25 s Op ee yy TOPRIM Lu uyuuuumossspsssmusussqususassuspussqusanas
4. Valid judge the mission is available or not When the mission is invalid machine will ignore this mission Wait Wait time before task group begin Total the count shoud be processed Page Sure If check this option a affirm dialog box will pop before processing must click the continue button to go on 1f this option 1s not checked the machine will perform the programme automatically without the affirm dialog One Sure in the array working a mission contains several piece 1f check this option affirm by yourself to continue the work after one piece is finished If don t check the option the system will finish all the missions automatically without affirm dialog X Array the mission group count in X coordinate direction Y Array the mission group count in Y coordinate direction X Offset space between two missions group in X coordinate direction Y Offset space between two missions group in Y coordinate direction 2 6 5 Set Parameters Please set all the parameters according to the real condition In mission manage property dialog Work V the laser head s speed when it work normally unit is mm s or Inch s change it in the menu the max speed is 1000mm s Work A it is the differential coefficient of the working speed it decide the time when machine from start to the speed set previous its unit is mm s or Inch s the max acceleration is 5000m s Spare V it is the speed when working but the laser is not out its uni
5. 8 The parameters after setting the first piece area likes the Figure 6 19 shows First Task rea Left top ra sesonon E Right Botton 21 a7S000000 C tia kei K Seale r Seal Fos Mode ArT Scale Figure 6 19 Set First Task Area Please cancel the check of width height and width height scale first before changing the X coordinate scale and Y coordinate scale The orientation style had better be laser head then the machine will start at the point of current laser head at 9 Click button two dialogs will pop one is task team sure dialog see Figure 6 20 the other is task sure dialog see Figure 6 21 click contine button in all of them to contine the work 38 Hangzhou AutomaticAge Co Ltd Http www AgeMotion com ERA AgeMotion Datasheet AgeMotion Task Team Sure x Task Sure Task Team Task Hame ger 00 Hame Test0000 Total Total Finished 0 Finished i Y Array Pos L Array Pos 1 x Figure 6 20 Task Team Sure Figure 6 21 Task Sure 10 Start processing machine s laser head will return the start point when the task is finished If there is no mission please click button to disconnect the computer with machine 6 5 Sculpture Rubber Instance s task sculpture images on the rubber contains setting the slope and processing The steps are following l Make sure the connection is correct trun on the power run the programme AgeMotion6 on the computer s desktop choose the c
6. Appendix A Anti jamming Connection 58 Appendix B File Formats AgeMotion Support 60 Appendix C Mea srement U u u iu ua EPEAN EEE ERE EEEO EES 61 Welcome to choose and buy our corporation s numerical control products Before the use must read and understand the notice in chapter9 and contents in other chapters so that to use the product correctly otherwise will cause troubles even danger ii Hangzhou AutomaticAge Co Ltd Http www AgeMotion com Ria AgeMotion Datasheet AgeMotion Chapter1 ANC5150 Numerical Control Laser System 1 1 Introduction of ANC5150 The structure of ANC5150 Numerical Control Laser System 1s showed as Figure 1 1 PC AC220 AgeMotion6 Ethernet ANCS5150 AC220 DC Assistant software AC220 DC _ 5 12 m lt Laser ANP4149 Pann Power box river Water pump Laser numerical control tool Gas pump Sensor Air refresh Figure 1 1 Structure of ANC5150 ANC5150 Numerical Control Laser System uses technology of high speed motion control DSP embedded DSP real time operating system embedded 10 100M self adapting industry Ethernet and fieldbus DSP
7. Image Flip Horizontal Image Flip Vertical Current Layer to Current Machine All Layer to Current Machine Current Layer to All Machine All Layer to All Machine Connect to Current Machine JENS Vey Br AN be Da dw Eb Pe L NY ES See RS SS d Fress Fl for help Figure 6 22 Add Task 6 Set the parameters in the mission manage dialog box Choose the Sculpturing the slope in working mode combo box choose normal sculpture in the mission s parameters configure combo box the software will set all the parameters automatically likes the Figure 6 23 shows Work V 00 mms Spare Y 200 mm s fork 2500 mmfs 2 Current m Intensity 20000 Scan Step 0 OS000000000 Positive Clr Comp Om Unid Sean York Para Figure 6 23 Set Parameters 5 2500 mm s 2 Spare A In this Sculpturing instance needn t to set the optimizations don t check the positive Sculpturing 7 Like the Figure 6 24 shows to set the parameters for Sculpturing slope The rank number is 21 the rank width is 0 025 mm Set the 0 rank depth as 0 0 set the last rank depth as 1 0 click the auto insert values button the other values will generate automatically Click OK and exit the dialog 40 Hangzhou AutomaticAge Co Ltd Http www AgeMotion com AgeMotion Datasheet 8 10 Ria AgeMotion Gradient Hanaze Depth 00000 050000 100000 00000 20000 20000
8. Optimization includes X coordinate optimization and Y coordinate optimization the parameters could be user defined or defined by software Click the X coordinate first button the parameters will be 1 and 0 then machine will move in X direction first Click the Y coordinate first button the parameters will be 0 and 1 then machine will move in Y 22 Hangzhou AutomaticAge Co Ltd Http www AgeMotion com AgeMotion Datasheet ERA AgeMotion direction first Click the equilibria button the parameters will be 0 5 and 0 5 then the path is optimal Table 2 1 is a group testing values about different optimizations as 1t shows choose the balanced optimization is best esting parameters Files RD RD RD LES LEN Tras ENS 2 6 7 Set Slope Path Z Primary optimization Primary optimization Scale Efficiency 44 15 67 47 Primary optimization 0 1 Primary optimization 0 3 0 7 Table 2 1 Optimize Test 40 15 Slope click button to set the slope parameters when sculpturing the slope the slope manage dialog box likes Figure 2 34 shows Gradient Manage oo am Oo d w pa SS C U U U U U U U U U U U Depth 000000 od TST 13474 bD4211 620947 bo3b04 Todt 1053150 L US IS 52532 TTT 02105 0 0 2 000 Steps Z Auto Width 0 Imm Default ID L DE Depth 53 Figure 2 34 Set Slope Left list shows the information about all the ranks contains the n
9. button to reset the machine and it can continue working In addition at anytime enter previous menu and push system restart function the system will restart and all parameters return initial states so 1t can continue working After push stop button corresponding leds of Pause Continue and stop lighten 4 3 Menu Interface and Functions Click MENU and enter previous menu The interface shows as below Ft AOE HLAS T AA RIG A Function Descriptions Laser on off When laser power is on switch laser emission status 1f choosing this function Machine Reset Machine reset to origin System Restart Control system restart System information Displays control system name and company name 4 4 Main Interface Operations Just when system power on LCD screen displays system information and at the same time machine reset The Hangzhou AutomaticAge Co Ltd Http www AgeMotion com 27 ERE AgeMotion AgeMotion Datasheet screen displays the main interface after reset The sequence of screen display shows as below EE DIST S Z 200404 AGE TERK Z X 0 000 mm Y S 0 000 mm Vxy 0 00mm s HY 0 On the main interface parameters and states those can be setted and displayed include as below X Y axis coordinates machine working speed Vxy laser current strength states on or off of motor offline gas pump atr refresh water pump laser power laser hig
10. namely Digital Signal Processsor Is a special microprocessor used to process real time signals transfer and control DSP realizes sorts of complicated numerical control arithmetic quickly and real time Embedded 10 100M self adapting industry Ethernet supports high speed and reliable communication broad band between computer and laser control system Fieldbus affords steady and reliable communication link for system expansion and distant control The distance of Ethernet and fieldbus communication can reach 40m If use HUB Ethernet can transfer farther Because of Ethernet it is possible for the system to remote update and remote control 1 2 System Components As Figurel 1 ANC5150 numerical control laser system softwares are constituted by AgeMotion6 and assistant softwares The hardwares consist ANC5150 controller ANP4149 portable panel stepping motor drivers and a few lines 1 3 System Features ANC5150 system uses high speed motion control DSP embedded DSP real time operating system This system can remote diagnosis and remote update for using network communcation Embedded 10 100M self adapting industry Ethernet provides maximal 100Mbps communication broad band for the system The main features of ANC5150 is as follows Speeds of Sculpturing and cutting up to 60m min both High resolution up to 13600DPI resolution reaches 0 002mm Precision of repeated orientation poweroff restart up to 0 01mm Genuine stepless speed variation 0 60m
11. www AgeMotion com 19 ERE AgeMotion AgeMotion Datasheet First Task rea Left Top Ri ght 100 UUUUUUUUL Bottom 100 UUUUUUUUL Width 100 UUUUUUUUL Height 100 UUUUUUUUL A Scale 1 UUUUUUUUUUL Y Scale 1 UUUUUUUUUUL Fas Mode WY Scale Figure 2 27 Set First Task Area 1 Left right top bottom is the processing area left and top is the start position right bottom is generate by the width and height Width and height is the work area size set them by youself the default values are the layer s real size Adopt the default X and Y coordinate scale default value is 1 like the Figure 2 27 The user defined scale shows as Figure 2 28 Pos Mode include Zero User define Laser position and absolute Zero coordinate zero default the lefttop is coordinate zero So Left and Top are all 0 Of course you can adjust the zero as leftbottom righttop and rightbottom also User define user define the position of graph Laser position the laser current position as the position of graph Absolute the position of graph in the layer The user can adjust mode need First Task rea Left L Seale 1 Seale Fos Mode WY Scale Figure 2 28 Set First Task Area 2 2 6 3 Set Task Task Set Hame gt qar el UU Valid v iO gt Total Page Sure One Sure Saas ion Figure 2 29 Set Task 1 Name layer name can be any letter Valid judge the mission is available or not When the mission is invalid machine will ignore
12. 10000000C 1 UUUUUUUUUUL SO mm s a e One Sure Omm Valid Fage Sure L Array Y Offset HaitO s e One Sure F TS mm top Bottom Height Y Seale AY Scale SO mms Spare A 300 mms 2 Sean Buf 09 Positive a Wii d Sean Work Para Valid Page Sure Y Array Y Offset spare Y Figure 6 10 Set Task Parameters Click button two dialogs will pop one is affirm mission group dialog see Figure 6 4 the other is affirm mission dialog see Figure 6 5 click contine button in all of them to contine the work In this instance a affirm dialog will pop after finished each whole the task will not go on until clicking the continue button Adjust the position of the material on this moment but can t move the laser head position Hangzhou AutomaticAge Co Ltd Http www AgeMotion com AgeMotion Datasheet ERE AgeMotion 12 Machine s laser head will return the start point when the task 1s finished If there is no mission please click x button to disconnect the computer with machine 6 3 Cut Organic Glass Complex 2 Instance s task cut the graph by outline and cut the figure of the whole Image Includes optimization in gradient and optimization in path the material is organic The steps are following ll 7 Make sure the connection is correct trun on the power run the programme AgeMotion6 on the computer s desktop choose the correct machine click SS button on the Too
13. 35D D 1 400000 500000 550000 00000 ID iss Depths Figure 6 24 Set Slope G oO oO oO oO oO oO oO C The parameters after setting the first task area likes the Figure 6 25 shows First Task Area batt 330 0889999396 Top Right a asan D Botton m Regan D Height r Seas r Seal Pos Mode H T Scale Figure 6 25 Set First Task Area kk k Click button two dialogs will pop one is affirm mission group dialog see Figure 6 20 the other is affirm mission dialog see Figure 6 21 click contine button in all of them to contine the work Start processing machine s laser head will return the start point when the task is finished If there is no mission please click button to disconnect the computer with machine 6 6 Sculpture Backlight Line The software supports the mode of sculpture backlight line This function is convenient for user to process backligt line Instance s task Sculpture backlight line including setting backlight line The steps are following l Make sure the connection is correct trun on the power run the programme AgeMotion6 on the computer s desktop choose the correct machine click 2 button on the Tool bar to link the computer to the machine it may be unsuccessful when the network is busy please try it again how to set and check the network see the information in chapter 10 Click button on Tool bar a machine control dialog box pop press the button to ru
