Home

1 - Tulloch Farm Machines

1. WWW GOL 069 290 02 H x x i x WW Sg WU Dp WWW GZ lt H IS eg uman a
2. ainsseid Bulleq ZZA Npe v eyg Ae p9 v zrg SAS g Lg ACEP g OVE 9q ONS mnpou CCP ONS ampow Ge ONS mnpou ZOE OWN lnpou ZOE ONS lnpou L WOYLS 9 O I LION O I ILINW O I LL OUYsADIC O I OL OYSADIG O I vl PX uono uuoo oZz CN luomno uuoo ez ex luomo uuoo 9 LX uolo uuoo QOL LX luono uuoo I CV i CV I CV i v I v r ine 977 ET 9 KR 9 Ir qvx qex qex qx q x n LEX AN LEX d NEES Al LLX I I I I Ple x L e X P el x e X sS z Vi e e E e q0 x q0 x q0 X q0 x K n 8 eOLX 9 ent F eoLx 2 EOLX Z q AX z PEVaxX dacks z PLbON z P0rgX T d U d d z Z S z z eunsseijd Buljeq ANB 98 V AJMESD9 V OAI g Alpyeepy g x CCA erg cvg Ltd org L L L L U T T T T b azzax l e rgx b ezygx ble yax bl eorgx 2 A 1 COLX POLX BOLS v COLX d dr dr Ge q0 x q0 x q0 X q0 x g S g g i ees d deng Eres KS aex Haex Fous Haix eu X p T y c Ee CO Ro CO CO Q G CL bX luomo uuoo E g L VINMd O I gt gt gt gt JOE OWy mpou gt 3 z d V y y ainsseid Buileq ZZA d gt gt gt ow ow N N 8 L 9 G r C L wo us Aq Ve ulbuQ pendid afueyo JEUIWWS JOO LO LZ900LOSL Sigi
3. job computer connector X1 X2 D24 CF 155 XC CV 150 XC 03 150100369 jd D E 5 z O OKRONE 2 09 2009 lt m O CH LLI uyo 9 ZEN TL NYO 8V OL aide Bums YLA OL VIWMd 91 ZX m S ZX H L NYO ZV OL dn saquieyo ajeq 80A t VWIWMd 8L ZX LN ta S JOJOWZIONY Y YLSINMdGH L ZX FOI JOJOWZJONS YLSWMddH Zr ZX sits LF ZX siosu s Bojeue ONS YNY ONG d CV CT za eg ve X siosu s Boleue ONS YNY GND sn JNO DE ZX y BelloA Bojeue YNY AZL o f ID rg s aw 4 S 1Jo oui uonisod OHdHVNV ZZ ZX cv S ai ZZY Ca EZ ex VIL BelloA Bojeue YNY AZL oy level aera N N U0J X lt siosu s Bojeue Ajddns l Sau lqe Bums 6 9g LZ SIG O ZX oO SM 614 Z N ta 9 uonisod punoi6 gg 6 SIG ZL ZX YV JI T LE ZX L 1osu s ED LC GND od y g z _ LOL GL SM 88 2 _ 2 Te S 46u jqe uo jeq 449 84 SIG OL ZX y 9 88 SW ZL a en ex eee ae 9 LIA y jqe uo JL SIG 8 ZX V JI G LL ZX g 1osu s Eu 9 ONG lq GBALA S IL JL SM 9 8 SS G lqe ums g g 9 9lq t ZX kV Z a 6 ZX Z 1osu s e 61p AL ONE 91d S 8 _ x e DY 919 SM 9 8 E e 4 9 uolisod o18z wie Buiddeim og FL OYADIA 9 ZX cV Ia L ZX 9 Josuas jey 6I1p 9 GND OIG gd u Cu OI SE ane s Z ZX p sos
4. 28 4 6 Jil e EE 28 4 6 1 Re Ordering the Adhesive Safety and Information Labels 42 4 6 2 Affixing the Adhesive Safety and Information Labels 42 4 6 3 GOA E eane e E E ee ee eee eee 42 4 7 Se mbi E 43 b KRONE Table of Contents 4 7 1 Kate Mel 44 4 7 2 Attaching the safety Cable uuu uu uuu anadan aa niaaa kE i EE 45 4 7 3 ie P eier 45 4 7 4 Secure the machine against the possibility Of rolling back 46 4 7 5 SOO a0 PPN ISO ee ee ee ee ee 46 4 7 6 Btlateg GE 46 4 7 7 KEE 46 4 7 8 EE eegene 47 4 7 9 Lowering the Parking SUDDOM d 47 4 10 Shutoff Me for tailgate seen g eegent 48 4 7 11 Step for working on the linkage Ta a aaa 49 4 12 Rollers onthe Wrapping Table uuu u u u a ua a e 50 4 7 13 Platform on the Wrapping Table a 51 4 8 Jeng We rie GE 52 4 9 Information Required for Questions and Orders a 52 el Mt ee a aa arar rassssssrsssssassrssssssssssssasa 53 5 Bell e Le le e D 56 5 1 SOLS Till ls IT EE 57 5 2 Removing the transport holding down tensioning device 60 5 3 Changing the Drawbar Height and Adjusting the Hitch