14. B is not equal to a b according to these formulas as follow to compute the machine s real X coordinate and Y coordinate step distance X2 X1 X a A Y2 Y1 X b B Open the management property page input the result X2 and Y2 in the X coordinate step distance and Y coordinate step distance edit box Open the control property page see Figure 2 23 click button to reposition the hardware the machine is out of line now and the control property page shows as Figure 2 24 all of the buttona except power are not activated then click the second button machine activate the buttons as step 5 Return the mission property page cancel the selection of width height and width height scale set the width 700 set the height 400 register them as A 700 B 400 Click the fifth button E on the dialog s left bottom to start the processing After finishing the process measure the rectangle s width and height register as a and b a b if A B is not equal to a b according to these formulas as follow to compute the machine s real X coordinate and Y coordinate step distance X3 X2 X a A Y3 Y2 X b B Open the management property page input the result X3 and Y3 in the X coordinate step distance and Y coordinate step distance edit box Open the control property page see Figure 2 23 click button to reposition the hardware the machine is out of line now all of the buttona except power are not activated then to connect the
15. Check the setting of motor driver and its connection AgeMotion6 cannot connect with hardwares Check the devices communicated with computer and theirs configuration communication line controller and serial number and software password The speed of straight cutting is faster than curve cutting The speed of curve cutting can achieve is limited with its shape machining precision working acceleration and working speed while the limit for straight cutting is less oppositely So straight cutting is faster than curve working But a very short line must be slower than a circular arc with long radius so the relationship between straight and curve insicion is not absolute This condition is normal Unless alter the setting of working parameters the machining speed of a certain line impossibly exceed the fixed limit speed In order to maintain the consistency of the two statuses speed that we can do is only to reduce the working speed on the condition that doesn t alter another parameters But we don t suggest this method for it will reduce working efficiency The reason occurs this condition is that curve cutting can t exceed a certion fixed speed but straight cutting can achieve a higher speed For example when the motion control system wheel angle greater than or equal 90 the wheel speed must be 0 If the system speed maintain invariable then the entire machining speed should be 0 The laser can t turn on Check the waterway and whether t
16. NL is complete version and also the increment revision of NLS There is no difference on function between two versions The only difference of them is that NLS is more abundant on gallery and fodder so users can select and refer them Suggest that user install NL version as install AgeMotion6 first time because it can afford abundant fodder reference So you can choose the NLS version to install later thus you can install the software quickly and also get abundant fodder Q Will AgeMotion6 have update revision in the future If has how distinguish which is newer A Yes AgeMotion6 is serial software and we will update it In the future You can judge the newer according to the version number for example version 6 00 10 1s newer than 6 00 09 Q Should we install the older version before we can install a new version A Needn t Though our software will be updated this will not affect the use of users In other words it s no matter whether you have installed an old version AgeMotion6 or not If you have installed an old version you can set the same path for setup as an old version and then the installshield wizard will finish the covered installation automatically if have not it s more convenient and just finish the installation according to the installshield wizard Q I have installed an old version of AgeMotion6 before install a new version do I need to delete the old version before install a new A It s no effect on installation a
17. and the edge of graph including the end dot length DotLthE the end dot fill length DotIntE interspace between the end dot and the edge of graph DotPrdl increment of dot interval This is the increment of the dot interval and the later dot interval It can be negative and the software computes it automatically DotLthI dot length increment The increment is of one dot according to the previous dot It can be negative and the software computes it automatically DotIntI the dot interspace increment The increment is of one dot interspace according to the previous dot interspace It can be negative and the software computes it automatically Color the color of fill backlight if select new layer Click the color block and pop the select color page see Figure 6 31 Click OK after choose the color then the color of new layer is red as the figure shows If doesn t select New Layer select color is invalid ES ES L s Fa II I T NU H 1 1 1 RHS s polao Fe ew seq 120 QD O Al E FEA ENS A Figure 6 31 Select Color Property of Fill Area 2 Figure 6 32 The usages of the items in Fill Area 2 are the same with them m Fill Area 1 except underside items New Layer if select it fill lines are In new layer and the layer name is Fill Area 2 If not select it the fill lines are filled in the old layer Fill Last If select LineIntS DotIntS DotLthS and DotIntS of this Area are the same with LinelntE Dot
18. min High fieldbus AFB1 distance of communication 40m Embedded 10 100M self adapting industry Ethernet It supports surfing on net or running other programs during system working and will not destroy machining technics It supports multimachine control AgeMotion6 supports limitless machines General accreditation supports 3 machines and special accreditation supports limitless machines 7 Power off protection 8 There are protection circuits for inputs of sensors and dc power supply avoiding short current inverted connect and interfere 9 Reliability design for avoiding system halt and restart 10 Memory function on mechanical and software 11 ANP4149 supports individual control function fe R uma Hangzhou AutomaticAge Co Ltd Http www AgeMotion com 1 ERE AgeMotion 112 13 14 15 16 17 18 19 20 21 22 23 24 23 AgeMotion Datasheet Supports gradient Sculpturing Supports high speed cutting and adjusts cutting precision automatically Supports return difference compensate and unilateral Sculpturing Supports photoengraving Supports setting freewheeling and working parameters individually Supports two levels batched processing two levels multitask and two levels array setting It is suitable to factory batch production Sculpturing cutting outline and so on can be combined freely and parameters of every task can be setted individually Supports optimization arithmetic such as grads and pat
19. not effective on AHD80X reliability But the too big current will bring to noise raise or use life shorten AHD40X requires setting current and motor capacitance matching Q What difference among four type of AHD80X A Type A B step bandwidth is lowest Type D is most high most reliable and it is most simple to control AHD801X fit motor of 42 56 57 86 and AHD802X fit motor of 56 57 86 110 Q If the driver will be destroyed as undervoltage overvoltage short circuit open circuit or error phase or not A It does not destroy the driver But overvoltage occurs to burn the inner fuse The several hundreds volt will destroy AHD80X In such cases AHD40X will be destroyed Q Why my controller can not drive AHD80X A Check the drive current of controller is enough or not 54 Hangzhou AutomaticAge Co Ltd Http www AgeMotion com ERE AgeMotion Datasheet AgeMotion Chapter10 Relative Knowledge 10 1 Ethernet This manual mentions the concept of Ethernet many times so it s necessary to make illumination in brief for users references 10 1 1 Ethernet Summary Ethernet belongs to low layer protocol of network and generally operates on the layers of physical and data link of OSI It is the most universal communication protocol standard in local area network currently This standard defines cable type used in LAN and the method of processing signals It is the most general coaxial cable system that which is bus model and data rat
20. second menu is loaded after open a file then do more particular operations to the graph Openning the file which will be processed through the menu or click the button Ll The software supports many formats file such as PLT DXF BMP JPG DST and so on The BMP file could be sculptured and cut the outline border only can t be cut the graph Save the file by the File Save As menu Because processing graghs is on a base of layers the most particular property is combining several graph files to one graph file notice it only can combine several PLT files several DXF files or several PLT files and DXF files to a DXF files likes the Figure 2 6 shows First open a graph file that you want to be combined second import the other files see Figure 2 7 to be combined then the files are combined to be one file Finally save the file combined as a DXF file the different graphs are distinguished by layers in this file On this way users need to open one file instead of several file to process so that to operate easily Close 6 Ager Close All 8281 Salts 4 File lachine View Window Help Save As a c a E E 4 an a La O Import Print Setup ga Print Ctrl P 5 Send Email 16581 plt 1482 plt Test00002 plt Gradient plt Tae tn nt UU L N le CO pa e Import r Figure 2 6 Import a Graph File 6 Hangzhou AutomaticAge Co Ltd Http www AgeMotion com 1A AgeMotion Datasheet
21. Be ith AgeMotion AgeNotion gt l1 plt 0 977976 File Edit Image Layer Dray Tools Machine View Window Help RR et Efe we G 50 Press Fl for help Figure 2 7 File Combined Choose options in the menu to adjust the view and change the view styles such as aid lines mark lines rulers edge and so on see Figure 2 8 View Window Help Toolbar k a Zoom In a Zoom Out El Page 100 Loom d Refresh N Full Screen bil Ruler Edge Mark Line 17 Aid Line Big Grid Small Grid Reference Figure 2 8 View Menu There is a Toolbar a sub menu in the menu Figure 2 9 decide to show or hide the edition box file information box and machine management box in this sub menu Figure 2 10 Hangzhou AutomaticAge Co Ltd Http www AgeMotion com 7 ERE AgeMotion Help lee Window Toolbar Workspace A Zoon 1 e Standard Status a Zoom Oat Action El Pare E ID Template E Edit Loom d Refresh Command Command Command Visual MN Full Screen bil Ruler Infto Eye Edge Info Fosition Back Ground Lx Z L al Lo iia File Layer 17 Aid Line f Bie Grid File Object a File Ch 1 naled G a S E File Record eference File Page Setting Machine Machine Manage Machine Control Machine T ask Machine Log Reset bars Length mm rea Time Y Pixel Lock Co 8 H
22. E 90 CH Left Top H Right Top L Left Bottom l Right Bottom E Top Left I Top Right T Bottom Left I Bottom Right Figure 2 12 Adjust Coordinate To switch the unit of graph by option in the menu see Figure 2 13 if switched the unit the hints shown in the information dialog box is also changed ier Layer Draw Tools Machine View Window Help Mods Q Q El E H Page Set E a 5 Coordinate d Unit d mm s Dezg C y mm 2 mm s mm s 2 wu inceh s Llez F V inech 2 ineh s ineh s 2 Pixel Figure 2 13 Unit Switch Choose the option in the menu a layer manage dialog box will appear see Figure 2 15 In this box can set layer show or hide change the color of the layer the line style and width of the layer raw Tools Machine Layer Hanaze Current Layer Line 5 Move Lp s Move Down Delete Property Copy Property Paste Property Property Figure 2 14 Layer Menu 10 Hangzhou AutomaticAge Co Ltd Http www AgeMotion com 1A AgeMotion Datasheet Be it AgeMotion File Line G Freeze Lock Color Lin Lin Print Print O i Figure 2 15 Layer Manage This dialog box above contains all informations of the layer to chang the layer setting in this box Through the menu to change the window style see Figure 2 16 in particular change all the sub windows to a friend style when opening a lot of files at the same time Help He
23. ED 1s light when machine restart but the buzzer doesn t give an alarm 4 6 Alarm When the system is wrong the panel will give alarm information ERR LED is light at this time and the buzzer gives an alarm Users should push stop key first then push ON OFF to clear the error push pause continue to reset machine lastly The machine continue working after these operations In addition enter previous menu and push system restart function the system will restart and all parameters return initial states so it can continue working Note If the light head has stroken the position of proximity switch it can t clear the error that push stop and then push ON OFF Because when the light head bumps proximity switch the error message will be send all along At this time it needs to move the light head away from the proximity switch then push ON OFF to clear the error Hangzhou AutomaticAge Co Ltd Http www AgeMotion com 29 ql AgeMotion Datasheet AgeMotion Chapters ANC5150 Technical Specification 5 1 System Connection See also ANC5150 connection figure in chapter 5 2 Size Specification ANC5150 223mm x 146mm x 27mm ANP4149 119 5mm x 71mm x21mm ANP4149 location holes 30 Hangzhou AutomaticAge Co Ltd Http www AgeMotion com ERE AgeMotion Datasheet AgeMotion Chapter6 Instance In this chapter all the instances are carried on in following condition has added the machin
24. IntE DotLthE and DotIntE of Fill Area 1 respectively If not select LineIntS DotIntS DotLthS and DotIntS of this Area define by user Fill Area 2 Width eae Hew Layer Fill Last LineIntS LineIntE LineIntI Line Cnt DotPrds DotPrdE Z mm DotPrdl Color MN DotLth3 DotLthE DotLthI DotInts i mm DotIntE i mm DotIntI Figure 6 32 Fill Area 2 Property of Fill Area 3 Figure 6 33 The usages of the items in Fill Area 3 are the same with them m Fill Area 3 except underside items 44 Hangzhou AutomaticAge Co Ltd Http www AgeMotion com AgeMotion Datasheet ERE AgeMotion New Layer if select it fill lines are in new layer and the layer name is Fill Area 3 If not select it the fill lines are filled in the old layer Fill Last If select LineIntS DotIntS DotLthS and DotIntS of this Area are the same with LineIntE DotIntE DotLthE and DotIntE of Fill Area 2 respectively If not select LineIntS DotIntS DotLthS and DotIntS of this Area define by user Fill Area 3 Width Height Ter Leaper LineIntS LineIntE LineIntI DotPrds DotPrdE DotPral DotLths DotLthk DotLtht DotIntS DotIntE DotIntI Figure 6 33 Fill Area 3 Fill Last Use the setting as Figure 6 28 the result of fill is Figure 6 34 show At this time there appears Fill Area 1 layer Figure 6 35 show AgeNotion C Program Files AutomaticAge AgeNotion6 amp 5S Sele 1 File Edit Image Layer Draw Tools Machine View Windo
25. RD AENA Ds KA Be Figure4 1 ANP4149 Hand Panel 4 2 Keyboard Function Descriptions ANP4149 keyboard function descriptions are showed table4 1 Operation Key Main Functions click enter previous menu double click enter main operation interface to operate parameters and states a E start sequence close sequence clear errors motor moving along Y positive orientation data value largen arrow moving upwards motor moving along Y negative orientation data value minish arrow moving downwards motor moving along X negative orientation switch states on and off cursor moving right confirm operation pause continue machine running motor moving along X positive orientation return last operation or interface 26 Hangzhou AutomaticAge Co Ltd Http www AgeMotion com ERE AgeMotion AgeMotion Datasheet EG amine E E machine stop rapidly Table4 1 Function Descriptions Note Every button on the keyboard has a corresponding LED above 1t Push one button and the corresponding LED will lighten 0 55 MENU Click enter previous menu double click enter main operation interface to operate parameters and states ON OFF Normally no communication error push ON OFF button then it send control instructions to drive board and turn on or off an equipment every second until all peripheral equipments on or off At the same time LCD according to the sequence of on or off displays statement of on or
26. Step Positive d Clr Comp Om Ura d Scan Work Para Figure 6 11 Set Parameters 3 Optimize the gradient and the path click the button a optimization setting dialog box pop likes the Figure 6 12 shows Hangzhou AutomaticAge Co Ltd Http www AgeMotion com 35 AgeMotion K ih AgeMotion Datasheet Task Optimize Gradient Folar Hoise Route Low A Opt Co 1 Mid Y Opt Co Hi zh Global x Clearance Y Clearance Figure 6 12 Set Optimize Check the optimization for gradient to make machine cut inside first then the outside Check the first step optimization for path click the button the parameters will be configured automatically 8 The parameters after setting the first piece area likes the Figure 6 13 shows First Task rea Width ei ght t Seale 1 Seale Pos Mode XT Scale Figure 6 13 Set First Task Area 9 Click button two dialogs will pop one is task team sure dialog see Figure 6 14 the other is task sure dialog see Figure 6 15 click contine button in all of them to contine the work Task Team Sure E Task Sure Task Team Task Hame Agez 00E Hame Tes t0000 Total CO CN 1 Finished Finished 1 Remain Wall Time Wall Time ra mej E Figure 6 14 Task Team Sure Figure 6 15 Task Sure 10 Start processing machine s laser head will return the start point when the task is finished If there is no mission please click button to disconnect the computer with mach
27. ance of AgeMotion6 software when you run the program likes the Figure 2 2 shows The main appearance is made up of menu bar toolbar status bar and view Tiltle bar which is on the top of the window shows the file name and the path opened Its color expresses the file is activated or not There is a control menu icon on the left of title bar press the icon a control menu which used to change the size and position of the window will be opened includes revert move exit maximize and minimize From left to right there are buttons for minimization revert and exit on the right of title bar Menu bar and Tool bar are under the Title bar move mouse to the buttons on Tool bar and pause for one second the hint of the button will pop in Status bar A viewport where the graphs will be shown all right is under the tool bar 4 Hangzhou AutomaticAge Co Ltd Http www AgeMotion com ERA AgeMotion Datasheet AgeMotion The Status bar 1s on the bottom of the window hints of your operation or your command now will be shown here Tie Bet oo DER PE len File Tools Machine View Help I Tool Bar fh SE IS 2006 R m el p Ss J View status Bar Press Fl for help l a Figure 2 2 Main Window of AgeMotion The interface after opening a file likes the Figure 2 3 shows There will be a ruler in the margin of the viewport some assistant lines in the view to hide the ruler and assistant lines please cancel these two choices on the Tool ba
28. and minimum value is down to 0 01mm It can realize precise location on X and Y axis 3 Laser current strength to return higher level interface The range of current This parameter is the value of laser current strength Push A v Push lt to set this parameter Complete add or subtract the strength of laser current using strength is 0 100 Operation interface 1s following Or Push A and current is increased 0000 000 mr 0000 000 mm 0 000 mm 0 000 mm 0 00mm s 0 00mm s 28 Hangzhou AutomaticAge Co Ltd Http www AgeMotion com ERE AgeMotion Datasheet AgeMotion 4 Peripheral equipments states control Peripheral equipments include motor offline gas pump air refresh water pump laser power laser high voltage gt The method to switch these states 1s pushing directly to switch the shadow line according equipment 4 5 Normal Operation PWR LED light This means the system nomally power on TXD LED blink This means that the panel is transfering information to ANC5150 and transfer Is normal RXD LED light This means that the panel is correctly receiving information from ANC5150 ERR LED light This means that the panel has received an error message or the system 19 wrong such as exceed the range of maximal size push stop communcation halt When the system is wrong buzzer gives an alarm In addation ERR L
29. anges succeed otion6 Sample Line plt 0 808567 Help Help Topics lO Visit Web Language 0S S T About AgeMotion Figure 2 19 Help Menu 12 Hangzhou AutomaticAge Co Ltd Http www AgeMotion com Ei AgeMotion Datasheet AgeMotion 2 4 3 Tool Bar Aa E I s Q El 2 HS z DELENE A majority of menu control options have the parallel button on the Tool bar move the mouse over the button for a pause a hint about this button will pop the information about this button s fuction will also be shown in the Status bar so that operation become easy 2 5 Machine Manage 2 5 1 Add Machine Click the AgeMotion6 shortcut to run the programme Choose the option in the menu a machine manage dialog box will be opened On the Tool bar click the button FL Control Panel button El Task Manage button 2 or button El also can open the machine manage dialog box see Figure 2 20 Machine Azge 006 Ed Rw Control Task Show Machine Rans Frogress Address Port E AzeZ006 Unknow ANCB150 100 10 10 10 105 3000 29246 2452 Z 632 Add Delete Name Azge2006 Type ANCB150 100K Address 10 10 10 105 Port Serial 29248 24822 8551 38224 81958 51194 258 837T7T8 Key 46Bqgz 56542 53TT2 B313 B2T39 T B S9 BS238 3TT45 Date Lmt Auto Con Origin Task Pretreat Ho Treatment A Length T mm Y Length A Step 0 1195 mm Y Step 0 1195 mm Pad Y 150 mms Pad A 1000 mms 2 A Left click to s
30. angzhou AutomaticAge Co Ltd Http www AgeMotion com AgeMotion Datasheet ERE AgeMotion Datasheet AgeMotion Machine geZ006 Ed Machine Progress Figure 2 10 Information Box The position of the mouse in time the color of the current point and the unit of the graph are shown in the information dialog box the looked down graph is also shown in the view of the information dialog box The file information dialog box contains four pages they are layer object channel and page layout edit the layers of the graph in the layer page The machine property page shows the management control mission and log informations about current machine Change the scale of the graph exactly and quickly in the menu View gt Zoom likes the Figure 2 11 shows RADA AAA Window Help Toolbar k a Zoom In a Zoom Ont El Page Reference Figure 2 11 View Scale To adjust the coordinate by option in the menu see Figure 2 12 from the first to the fourth option change the effect of seeing only didn t effect on the operation From the fifth to the twelveth option change the origin of the machine s coordinate system they effect on the operation Hangzhou AutomaticAge Co Ltd Http www AgeMotion com 9 ER AgeMotion AgeMotion Datasheet C Program Files Automatica ge Layer Draw Tools Machine View Wi Mode Page Set Se amp Coordinate Z jD Flip Horizontal OTC AA Rotate 90 CCW Eb ROTAT
31. any layers please choose the all layers to current machine option to add all the missions Set the parameters in the mission manage dialog box Choose the cutting in the working mode combo box choose normal cut in the mission s parameters configure combo box the software will set all the parameters automatically likes the Figure 6 6 shows forte A so Current Scan But Om Intensity ocan Step Positive F Clr Comp Dm Uni d Scan Work Para Work Mode Norm Cut Figure 6 6 Set Parameters 2 If necessary set the optimization When set the optimization please see contents of paragraph 2 6 6 Set the first piece area as Figure 6 7 shows Please cancel the check of width height and width height scale first before changing the X coordinate scale and Y coordinate scale The orientation style had better be laser head then the machine will start at the point of current laser head at First Task rea Lett tep 195 9625000007 var e maar D Botton 254 03750000 C r Seal r Seals Pos Mode XY Scale Figure 6 7 Set First Task Area Set mission array parameters are set as Figure 6 8 shows Name is the layer where the mission is Effectivity means that this task is effective if it isn t checked the task is ineffective Count is the count will be produced it is no large than product of X coordinate array and Y coordinate array Check the affirm space of a whole page option a affirm dialog box will pop before processing must cl
32. appoint the position also 3 Press the Wat Refl Gas pump Las and LHV buttons click the Men button to check the laser power is running well or not 4 Choose the option in menu or click 2 button on Tool bar to open a file to process in this instance open the file 721 2 plt 5 Click the mouse right button in the view choose the current layer to current machine option in the pop menu to add a new mission if the graph file has many layers please choose the all layers to current machine option to add all the missions 6 Set the parameters in the mission manage dialog box Choose the cutting in the working mode combo box choose normal cut in the mission s parameters configure combo box the software will set all the parameters automatically likes the Figure 6 1 shows Current Scan But Om Intensity ocan Step Positive 4 Clr Comp Om Uni d Scan Work Para Hork Mode Norm Cut Eg Figure 6 1 Set Parameters 1 7 Ifnecessary set the optimization When set the optimization please see contents of paragraph 2 6 6 in chapter 2 8 Set the first piece area as Figure 6 2 shows First Task Area Left 316 949900005 Top 195 S8250000 1 var ass maar D Botton 254 03750000 C r Seale r Seal Pos Mode XY Scale Figure 6 2 Set First Task Area Please cancel the check of width height and width height scale first before changing the X coordinate scale and Y coordinate scale The orientation style had bet