5. 62 5 4 Saken 65 5 4 1 Length Biel Wd TE EE 65 5 4 2 Mounting the PTO shaft on the machine side 66 5 5 Hose holder assembly T aa asss rarasssssrrsssssssrssssss ssa 69 6 SL A Te E 70 6 1 Mou nting onio the r Irael0r uuu u uu uuu Su aA aAA ERA 71 6 2 wgl Uer 72 6 2 1 Special Salely INSUMUCIONS E 72 6 2 2 Connec ng th hydraulic TE 73 6 3 Hydraulic Drake e E 76 6 4 li lis PTOS Ra E 77 6 5 Compressed Air Connections for the Compressed Air Brake 79 6 6 Electrical connections EE 80 6 6 1 Connecting the terminal on tractors without ISOBUS system 81 6 6 2 Connecting the Terminal on tractors with integrated ISOBUS system 82 6 7 Jong The salet Chail uuu uu u E E clasivaao panne cetnacioned os ceacninetsceeeosconsteacme eatumaeeecst 83 6 8 Not BO O PNA E E E E E sss 85 6 9 KOPIRA ENO EE 85 6 9 1 1 Cam iype Te Engadin EE 85 c10 Wrapping e ni 86 BAT UMNE DIEC O DE 87 6 12 Startup Bale urner LL u asua aaia aaia ani anaia ashaka aa NANA NEEN EEN 88 6 13 Mounting the Stop Holding Tube aT aaa saaa rr rssssssss asa 89 6 14 Positioning the Bale Tumer a a raras rsrsssssssssssssssssssssssssse 90 6 15 Moving the Bale Turner into Working Hosmton 91 6 15 1
6. lt CO LLI c w O V VINMd S X SITES _ NCL dH SSLdO 10 1uBH alen dos ZEA VINMd Z tX cV cel g KUER REES LZ YX siosu s Bojeue ONS L YNY ONS Nm sjosues Bojeue E E VEH gaus zeg GE Se Se SE LWeL GH S149 40 U81939 dois Wek SC vull 6 tX x eo AND E YNY ONS o EL eunsseid Buileq OFA L V INAAd SL EN siosu s Boljeue Ajddns sindino m osuas IEu E bb YX OL 4osue e oF AN9 91d ee ZTNOHLST ZF bX A es Se e ONG S A Stel ainsseid Bulleq O A L WOULS 9 rL tX m JOosu s e B Es LL tX 8 a 8 qN 91A 8 SHANS EECH p oe mea Soe s s os prer GH S9149 Jo M einsseud zga Z LINN re bx Snes ene s ND ACEL OU S9149 40 4e eunsseid Log INN S rw d EC tX g Josues Ieufm Gg ONE 91A a g be i SW 9 a auer Si Ol o E x lt VV L g rs ve PN tdiosu s e 6ip FONS OIG _ e FX erg SW 2a amp e ec SL 0 6 SIG o bx CV L g Cem GZ EN 4osues IeuDmp GND SIG E f cyd SW t8 SS z _ z N _ _ V CH age Gees 9 bX zdosues IEu p Z GND OIC 8 8 SIG be tX z e IN CH at X AS tX Josuas eufp GND og ei A z 9lQ tX lt Dn Ei 9 91a o bx O N siosu s e Bip Ajddns N g _ O ei amp s 91d tX gt lt st N T vaz n v Era rt 9IA 8 EN e SW DEL e _ _ _ _ LIJ EL e Se K OL bx A ddns AZL punoi6 T ONS gt Q e CA CL AIL 8P8 V rq SId GC VX N N 9