33. asheet Detail settings show as Figure 2 1 Internet HY ICP IP Ett EH AR Peo ELOTE MIA eae R Sshieindy IP BE Bill Rae U PES RG A 1 F GB O Bab 2 IF Hetk i SAF A IF Hhik s IP Ht I FBU Rs y w BF FB DHS Hg SR HRL E see panc FA DHS HR 25 lA Figure 2 1 TCP IP Setting Connect computer with machine by the reticle markered AB and connect computer or machine with HUB by the reticle markered BB Through the reticle markered AB to connect the UPLINK port of HUB Ususlly HBU has only one UPLINK port so UPLINK port and the other port near the UPLINK couldn t be used together in the same time Connect Machine with panel controller by the reticle markered BB B end 1 white yellow 2 yellow 3 white green 4 blue 5 white blue 6 green 7 white brown 8 brown A end 1 white green 2 green 3 white yellow 4 blue 5 white blue 6 yellow 7 white brown 8 brown The reticle markered A B means one end of the reticle is made in the way of A end the other end is maked in way of B end The reticle markered B B means both of two end is made in the way of B end 2 3 2 Startup l Open the start menu of operating system according to the path AutomaticAge AgeMotion6 gt AgeMotion6 to find the programme in the programme menu run the program 2 Run the programme by the AgeMotion6 shortcut on the desktop immediately 2 4 Frame of AgeMotion 2 4 1 Main Interface The first appear
34. com AgeMotion Datasheet AgeMotion Datasheet Draw Fill Backlight Fill Area 1 Width LineInts DotPrds DotLth5 DotInts 49 2 mm Height 1 mm DotPr dE DotLthE DotIntE 1 mm 1 mm Pi 3 Fill Area 2 Width Linelnts DotPrds DotLth5 Dot T nL 49 2 mm Height 1 mm Lla tFr dE DotLtkE DotIntE 1 mm 1 mm Fill Area 3 Width LineInts DotPrds DotLth5 DotInts 49 2 mm Height 1 mm Dot Fr dE DotLtkE DotIntE 2 mm 1 mm 1 mm Property of Fill Area 1 Figure 6 29 Fill Area 1 Width Height LineIntS LineIntE DotPrds DotPrdE DotLths DotLthE DotIntS DotIntE LinelntkE LinelntE LinelntE 16 mm 1 mm 1 mm 1 mm 16 mm 1 mm 1 mm 17 2 mm 1 mm Z mm 1 mm 1 mm 16 mm 1 mm Z mm 1 mm 1 mm ERE AgeMotion Hew Layer w Linelntl LDotPrdI DotLtht DotIrntl Line Ent 16 Color Fill Last vw 16 Hew Layer d Linelntl DotPrdT DotLtHT DotIntl Line Ent Color Hew Layer Linelntl DotPrdT DotLthI DotIntl Line Ent 16 Color Figure 6 28 Fill Backlight Dialog Hew Layer Linelntl Dot Fr dI DotLthl DotIntl color Figure 6 29 Fill Area 1 Width the width of this area to fill Default is the whole width of graph It doesn t need to alter usually Height the height of this area to fill Default is integral of one third of whole graph User can alter it according requirement And if alter the line interval the heig
35. computer to the click the second button to connect the computer to the machine activate the buttons as step 5 Return the mission property page cancel the selection of width height and width height scale set the width 780 set the height 460 register them as A 780 B 460 Click the fifth button on the dialog s left bottom to start the processing After finishing the process measure the rectangle s width and height register as a and b a b if A B is not equal to a b according to these formulas as follow to compute the machine s real X coordinate and Y Hangzhou AutomaticAge Co Ltd Http www AgeMotion com 17 ERE AgeMotion coordinate step distance X4 X3 X a A Y4 Y3 X b B AgeMotion Datasheet 13 Then the result X4 and Y4 are near the exact values input the result X4 and Y4 in the X coordinate step distance and Y coordinate step distance edit box Bachine Agez006 Control Fosition Control Abs A Pace LLE Y Pace oc A Pos 7 99 90199 7 99 90199 30199 t os 000 A set Laser Control Feed Int 7 100000 Cur 7 29 06 Switch m m m m Figure 2 24 Control Dialog 2 system Test Machine Test Controller Temp 7 35 58 Notice The parameters about machine s step distance should be set only one times when adding a new machine needn t to set again except add another new machine 2 6 Task Manage Select the option in menu or the button in
36. connection to assure the system long term and steady working The user can disconnect the anti jamming portion only when you are sure that the exeternal interfere is not great and adopt the laser power according EMC The environment of electricity usage for main users is relatively good But laser power supply in market are no any EMC certification and the invert power lack EMC portion for cost saving So the anti jamming measure must be done L1 L2 L3 and L7 8 must connect If the power of laser power supply is little relatively L2 and L3 can not connect and use the upper simple connection Large power or serious interfere use the nether complicated connection 48V switching power supply of step motor driver and 5V 12V switching power supply of ANC150B can not use the common ground and can not use a single 5V 12V 48V switching power supply yet The switching power supply must use productions pass EMC certification and safety certification ANC150B chassis connect ground The system can mostly work stably using passed certification switch power supply and no adopt anti jamming Hangzhou AutomaticAge Co Ltd Http www AgeMotion com ERE AgeMotion Datasheet AgeMotion measures 7 L4 L5 and L6 can not connect generally 8 Ll to L8 are toroidal magnetic core But when use laser power supply inconformity EMC we suggest to use suitable choke or reactor or use long distance single power supply 9 The coil of toroidal magnetic core is inphase c
37. dinate step distance it moves on base of the swing in the management property page click the right bottom button the machine will move to the right bottom of the hole area it can move Input values in the X coordinate setting and Y coordinate setting and click the button then the machime will go to the position appointed If the X coordinate offline and Y coordinate offline is pressed the machine is out of software s control in both directions when moving In the laser control setting area the laser control parameters set previously In mission property page is shown Input values and click the set laser button the values will be changed Click the laser out button the laser will output Press the buttons water pump air refresh gas pump laser power and laser hight voltage click the fifth button E on the dialog s left bottom to start the processing Hangzhou AutomaticAge Co Ltd Http www AgeMotion com AgeMotion Datasheet 10 11 12 ERE AgeMotion Bachine TT 11T S Control Position Control Switch System Abs Mot lr at aoc 5 Free Reft x Pos 99 901997 r 301997 99 901997 r FI System Test Y Fos a 901997 r MA e Om Machine Test ies Las Controller Temp Laser Control Feed 35 23 T LH Int 100000 cur agy On Pow uta ar Figure 2 23 Control Dialog After finishing the process measure the rectangle s width and height register as a and b a b if A
38. e 2 21 Add Task 3 There will be a machine mission property See Figure 2 22 pop after adding a layer to missions Input 0 in the left and top edit boxes or choose as Zero and select them in the first piece area width and hight is the size of processing register as A B Other values are default Hangzhou AutomaticAge Co Ltd Http www AgeMotion com 15 ERE AgeMotion AgeMotion Datasheet Bachine T 11 S AgeZO06 Task Team Set aquarel Hame Valid Wal fos Total Page Sure One Sure a Offset Y Offset Task Set Hame tats Total One Sure A Array a Offset First Task rea Left Top Fight Bottom Width 34 999999999 Height UE HT Poz iede WY Scale fork V Spare Y fork A Jaat Current Scan But Om Intensity ocan Step Positive d Clr Comp Dmm Uni d Scan Work Para Work Mode Figure 2 22 Task Dialog Choose the control property page see Figure 2 23 computer 1s link with the machine so the button is activated click the direction buttons to test the machine first Cancel the selection of the absoluteness click the direction buttons machine will move in the direction clicked its distance moved ervery times is according to the parameters X coordinate step distance and Y coordinate step distance Step distance means the distance the machine moved when click the button one time Select the absoluteness the machine will ignore the X coordinate step distance and Y coor
39. e and set the parameters correctly How to add a new machine and set machines step distance correctly please check the paragraph 2 5 1 and 2 5 2 in chapter 2 this step must be done when add a new machine since then it needn t to set again except changing the machine or system Because every machine s capability and every laser power intensity is different all the parameters in this chapter isn t absolute correct but they are could be as a reference and meet requires mostly if they are not proper please adjust them on this base 6 1 Cut Organic Glass Simply Instance s task cut the graph by outline needn t to set the array the material is organic glass The steps are following l Make sure the connection is correct turn on the power run the programme AgeMotion6 on the computer s desktop choose the correct machine click button on the Tool bar to link the computer to the machine it may be unsuccessful when the network is busy please try again how to set and check the network see the information in chapter 10 2 Click button on Tool bar a machine control dialog box pop press the button to run machine click the direction buttons to test the machine is running well or not first If the machine runs well move the laser head to the start position Input the start point to and edit control box click the Set button on right the laser head will move to the point defined ANP4149 hand panel is used to control the machine and
40. e install the software Only by the condition that the system time is precise the software can use normally Please don t alter the system time optionally after install the software Cooling water output of the laser pipe should be placed upwards Hangzhou AutomaticAge Co Ltd Http www AgeMotion com ERE AgeMotion Datasheet AgeMotion Chapter9 FAO Q Whether AgeMotion6 is the update revision of AgeMotion5 or an entirely different revision and what difference on functions between AgeMotion6 and AgeMotion5 A No AgeMotion6 isn t an update revision of AgeMotion3 but a entirely different revision and it is independent of AgeMotion5 AgeMotion6 modifys some flaws in AgeMotion5 There are not only all functions of AgeMotion5 but also many functions that AgeMotion5 doesn t have So the function of AgeMotion6 is stronger and operation 19 more convenient than AgeMotionS Q Do we should delete AgeMotion5 before install AgeMotion6 Is it harmful to the computer system and affected by each other when two revisions exist at the same time A You need not delete AgeMotion5 before install AgeMotion6 Because they are independent and they don t affect each other as running and also not be harmful to the computer system You can delete AgeMotion5 after install AgeMotion6 because AgeMotion6 has all functions of AgeMotionS Q What s the difference between NL and NLS of AgeMotion6 and do we need install both version A NLS is compact version
41. e is 10Mbps This system is cheaper and easier installation oppositely The cables can connect from one workstation to another workstation by using the BNC T connectors on every workstation and complete tasks of network transmission and control 10 1 2 Set Ethernet XP operating system Network Neiborhood gt property local connect gt property gt Internet protocol TCP IP property Please set the TCP IP address as 10 10 10 XX which XX is from 2 to 254 Netmask is 255 255 255 0 push the OK button and exit The setting is completed 2000 XP don t need restart but 98 needs restart 10 2 Network Connections Detection Run the running in the system start menu by the command ping 10 10 10 xx t to detect whether the network is connective or not For example IP address of the machine is 10 10 10 92 you entry ping 10 10 10 92 t push OK and run The time of ping can last one minute as long as one time is connective the network communication 1s normal and the ETH indicator light TX RX of ANC5150 will blink when running ping process If TX RX doesn t blink it is possible that coaxial lines trouble A B types fault machine pause because of failure it can nomally work after hardware reset the fault network configuration of computer 10 3 Glossary 1 Acceleration In Physics acceleration abbr a is defined as the rate of change of velocity with respect to time derivative for velocity to time It is a vector a directional param
42. e simulated as a keyboard to control the Sculpturing system 3 Implement edition transformation effect of graphs control the movement object according to the setting of groaph and movement Must unify the hardware control system 4 The series of AgeMotion6 software supports multi machine control in order to economize the cost and power loss of system It realizes the high speed credible and steady motion control combining with DSP high speed control system 5 The series of AgeMotion6 software s communication with machines is base on ethernet network so it can implement remote control to machines Please look over the introduction of ethernet network in the first section of chapter 11 6 Combine files The series of AgeMotion6 software can use several PLT files and DXF files which are vector files to form a synthesis output a synthesize file that mixed several graphs of different files together the final vector file mixed must be saved as a DXF file so that meeting the needs of processing in the future improving the efficiency more and more in this way 7 The software imports English Interface 8 The software sets authorization password If no password of the password error or exceeded the software can not use normally and can not connect with machine exactly 2 2 Environment CPU should be more advanced than 586 suggest use PIII PIV or a better one Memory should be larger than 256 M Make sure having installed the ethernet
43. elect machine Right click to select operation Figure 2 20 Manage Dialog Adding machine and setting parameters 1 Choose the property page and click the mouse right button to add a new machine 2 Choose a machine to set the parameters about this machine machine name is symbol of this machine it can be any letters Machine type is ANC5150 enter the address serial number and port number and get them from provider Hangzhou AutomaticAge Co Ltd Http www AgeMotion com 13 ERE Os 4 9 10 AgeMotion AgeMotion Datasheet Get the password from the provider and input it Lack of password or the password is out of date the software will not conncent with machine exactly Auto link property if this check box is checked the software will connect with machine automatically in the next start time or when the hardware reposition This fuction is on test can t be used now Origin Set which dot as the coordinate origin You can choose Left Top Right Top Left Bottom or Right Bottom Choose the different origin the task pretreat mode will different The effect of this action will take the show the same as display on layer as working Task Pretreat Pretreat the task display mode You can choose Flip Vertical Flip Horizontal and Vertical Flip Horizontal or No Treatment Setting X coordinate and Y coordinate length these values mean the longest distance that machine can move on the X coordinate and Y coordinate Set the pa
44. et Q What should we do when the driver is very hot A Check the position for place drivers if avail to emit heat And check the fan of heat dispersion if work normally Q Why the motor whistles and moves irregularly A Check the connection The error control signal or phase lackness when motor moving will bring whistle Q Why the stepper motor is always out of step when speed up A The motor system is inertial but the drive power of motor is limited So when the exceptation drive power exceeds drive power of motor the motor will be out of step Design the proper and continuous curve of accelerate and decelerate Q Why the direction of motor move is opposition A Exchange motor coil of any one group but not exchange two groups at the same time Q How to choose the supply voltage of AHD80X A The higher of the supply voltage the bigger of dynamic moment and it is more proper for movation of highspeed When the motor capacitance more while the supply voltage is relative high then the current feedback of motor will bring on voltage rise to overvoltage protect In such a case you can connect a parallel big capacitance of proof pressure for 100V outside the driver The capacitance decides by the capacitance of the motor Normally is serval hundreds to thousands microfarad Q If the driver will be destroyed when set AHD80X current bigger than rated current or not A The setting of driver current and the external motor capacitance are
45. eter It expresses by formula 10 1 as follows dv a dt a is acceleration vector v is velocity vector and t is time In international system of units the unit of acceleration is m S meter per second Acceleration is the expression for ratio of change of velocity For example beginning velocity of an object is vo 0 m S acceleration is a 5m S According to formula 10 2 calculate the velocity of it after time t 1 S The velocity is v vo a Xt 5 m s v v taxt Formula 10 2 Formula 10 1 Where v is the velocity after time of t vo1s original velocity a is acceleration and t is time 2 DSP Digital Signal Processing is a method of processing real world signals using mathematical techniques by special or usual digital signal processing chips The advantages of DSP are fast processing speed flexibility accurate reliablity and tininess DSP has come into being a new technical field and an independent knowledge system It is a potential domain and market 3 HUB HUB is interconnecting equipment to connect multiple computers in computer network or another devices It is the least cell of centralized management in network Hub in English means center It likes the trunk of a tree and it is the focal point of all branch points HUB is shared equipment The function of it is to magnify and transfer signals It issues the all signals from a certain port to all other ports Some hubs enhance signals before issue and
46. graph file has many layers please choose the all layers to current machine option to add all the missions Layer Draw Tools Machine View Window Help SOG e Preu vi TestDDDD v S s A IP L E A amp 0 2 J Eull Sereen w Ruler w Aid Line Image Flip Horizontal Image Flip Vertical Current Layer to Current Machine All Layer to Current Machine Current Layer to A11 Machine All Layer to All Machine Commect to Current Machine Press Fl for help Figure 6 16 Add Task Set the parameters in the mission manage dialog box Choose the cutting in working mode combo box choose cut paper in the mission s parameters configure combo box the software will set all the parameters automatically likes the Figure 6 17 shows Hangzhou AutomaticAge Co Ltd Http www AgeMotion com 37 ERE AgeMotion AgeMotion Datasheet forte Y spare Y forte A ad Current Scan but Om Intensity ocan Step Positive F Clr Comp Om Uni d Scan Work Para Figure 6 17 set parameters 4 7 Click the button to optimize the gradient and the path likes the Figure 6 18 shows Task Optimize Gradient Folar Hoise Route Hi gh Global Equal X Clearance Y Clearance Figure 6 18 set optimization Check the optimization for gradient to make machine cut inside first then the outside Check the first step optimization for path click the Equilibria button the parameters will be configured automatically
47. h optimization 12V1A 5V4A dc power supply Supplys test software of manufacture Supports printer output The contoller has the function of antivirus and defending hackers Supports search and set controller automatically Low power dissipation minimal dissipation is 2 5W Supports file formats more than ten such as BMP PLT and DXF Note The function can be updated This function can update by remote softwar The other marks in this manual followed is same Hangzhou AutomaticAge Co Ltd Http www AgeMotion com ERE AgeMotion Datasheet AgeMotion Chapter2 AgeMotion for Numerical Control Laser System Edition introduction lastest edition V6 01 77 2 1 Introduction The series of AgeMotion6 software as an important part of ANC5150 system is used in motion control mostly It controls the Numerical control electrical machinery by computer completes the different task according to different commands There are some properties of AgeMotion6 software as follow shows 1 Deal with many kinds of graph files the supporting documentation types include PLT BMP DXF DST JPG ICO GIF and so on The PLT file is generated from CorelDRAW the BMP file could be generated from Photoshop the DXF file could be generated from AutoCAD Please check all of the file introductions in appendix A 2 Open many graph files at the same time translate graphs zoom in out graphs rotate graphs preview test sculpture and cut This software can b
48. h voltage Users can set some parameters and states according use The sequence of operation is following firstly double click MENU key when main interface as above figure displays scroll dieblock v and or A It suggests user to A V select the parameter to set by and displays as follow this time The selected parameter display is inverse shadow The interface X 0 000 mm Y 0 000 mm Vxy 0 00mm s VE 0 Push gt enter the operation of parameter or state shadowed 1 Working speed Vxy This parameter is only for display It displays the real time speed as working unit is mm s 2 X Y axes coordinate X Y These parameters display machine real time position on X and Y axis Unit is mm When push gt to set these two parameters cursor will blink on the highest bit of value Shows as follows Z E AROS W000 000 mm 0 000 mm Increase or decrease the value by pushing and V this time A Increases value and V decreases value Summand or minuend is the significance of current cursor position Machine moves to the position of current calculated If the value of add or subtract is less than 0 the result Is considered 0 If the value is greater than machine maximal size the result Is considered the maximum Push gt move the position of cursor Summand and minuend are decreasing followed
49. he water switch 1s normally working or not The voice of motor is too high The rated speed or magnetic core frequency of motor is too slow Please use better stepping motor A worse stepping motor is worse on linearization and response time These cause that motion in electromagnetic vector space unsmooth and dynamic moment small thereby amplitude greater The size of file export has random error or tiny error The random error is caused by the limitations on mechanical or light path and the disposal to these errors should deal with these limitiations The causations for fixed such as light leaning and tiny error caused by the drive ratio of drive system can be settled by adjust minitrim amplification coefficient or stepping distance If the machine bursts into the condition that cannot connect with computer normally and has never occurred this similar status previously It is possible that your accredited password has exceeded the time limit Please consult with the supplier Once working the driver is broken Hangzhou AutomaticAge Co Ltd Http www AgeMotion com ERA AgeMotion Datasheet AgeMotion Check the voltage of Switching Power Supply is steady or not If 1t 1s not steady the instantaneous current of driver will exceed and make the driver broken Please use the Switching Power Supply we suggest Hangzhou AutomaticAge Co Ltd Http www AgeMotion com 91 ERE AgeMotion pd NO G 1 ON Q W WN lt gt
50. ht will change accordingly New Layer if select it fill lines are In new layer and the layer name is Fill Area 1 If not select it the fill lines are filled in the old layer LineIntsS start line interval The interval between the first line and second line in this fill area LineIntE end line interval The interval between the last line and the previous line in this fill area LineIntS and LineInsE decide the LineIntI and Line Cnt of this area If LineIntS is not equal to LineIntE the software will compute LinelntI and Line Cnt according to not greater than the integral of this area height like Figure 6 30 After alter the line interval click and the result display Linelntl line interval increment The increment is between one line interval and the latter line interval It can be negative and the software compute it Fill Area 1 Width Height LineIntS LineIntE DotPrds DotPrdE DotLth3 DotLthE DotIntS DotIntE Hangzhou AutomaticAge Co Ltd Http www AgeMotion com Hew Layer posa Figure 6 30 Fill Area 1 43 ERE AgeMotion AgeMotion Datasheet DotPrdS start dot interval The interval between the first dot and the second dot It includes the first dot length and the interspace between the first dot and the second It is the sum of DotIntS and start dot interspace DotLthS start dot length DotIntS interspace between the first dot and the second dot DotPrdE end dot interval The interval between the last dot
51. ick the continue button to go on X coordinate array means the mission count in X coordinate direction Y coordinate array means the mission count in Y coordinate direction X array excursion means the space between two missions in X coordinate direction Y array excursion means space between two missions in Y coordinate direction Hangzhou AutomaticAge Co Ltd Http www AgeMotion com 33 ERE AgeMotion Task Set Name Total A Array n Offset 9 Set the mission group the parameters as Figure 6 9 shows 10 11 34 Task Team Set Name Total A Array n Offset AgeMotion Datasheet Valid Wao s Fage Sure v lins Sure dl T Array Y Offset Figure 6 8 Set Task Array Valid Y taito s e Page Sure e One Sure dl qa Y Offset O mm Figure 6 9 Set Task Group Mission group array setting is to several missions include one mission in this instance setting the mission group is on the base of mission array setting According to the step 8 1t takes the mission array as a whole then set the mission group array as 2 by 2 the product count is 3 in this mission group means it produce 3 wholes Finally the parameters in mission dialog like fiure 6 10 shows Bachine a U 1 c amp zg zDDB 2 Total Array a Offset Task Set X Offset Left Ki ght Width Scale Fos Mode Work Work Current Intensity Scan Step Clr Comp Work Mode Task Team Set 465 049999991 146
52. ine 36 Hangzhou AutomaticAge Co Ltd Http www AgeMotion com AgeMotion Datasheet ERE AgeMotion 6 4 Cut Paper Instance s task cut the images out of the paper so 1t needs to set the optimization for gradient The steps are following l Make sure the connection is correct trun on the power run the programme AgeMotion6 on the computer s desktop choose the correct machine click e button on the Tool bar to link the computer to the machine 1t may be unsuccessful when the network is busy please try it again how to set and check the network see the information in chapter 10 Click button on Tool bar a machine control dialog box pop press the button to run machine click the direction buttons to test the machine is running well or not first If the machine runs well move the laser head to the start position Input the start point to and edit control box click the Set button on right the laser head will move to the point defined ANP4149 hand panel is used to control the machine and appoint the position also Press the Wat Refl Gas pump Las and LHV buttons click the Men button to check the laser power is running well or not Choose the option in menu or click Ll button on Tool bar to open a file to process in this instance open the file Test0000 plt Click the mouse right button in the view choose the current layer to current machine option in the pop menu to add a new mission see Figure 6 16 1f the