7. m G gt CC000200 Fig 78 Note Before switching the terminal on for the first time make sure that the connections on the device are fastened right and securely By pressing and holding for approx 2 sec the key 1 lt ON OFF the terminal will be switched on or off 109 b KRONE ISOBUS Terminal KRONE ge ge 110 Note Prior to first use When switching on for the first time the configuration of the specific menu of the machine is uploaded into the terminal The loading may take a few minutes The configuration will be saved on the memory of the terminal Note For further information on the functioning of the ISOBUS terminal CCI refer to the terminal operating instructions included with delivery Betriebsanleitung Version 1 0 CC ISOBUS ISOBUS Terminal CCI 100 200 WA 4SDBLIS BPXC0317 Fig 79 e The start up screen is shown in the display after the loading process The terminal is now ready for operation e By pressing the function ke the basic screen appears C KRONE KRONE ISOBUS Terminal 8 3 Basic Screen 450 1 Bei 140 120 100 80 Ocm Fig 80 Status line I Current states of the machine depending on how it is equipped are shown in the top line of the display 111 b KRONE ISOBUS Terminal KRONE AE Alarm message is pending Blades are swivelled in Blades are not swivelled in Pre signalling set gt p
8. aaa aarssssssssssssa 186 8 17 1 Menu 7 4 2 Diagnostics Auxiliary Functions AUX7 187 odo IMC SSA au aaa saam Sasa nas 188 8 18 1 Query message for bale chamber 188 8 18 2 Query message manual operation a 188 8 18 3 Prompt message Repeat wrapping 189 SEENEN 190 655 ACUE WI I D 190 8 18 6 Note ANd messages eaaaaa ee eeaaaaeeeeeeaaaaeeeeessaaeeeeessaaeeeeeneas 191 5 87 El e CC 193 8 18 8 Physical messages a a ar aaaaasssssssssssssssssssssssssssaa 194 8 189 QGe enerallM668S8g68_ EE 196 9 SOB US OPE Gl 0 EE 197 9 1 MOUNTING SOB WS TSH Lu uu u u u uuu u 322 198 9 1 1 Connection Terminal to Tractor aaa aaa aaasssssrrrsssssssasasa 198 9 1 2 Connection Tractor to Machine a a a a aasasssrrrrrsssssssasa 198 9 2 Differing functions to KRONE ISOBUS terminal CC 199 9 3 ISOBUS Auxiliary function AIX 200 9 3 1 Example of joystick assignment for Fendt default Setting 201 9 3 2 Recommended settings for a WTK multi function lever default setting 202 10 Operation of the Hydraulic Zero Setting of Blades Optional 203
9. Sensor bale diameter left defective 110 Sensor bale diamter right defective 111 l Sensor bale chamber closed left defective 112 Sensor bale chamber closed right defective 114 Sensor bale chamber open defective 116 Sensor bale on swivel table left defective 117 Sensor bale on swivel table right defective 118 Sensor swivel table centre defective 119 Sensor swivel table front defective 120 Sensor position wrapping arm in zero position defective 121 Sensor position wrapping arm defective 194 h KRONE KRONE ISOBUS Terminal Sensor holding arm left defective Sensor holding arm right defective Sensor sheet tear monitoring defective Sensor lifter bottom defective Comprima CF 155 XC Sensor bale on lifter defective Comprima CF 155 XC Sensor wrapping arm height defective Comprima CV 210 XC 195 KRONE ISOBUS Terminal 8 18 9 General Messages No Icon FUSE A01 120 Pow A02 A03 A04 A14 196 Acoustic signal b KRONE Description Fuse 2 defective job computer Fuse 3 defective self repairing No connection to control unit EEPROM faulty Power supply too low Power supply too high Access to protected storage cell 0 Access to protected storage cells 0 b KRONE