53. l bar to link the computer to the machine it may be unsuccessful when the network is busy please try it again how to set and check the network see the information in chapter 10 Click button on Tool bar a machine control dialog box pop press the button to run machine click the direction buttons to test the machine is running well or not first If the machine runs well move the laser head to the start position Input the start point to and edit control box click the button on right the laser head will move to the point defined ANP4149 hand panel is used to control the machine and appoint the position also Press the Wat Refl Gas pump Las and LHV buttons click the Men button to check the laser power is running well or not Choose the option in menu or click 2 button on Tool bar to open a file to process in this instance open the file Test0000 plt Click the mouse right button in the view choose the current layer to current machine option in the pop menu to add a new mission if the graph file has many layers please choose the all layers to current machine option to add all the missions Set the parameters in the mission manage dialog box Choose the cutting and cutting the frame in working mode combo box choose normal cut in the mission s parameters configure combo box the software will set all the parameters automatically likes the Figure 6 11 shows Work V Spare Y 100 mm s Current Scan But Om o Intensity Scan
54. n users which supports corresponding type of ALC numerical control system when buy an ALC numerical control system We guarantee that customers update AgeMotion6 freely one year after purchase The right to interpret belongs to our company whether the users obtain a free update AgeMotion6 or not Customers should not pirate and copy AgeMotion6 6 If products repair in guarantee period is no trouble in fact after our examination customer should offer carrying cost and insurance Consider that you have accepted all clauses in this manual once purchase this product 11 2 Contact Us Manufacturer Hangzhou AutomaticAge Co Ltd Addr Room 212 213 Building A East Zhejiang University Science Park No 525 Xixi Road Hangzhou China Zip 310013 Tel 0086 57 1 85022190 Fax 0086 571 85022590 Web http www AgeMotion com Email Sales AgeMotion com Recommand use personnel s email Hangzhou AutomaticAge Co Ltd Http www AgeMotion com 57 ERE AgeMotion AgeMotion Datasheet Appendix A Anti jamming Connection ANCS5150 NC Laser System Anti jamming connection as show the figure below
55. n machine click the direction buttons to test the machine is running well or not first If the machine runs well move the laser head to the start position Input the start point to and edit control box click the Set button on right the laser head will move to the point defined ANP4149 hand panel is used to control the machine and appoint the position also Press the Wat Refl Gas pump Las and buttons click the Men button to check the laser power is running well or not Choose the option in menu or click 2 button on Tool bar to open a file to process in this instance open the file Test0000 plt Move the cursor on the graph outline processing and click to choose the graph likes Figure 6 26 choose the circle Click option in menu like Figure 6 27 At this time is active click it and pop the Fill Backlight property page Figure 6 28 The user can adjust fill format of backlight Fill area is divided 3 areas and can set property for every area alone Hangzhou AutomaticAge Co Ltd Http www AgeMotion com 41 ER AgeMotion AgeNotion TestDUDU_plt 0 785750 Fi File Edit Image Layer Draw Tools ase View Window Help ies a x amp Ba E Teake Jer S Tans Jes SU es 244 Alle Press Fl for help Tools Machine View Window Hel Trail Polyline Polygon Rectangle Circle Circle Arce Ellipze Ellipse Arc Align Figure 6 27 select Fill Backlight 42 Hangzhou AutomaticAge Co Ltd Http www AgeMotion
56. nd sculpture the slope in the combo box every mode is effective to all the vector graphs Cutting is effective to vector graph only it can t cut the bitmap Cut mode cut the graph only cut the frame mode cut the rectangle that contain the graph only cut and frame mode cut the graph first then cut the frame we can distinguish the parts easily In this way 2 6 6 Set Optimize According to the user defined optimal parameters machine will move in a optimal path in order to enhance the efficiency so it is very useful when cutting but useless when Sculpturing Optimization contains optimize in gradient and optimize in path both of them can be checked at the same time see Figure 2 33 Task Optimize Gradient Folar Hoise Route Hi gh Global TER Figure 2 33 Set Task Optimize 1 Optimize in Gradient must choose this optimization when cutting through the material If this option is chosen the machine will cut the inside graph first then cut the outside In this way machine cut every part integrallty in turns For example when cutting a traffic circle if choose this optimization machine will cut the circle inside first and then cut the cirle outside Machine will take some time to computer when choose this optimization 2 Optimize in Route route optimization contains four grades primary optimization intermediate optimization senior optimization and holistic optimization choose the primary optimization
57. nd use for a new version whether deletes the old version or not Q How do we delete an old version when we want A You can find AgeMotion6 from the start menu and select wizard of uninstall AgeMotion6 then the system will uninstall the software automatically Additionally you can run add delete program in the system control panel and select change delete uninstall has finished Q Why multi layer can not align in order always A It is easy for files of dxf format which are absolute coordinate But it is not easy for bmp and plt files of their relative coordinate When export a multi layer graph from cdr file only use the way of import layer to align Q Why cut is not from inside to outside A You must select the in Optimize Q Why the order of cut is not as the same as design A You must not select all options in Optimize Q Why the motor moves slowly when start A The step of motor driver is too bigger than the machine s Reduce the step on Machine Manage page Close the software and restart then the motor move normally Q Why connection is correct but action of the driver is not correct A Check if connect into isolation layer or not If set into isolation layer the connection is vain actually Q Why the action of dial switch is not correct A Check the dial switch if dial to the designated position Hangzhou AutomaticAge Co Ltd Http www AgeMotion com 53 ERE AgeMotion AgeMotion Datashe
58. network 10 100Mbps self adapt Windows98 2000 SP4 XP Microsoft had provided the service package for Windows98 no longer it also will stop to provide the service package for Windows2000 after providing the last service package in the near future so please use this software under WindowsXP SP2 NOR Ne 2 3 Install and Startup 2 3 1 Install 1 Insert the CD the operating system will run the setup exe automatically finish installation quickly according to the guide of the process 2 Ifit didn t install automatically run the setup exe on the CD and install according to the guide of process When install the software the user input the software serial or use the default The software serial decide the type of software Differtent type of software function is different also The main differences along the types are control of task property The defalult installation type is no authority as a dome usage 3 Set the ethernet network after the software installation Please set the TCP IP Address as this style 10 10 10 XX the XX must be a number between 2 to 254 the code of Subnet Mask should be 255 255 255 0 press OK and exit Then finish the setting Windows2000 XP should not restart but Windows98 need Where to set XP operating system network neighborhood gt property gt local link gt property Internet protocol TCP IP property Hangzhou AutomaticAge Co Ltd Http www AgeMotion com 3 ERE AgeMotion AgeMotion Dat
59. o Current Machine Figure 2 35 Add Task Full screen ruler and aid line are some assistant option to graph display Among current layer to current machine all layers to current machine current layer to specified machine all layers to specified machine current layer to all machines and all layers to all machines choose one to meet the real require click 1t and pop a mission manage dialog box Connect to Current Machine or Cancel Connect Choose the Task Manage option in menu or click E on Tool bar a mission manage dialog will pop if add a new mission successfully 3 Set parameters in mission manage dialog box see mission setting and parameters setting 4 Choose Start in Machine menu or click gt button on Tool bar or click gt in mission dialog box to start the work 5 Ifnecessary click pause continue stop and stop quickly Notice l First use this software or use a new machine must add the new machine and set the parameters correct 2 Before processing make sure the machine link with computer and everything is well 3 When the work is start can t move the laser head by the key panel 24 Hangzhou AutomaticAge Co Ltd Http www AgeMotion com ERR ik AgeMotion AgeMotion Datasheet Chapter3 ANC5150 Controller 3 1 Overview ANC5150 controller is the main controller of ANC5150 laser numerical control system Its functions are Ethernet communcation fieldbus and high speed vector motion control Fig
60. off non interlace This buttom operates startup and close operations and these two operations are operated in turn The startup sequence is that water pump gas pump air refresh laser power laser high voltage the close sequence is that laser high voltage laser power water pump gas pump atr refresh If there are errors the buzzer will beep Push this button and the error will be cleared A ol VI mp Y gt gt gt A Y On the main interface these four buttons control direction of light head moving Here gt mean four direction key of up down left and right Pause Continue Push Pause Continue when machine is executing a task This action pauses the current operation and synchronously corresponding LED lighten Only push this button again the machine can resume the current operation Corresponding LED is off Manual Lasing When laser power and laser high voltage are on push manual lasing button and laser emits light rays until loosen the button Stop Anytime push stop button close all equipments and the machine stop at the current position If the machine needs to continue running after push stop button following operations should be completed push ON to clear errors first then push Pause Continue
61. oil Hangzhou AutomaticAge Co Ltd Http www AgeMotion com 99 ERE AgeMotion Datasheet AgeMotion Appendix B File Formats AgeMotion Support amf AgeMotion6 graphics file l exchange file created by AutoCAD jpe Jpeg jpg jfif Joint Photographic Experts Group Created by PhotoShop HPGL graph plotter plot file AutoCAD plot file Gerber symbol making K softwar created by CorelDRAW mainly 60 Hangzhou AutomaticAge Co Ltd Http www AgeMotion com AgeMotion Datasheet Appendix C Meausrement Units Units in this manual AgeMotion6 and the control system show as follow A FS SD Sa ss A Al Ad VD Ln DR OC m meter mm millimeter Inch inch 1 Inch 25 4mm Hz hertz DPI dot per inch create PLT files according 1016DPI S second min minute h hour bps bits per second BPS Bytes per second D degree Rad radian 1 Rad 180 a D MIPS million Instructions Per Second m S meters per second unit for velocity m S meters per square second unit for acceleration Hangzhou AutomaticAge Co Ltd Http www AgeMotion com Ria AgeMotion 61
62. ormally drive system whether loose Normally the control system appears cutting unsmooth Check the laser path if loose the motor if has abnormal sound and whether the drive system loose Normally the machine appears cutting depth different Check whether the rate 1s too fast or Intensity of laser Is so weakly Normally the machine appears pause and close the laser Check whether cooling water is working normally output of switch for turn off water is right Suggest that repair the waterway after shut off machine 5 minutes The position of matchine has lighted limit switch but the machine 19 moving in the same orientation Check the limit switch and tts connetion Error occur in motion orientation on X Y axis Check the connection of singal DIR on the motor driver 1f connection is right then exchange one phase connection of phases A B Motion equipments of light head are out of control and make a screech The motor was out of step please push the stop immediately and the other steps refer the chapter of keyboard The reason of lose control of motion are as follows speed is too fast acceleration 1s too fast drive current is too little instantaneous invertion phase move when keyboard operating drive system is loose resistance on guide rail is too strong Motion equipments of light head are wobbling at intact place Motor is lacking phase please check the connection of motor Motor appears that motion speed is not normal
63. orrect machine click SS button on the Tool bar to link the computer to the machine it may be unsuccessful when the network is busy please try it again how to set and check the network see the information in chapter 10 Click button on Tool bar a machine control dialog box pop press the button to run machine click the direction buttons to test the machine is running well or not first If the machine runs well move the laser head to the start position Input the start point to and edit control box click the button on right the laser head will move to the point defined ANP4149 hand panel is used to control the machine and appoint the position also Press the Wat Ref Gas pump Las land LHV buttons click the Men button to check the laser power 1s running well or not Choose the option in menu or click 2 button on Tool bar to open a file to process in this instance open the file 1184 pie Click the mouse right button in the view choose the current layer to current machine option in the pop menu to add a new mission see Figure 6 22 1f the graph file has many layers please choose the all layers to current machine option to add all the missions Hangzhou AutomaticAge Co Ltd Http www AgeMotion com 39 ERE AgeMotion AgeMotion Datasheet A o ME E 0 902701 Sele File Edit Image Layer Dray Tools Machine View Window Help 5 x e 2 a a a oE speal AA SEke jera S rU S v Full Screen w Ruler w wid Line
64. ow shows one or more times as Reply from 168 168 186 165 bytes 32 timetims TIL 128 means the network is no problem When the computer ping the machine the ANC5150 Ethernet LED TX RX Is bright If the TX RX LED isn t light the network link is fail the cause is one among these the reticle is broken A B reticle is wrong machine stopped because of failure It can work in gear after reposition the wrong setting of the network Open the squarel00 plt file from Program AutomaticAge AgeMotion6 Examples The path of this software installed click mouse right button in the view and select the option current layer to current machine in the pop menu to add the current layer to missions Have to do this work before processing tee The layer had added is list in the combo box choose the layer to process form this combo box Likes the Figure 2 21 shows Hangzhou AutomaticAge Co Ltd Http www AgeMotion com ERE AgeMotion Datasheet AgeMotion AS O IN C Erogram Filesv utomatichgevkzelmotion6s Mala 4 File Edit Image Layer Draw Tools Machine View Window Help A x TYTN Pan AA g E em KT ROA SE Squarel00_ vi sz aa H Full Screen Fol er Aid Line Image Flip Horizontal Image Flip Vertical Current Layer to Current Machine All Layer to Current Machine Current Layer to All Machine All Layer to All Machine Connect to Current Machine Cancel Connect Press Fl tor help Figur
65. ows Guarantee period The product guarantee period is that 36 months after purchase or 40 months after manufacture Either period exceeded the product guarantee period is considered exceeded But if occur following conditions the buyer should pay for repairment even in guarantee period 1 Because operate without according to the user manual the system occurs fault Rebuilding and repairing improperly No guarantee voucher label Using beyond standard specifications Break or destroy in traffic after purchase Earthquake fire windstorm lightning strike abnormal voltage others visitations of Providence and conic disasters 7 Disassembling the system without permission oe IS Service 1 When the using status isn t well check first then read the manual and remove trouble 2 Please contact the distribution when appear trouble 3 Disposals in guarantee period If the cause of fault is our company manufacture we will only repair this system freely If trouble causes other accidents and makes system rejected or casualties we are only responsible for the guarantee and compensate of the system 4 Exceeded the guarantee period we are not responsible for the product at all and the customer should pay for repairment 5 AgeMotion6 the numerical control software does t belong to ALC numerical control system saled AgeMotion6 is an independent numerical control software product Users will freely get a suit of AgeMotion6 for commo
66. r Maybe there will be an edit dialog box information dialog box layer dialog box and machine manage dialog box in the window area To maximize minimize and move the graph in the view please press the button for maximize minimize and move EA 1f the mouse used has three keys also can maximize and minimize graphs by the middle key s kzgelmNotion E A 0 884167 P File Edit Image Layer Draw Tools Machine View Window Help a lx amp Ba 3 lt ca 7 E he SE z G p i nn a Press Fl for help Figure 2 3 Open a File Hangzhou AutomaticAge Co Ltd Hittp www AgeMotion com AgeMotion K ih AgeMotion Datasheet 2 4 2 Menu Bar The software menus contain the begin menu before opening a file see Figure 2 4 and the second menu after opening a file see Figure 2 5 File Tools Machine View Help Figure 2 4 Begin menu The begin menu is the menu when didn t open any file adjust some simple setting of the window to meet requires Otherwise adjust these settings after opening a file these two ways bring the same effect Choose the file which to be opened in the file open dialog after choose the option File Open or open the file opened recently as well as the fille menu shows 16 files that you opened recently Otherwise double clicking the left mouse button in the view also can open the file open dialog if haven t any file opened File Edit Image Layer Draw Tools Machine View Window Help Figure 2 5 Second Menu The
67. rameters custom or adopt the default values X Step and Y Step X coordinate step distance and Y coordinate step distance These values mean the distance that machine move for one step in fact they are defined on base of the practical condition Get these values through adjusting if having no idea of the machine s step distance exactly How to set the machine s step distance please see the machine s step distance setting paragraph Pad velocity and Pad acceleration ConnectTo display the absolute path of currenet file 2 5 2 Machine s Step Distance Setting l 14 Input values near the right values in the X coordinate distance and Y coordinate step distance edit box as X1 Y1 for example 0 2 0 2 click the second button on the bottom of the management dialog box to link the machine Make sure the electrical source 1s turned on The other way click OK and cancel the dialog press the link button on the Tool bar or select the Connect loption In the menu to link the machine when connecting with the machine the Status bar will show the current state If the software can t connect with machine and the password is not out of date please make sure the computer is link with the network run the command ping 10 10 10 xx t to check the computer is linked to the network if the machine s address is 10 10 10 105 please input 10 10 10 105 t click OK and run keep to ping for one minute succeed as long as one time wind
68. s the Figure 6 39 shows Hangzhou AutomaticAge Co Ltd Http www AgeMotion com 47 ER AgeMotion 48 Close ALL Save Fo jew Window Help Save B Save ALL Import Export Open Workspace Save Workspace Save Workspace As Close Workspace Print Setup Print Preview U cy Print Ctrl P 5 Send Email Property 1 C Program Files 121681 plt 2 Test0000 plt 3 C Program Files YKE plt 4 C Program Files 1214682 plt 5 Testb0D0 plt 8 Test0001 plt Figure 6 38 Import a File Layer Draw Tools aE View Window Help Open File 100 Os Figure 6 39 Complex Hangzhou AutomaticAge Co Ltd Http www AgeMotion com AgeMotion Datasheet ERE AgeMotion Datasheet AgeMotion 3 Save file choose the option in the menu decide the path where the complex is saved save the result file 4 Open the dxf file that saved previously the image in this file is a complex that contains the images in DL FA E 1 plt and 7 2 plf it can instead of those files in the future De LL H 46 1 Hangzhou AutomaticAge Co Ltd Http www AgeMotion com 49 ERE AgeMotion 10 11 12 13 14 15 16 50 AgeMotion Datasheet Chapter7 Troubleshooting Normally the control system appears the depth of laser processed uneven Check the laser path if deflected the mirror of laser whether clean air refresh and gas pump whether working n
69. some hubs array sequences of signal in order to synchronous data communication on all ports 4 Network interface card Network interface card is also named as NIC It is a adapter installed in computer It offers connection point to network Every NIC design is for a special network such as ethernet networks token ring networks FDDI ARCNENT They operate on physical layer of OSI and offer a connection point to a given cable such as coaxial line twisted pair line and optical fiber cable Wireless network NIC communicate with a Hangzhou AutomaticAge Co Ltd Http www AgeMotion com 55 ERE AgeMotion 96 AgeMotion Datasheet base station by antenna Broad band Broad Band is also named as bandwidth It means information quenlity can be transferred in a certain time It is carrying data ability in transfer channel In digital equipments Broad Band is expressed by bps 1 0 Bits Per Second In analog equipments Broad Band is expressed by transfer cycles per second or Hertz Hz Broad Band is import for Basic Input Output System BIOS For example fast disk storage drive will be blocked by a low bandwidth bus Hangzhou AutomaticAge Co Ltd Http www AgeMotion com ERE AgeMotion Datasheet AgeMotion Chapter11 Support 11 1 Service Thank you for purchasing our numerical control system Our products stick labels of guarantee voucher Don t tear 1t up The specifications about guarantee period and after sale service are as foll
70. t is mm s or Inch s the max value is 1000mm s Spare A it is the differential coefficient of the Leisure speed its unit is mm s or Inch s the max acceleration is Hangzhou AutomaticAge Co Ltd Http www AgeMotion com 21 ERE AgeMotion AgeMotion Datasheet 5000m s Current precent of laser current a number between 0 and 100 Intensity the intensity of the laser is a number between 0 and 100000 Scan Buf increase the extra scanning cushion width when Sculpturing Scan Step the distance between two lines when doing the line scan the range is 0 001 500mm the default value 1s 0 1mm Clr Comp through the compensation it can clear up the margin sawtooth caused by the strap s interspace but the machine will not add the extra distance so it don t affect the working time The value can be adjusted from 1mm to 1mm it doesn t compensate when this value is 0 or it scan In one direction This value is set to be 0 or greater than 0 the type value is 0 2mm Positive this option is effective when the working mode is Sculpturing it is negative Sculpturing when this option isn t checked Unid Scan it means the laser is output In a direction only when working it can clear up the margin sawtooth caused by the strap s interspace in this way so that it will improve the product s quality It Scan in both direction when it isn t checked Work mode there are cut cut the frame cut and cut the frame sculpture a
71. tal A Array n Offset First Task rea Left Fight Width k Scale Poz Mode Work Y Work A Current Intensity Scan Step Clr Comp fork Mode Figure 6 37 Task Dialog i Scul BL l ERA AgeMotion Valid Jato s Page Sure One Sure F Y Offset A aieo s v One Sure top Bottom ei ht r Scale AY Scale Spare Y 100 mm s Spare 1000 mms 2 Sean Buf OS Positive F Uri d Scan Work Para 9 Click button two dialogs will pop one is affirm mission group dialog see Figure 6 20 the other is affirm mission dialog see Figure 6 21 click contine button in all of them to contine the work The task sculpture the backlight lines only not sculpture the outline 10 Start processing machine s laser head will return the start point when the task is finished If there is no mission please click button to disconnect the computer with machine 6 7 Combine Files The software s greatest property is combining several graph files to one graph file in this instance the task 1s combining two plt type files to a dxf type file and steps are following 1 Run the programme AgeMotion6 choose the option in the menu or click 2 button on the Tool bar to open the first plt file to be combined in this instance open the file Z 1 plf 2 Choose the options in the menu see Figure 6 38 import the second plt file 7 3 2 plt to combine with the first file the complex like
72. tasheet ERE AgeMotion 6 2 Cut Organic Glass Complex 1 Instance s task cut the graph by outline need to set the array contains mission s array setting and mission group s array setting the material is organic The steps are following I Make sure the connection is correct trun on the power run the programme AgeMotion6 on the computer s desktop choose the correct machine click e button on the Tool bar to link the computer to the machine 1t may be unsuccessful when the network is busy please try it again how to set and check the network see the information in chapter 10 Click button on Tool bar a machine control dialog box pop press the button to run machine click the direction buttons to test the machine is running well or not first If the machine runs well move the laser head to the start position Input the start point to and edit control box click the Set button on right the laser head will move to the point defined ANP4149 hand panel is used to control the machine and appoint the position also Press the Wat Refl Gas pump Las and LHV buttons click the Men button to check the laser power is running well or not Choose the option in menu or click 2 button on Tool bar to open a file to process in this instance open the file 74 2 plt Click the mouse right button in the view choose the current layer to current machine option in the pop menu to add a new mission if the graph file has m
73. tch whether works normally or not When the machine is processing the task don t alter the parameters of operation optionally Avoid using this system when thunder storm For the control system will emanate heat keep the entironment of operation ventilative for heat of emission The control system should not be affected with damp and don t operate when hands are wettest If detect the control system is abnormal please push stop button to stop the system and turn off the power The terminals of control system are electriferous even in stop state when the system turns on power so you cann t touch them Please don t use turn on and off the main power to run and stop the control system The temperature of controller and drivers are high sometime so don t touch them Please confirm the running capabilities of stepping motors and mechanical equipments when alter settings Maintenance check and components replacing should be responsible by the appointed professional Please take down metallic material such as watch and ring and use insulating tools This product should be disposed as industry disposal when rejected Forbid rebuilding the control system The controller and drivers should be installed vertically Don t install them conversely or leanly and fix them on firm devices using bolts The workmen cann t leave the working place when the system 1s working Please confirm the system time of your computer is precise befor
74. ter be laser head then the machine will start at the point of Hangzhou AutomaticAge Co Ltd Http www AgeMotion com 31 ERE AgeMotion AgeMotion Datasheet current laser head at Other parameters are default Final dialog likes the Figure 6 3 shows Machine Ta 11T e E AgeZ006 Task Team Set TF 2 Hame Valid Wai fos Total Page Sure W One Sure thee qe X Offset YOffset Dn Task Set Valid Mfaitl0s Fage Sure One DUE Y Array A Offset Y Offset Left Top Right Botton Width ei ght z Seale v Seale Pos Mode H T Scale fork V Spare V 100 mm s fork A pd Current Scan But Om Intensity scan Step Positive 4 Clr Comp Om Una d Sean Work Para Figure 6 3 Set Task Parameters 9 Click button two dialogs will pop one is task team sure dialog see Figure 6 4 the other is task sure dialog see Figure 6 5 click contine button in all of them to contine the work Task Team Sure x Task Sure Task Team Task Name Age2006 Name x oe Total Total 1 Finished Finished 1 1 1 Y Array Fos 1 Y Array Pos Wait Time D Wait Time Figure 6 4 Task Team Sure Figure6 5 Task Sure 10 Start processing machine s laser head will return the start point when the task is finished If there is no mission t Array Pos X Array Pas L please click button to disconnect the computer with machine 32 Hangzhou AutomaticAge Co Ltd Http www AgeMotion com AgeMotion Da
75. the Tool bar a mission manage dialog box will pop likes the Figure 2 25 shows When add a new mission this dialog pop also 18 Hangzhou AutomaticAge Co Ltd Http www AgeMotion com ERR ik AgeMotion Datasheet AgeMotion Bachine Age 006 Task Age2DD6 Task Team Set Square100 Valid fait s Total Page Sure W One Sure L Array T Array X Offset Y Dffset Om Task Set Hame Valid M tait0s Total Page Sure One Sure Array Y Array x Offset Y Offset Left Top Right Bottom Width Height 3 Scale I Scale Pos Mode Laser Fos Het Scale fork Y Spare Y fork A uy Current Scan But Om Intensity scan Step Positive 4 Clr Comp Om Un d Scan Work Para Work Mode Figure 2 25 Task Dialog In the mission list list all the missions of current machine the work start from the top mission to the bottom mission in turn The task can be deleted Choose the layer and click mouse right button likes the Figure 2 26 shows Click Delete then the task 1s deleted Manage Task Show Agez006 Task Team Set Delete A Array a Uffset Figure 2 26 Delete Task 2 6 1 Select Task To set the parameters of one mission make sure the mission is selected select the mission in the left mission list then all the parameters shown are about the current mission Likes the Figure 2 25 shows 2 6 2 Set First Task Area Set workpiece position and size Hangzhou AutomaticAge Co Ltd Http
76. this mission Wait Wait time before task begin see Figure 2 30 The unit is second Total the count shoud be processed Page Sure If check this option a affirm dialog box will pop before processing must click the continue button to go on see Figure 2 31 if this option is not checked the machine will perform the programme automatically without the affirm dialog box Task Set 1 vana tats Total 1 Page Sure line Sure A Array L Array 1 X Offset Y Offset Figure 2 30 Set Task 2 20 Hangzhou AutomaticAge Co Ltd Http www AgeMotion com Ria AgeMotion Datasheet AgeMotion Task Sure Task Hame gt duar el UU rb y A Array Pos Figure 2 31 Task Sure 1 1 1 1 One Sure in the array working a mission contains several piece 1f check this option affirm by yourself to continue the work after one piece is finished If don t check the option the system will finish all the missions automatically without affirm dialog X Array the count in X coordinate direction Y Array the count in Y coordinate direction X Offset space between two piece in X coordinate direction contain the workpiece width Y Offset space between two piece in Y coordinate direction contain the workpiece height 2 6 4 Set Task Group Task Team pet Hame Valid V tait 0 s Total Page Sure W One Sure A Array Y Array a Offset Y Offset Figure 2 32 Set Task Team Name shows the current machine s name
77. umber and depth of the ranks The number is from 0 to a number defined depth is the number that Sculpturing can reach It can be modified on the right to one rank Steps the series of sculpturing the slope is a number between 3 and 30 it is one greater than the largest rank ID Width the width of every ranks there are four choice in the combo box 0 025mm 0 05mm 0 075mm 0 1mm ID shows the current rank s ID Depth the current rank s depth value s rang is from 0 to 1mm Auto gradient interpolation software computes every rank s depth according interpolation Default generate the every rank s depth on base of the largest depth 1mm and the largest rank number the increase depth by one rank is the quotient of 1mm divides the largest rank number Modify a depth by self choose the rank in the left list to modify the rank number will show on right modify the depth and click another rank then the depth 1s modified succeed 2 6 8 Process Steps Process steps Hangzhou AutomaticAge Co Ltd Http www AgeMotion com 23 ERE AgeMotion AgeMotion Datasheet l Open a graph file to process 2 The graph shows in the view click mouse right button in the graph to add mission likes the Figure 2 35 shows Full Screen w Ruler w Ald Line Image Flip Horizontal Image Flip Vertical Current Layer to Current Machine All Layer to Current Machine Current Layer to All Machine All Layer to All Machine Connect t
78. upassqussasuupassqusaqssussucumasussuwsnauayaspana 25 Dc MINS iki u eo E ER O E E 25 Chapter ANP4149 Hind Paneles nati iited 26 jJ CMU CUMING nus A RE A PM O S SS 26 4 2 Keyboard Fonction Descriptions et 26 Ao Menu Mae te AC SAIN ACOSO 27 4 4 Main Interlace OPEN tati Ra 27 4 Norma lea O x xu u us u sss 29 eo u ou s uu o us S nun u ua nasi 29 Chapters ANC5150 Technical Specification 30 dl System CONE nani ii 30 ZE e O nus s usa am uma ua na nunana s Su 30 R TO C ToS TT es sgh sce cecventassevsecececsscsnsauvececucsscascssucesctsntess suguvsdetucessatssseeesessavevadseseversesascestesteeseunees 31 WO Oresnie Glass cy VN T 31 0 2 C utOroanie Glass Complex Larson ancora 33 Hangzhou AutomaticAge Co Ltd Http www AgeMotion com ERE AgeMotion Datasheet AgeMotion O Cu cere ay Coxe OMS td 35 G CI ADCP asus e PE uu ue o s unun 37 os i gt i uu uuu a 39 Ads dd 9 T ip uuu l a unuy ayama uya EEEE EEE OTE a qqikas 41 O RS T RTT 47 Chapter io y l 1 PAP r TONE Ene TOKKE NaN OKAN eenias aia 50 Chapters NOCE eras 52 Clip P 0 anio u u E os 53 Chapteri0 AA o II savepseerucaderssiecesectesenses 55 In e O O CR PE E RE E s 55 CA a TEE ms mamana anus ns 55 IA TP PEE E OE ui uama A 55 10 2 Network Connections Detection sesion ice 55 GD A eq s u u u S s wee 55 Clip IL Suppl u u a y 5 u u sss 57 IRH l aa usuyasa n A 57 n E T A E E E O A AT 57
79. ure3 1 shows the outline of ANC5150 controller EJE R ANDAR AgeMotion Hangzhou AutomaticAge Co Ltd e ee e q P ANC5 1508 II l 88 www AutomaticAge com SN AALOAOAOEB4 MUST E 180 Aja rumanas ast m iwajanm KF RH m ome minmn stmt Figure3 1 ANC5150 Controller 3 2 Operating Environment Suggests power MEAN WELL 12V1A 5V4A DC Switching Power Supply MEAN WELL 48V 7 3A DC Switching Power Supply Supports laser power supply of 5V interface 220V AC power supplys power for the control system after power filtering module AHD401 AHD80X or other motor drivers affirmed There are no special requests about connection between control system and laser power supply Try to use the powers we suggested and avoid halt restart and out of step In low speed machines stepping motor can be supplyed by 24V DC switching power supply 3 3 Instructions ANP4149 is the special control panel of the numerical control laser system It can fix on machines or operate manually It has functions of LCD Chinese denotion and keyboard input The maximal operation distance is up to 40m Please use standard cables of control system possibly Hangzhou AutomaticAge Co Ltd Http www AgeMotion com ERE AgeMotion AgeMotion Datasheet Chapter4 ANP4149 Hand Panel 4 1 Outline Figure4 1 shows the outline of ANP4149 hand panel PWR TXD RXD ERR o 0 0 LEMAIRE TRATARA ERRA R
80. w leds x l m E e nn E Senki vis s IEA Press Fl for help Figure 6 34 Fill backlight Result Hangzhou AutomaticAge Co Ltd Http www AgeMotion com Help x o 45 ERE AgeMotion AgeMotion Datasheet File HAREKI Solid Default Solid detal Figure 6 35 Layer Manage 6 Set the Fill Area 1 as the current layer Such as Figure 6 35 show select Fill Area 1 or select it in layer manage list Click the mouse right button in the view choose the current layer to current machine option in the pop menu to add a new task see Figure 6 36 File Edit Image Layer Draw Tools Machine View Window Help GE ASE ye Male Ia v Z lt ANETO Full Screen w Ruler w hid Line Image Flip Horizontal Image Flip Vertical Current Layer to Current Machine All Layer to Current Machine Current Layer to AL Machine All Layer to All Machine Commect to Current Machine Cancel Connect Press Fl for help Figure 6 36 Add Task 7 Set the parameters in the mission manage dialog box Choose the Sculpture Backlight Line work mode combo box choose Sculpture Backlight Line in the work parameters configure combo box the software will set all the parameters automatically likes the Figure 6 37 shows 46 Hangzhou AutomaticAge Co Ltd Http www AgeMotion com AgeMotion Datasheet Bachine Agez006 Task Age OUB Task Team Set El Total A Array A Offset Task Set Hame To
81. w Close Close All Previous ant Case ade Tile Horizontallay LT Tile Vertically Arrange cons 1 Hone plt m 0 809825 Figure 2 16 Window Menu Please choose the sub menu to manage the machine see Figure 2 17 the operations have add a new machine set the machine s parameters start machine begin to process and check the log Hangzhou AutomaticAge Co Ltd Http www AgeMotion com 11 dl AgeMotion Datasheet AgeMotion X Aut REA ai 1 IEA View Window Help F Machine Manage E Machine Control ET Task Manage El Machine Logz Current Machine Age2006 3P Connect Break c Preview Start Figure 2 17 Machine Menu menu provide some types of graph to drawing such as trail polyline polygon rectangle circle and so on Align is to align the graphs selected by one form Fill is to fill the graph selected by backlight line the detail refer to chapter6 E Tools Machine Kiew Wind View Window Help Polyline Polygon Rectangle Center Radius Circle rc Center Di ameter Ellipse Diameter Points Ellipse Are Point Center Figure 2 18 Draw Menu In the menu there is some information about this software and two language choices one is English the other one is Chinese Simplified the hints will shows in which language selected If you want to change the language you should select the language and close the software Then open the software again Thus the language ch

AgeMotion Datasheet V20121202

Contents

Download Pdf Manuals

Related Search

Related Contents