10. 48 312 leet EE 297 Sources of danger on the machine 22 S sal s S PIO s P eee 275 Starting the machine Safely 27 SEGT e ME 70 Start up bale turner 88 Status messages 148 Step for working on the linkage 49 Stop e 46 Stopping and securing the machine 25 EE 256 Structural changes to the machine 15 Supporting lifted machine and machine parts See UE 25 Switch to different terminal 185 Switching on off wrapping am 154 Switching the terminal on off when the machine IS connected 109 Switching the terminal on off when the machine IS NOt connected 108 T JEE 288 Target group of this document 11 Technical data 53 Technician 179 Tensioning the Drive Chains 304 Tensioning the floor conveyor 220 Tightening torques 286 Tightening torques countersunk screws 287 Torn sheet control 140 Total Dale coumter 1 145 alle Gi uu nunus Sus 20 Travelling speed 212 Tying and depositin
11. ea e L OWN enpow od O I v2 LX uono uuoo l V TAM w a zi e L gx 2 y pesojo Jequieyo ajeq Lg A I L e gx w x 2 gt gt SC gt N uo J us UOl eDO jue d L J O0IM R SJOSUSS LO YX OZ AD tza ybu wue Bunioddns zg OO L OWN lnpouu G OYSHDIG O I Z ZX UO ec A CM LE qzx 3o ezg SM 2a OW t i oy za Z Pecax WD LUEIIELIS ecg L egzgx A0 deu uiuo p A01d ueyo ye wue Bunuioddns zzg 9d e L OWJ ampow 8 DYADIC O I eg zx J uono uuooS L EM LI qzx 39 29 ezccgx Yd WJes eH 9 ccad N N L ezzgx SIE WW t aX zza LZ900LOSL OU JUSWINIOP si qlv Joen LLO SOE aen p le io IUOIL aide Bums 649 lpp uu age Bums g g ZOE L OWN einpow OO L OWM einpow kz SIG O I 94 od O I og zx Juono uuooS r ZX UOl O UUOD L EM DI qzx 39 619 e6 gX i 100 H N GL d eniee SW EIS WW t a xr 61d jqe Bus I EM H qzx 39 819 e8Lax l SIDD N 81g d eg gx SI 9V Eiter org qe Buims 1uBli l qe1 Bu ms dn jeq g 9q e L OWN mpou 9 Old O I DL ZX luo
12. 81 REESEN 21 C EE 42 EE 142 Coupling heads 326 Coupling the machine safely 26 Customer counter 143 Cutting length 228 Cutting system 227 D Danger zones 17 Dangers associated with certain activities Climbing up and down 23 Dangers associated with certain activities Work on the machine 23 Dangers associated with certain activities Working on wheels and tyres 24 Dangers associated with the operational environment 21 Detaching the bale cloth 219 PQA CN ter 176 Diagnostics analogue sensors 163 Diagnostics Namur sensors 162 Diagnostics Auxiliary Functions AUX 187 Differing functions to KRONE ISOBUS terminal EE E E ss s ss 199 Disconnect the supply lines 101 Disposal of the machine 347 LI WL Tua uu anasu sasa tuqay 294 Drive Chain for Pick up with Cam type Clutch 222 Drive Chain Tension Conveyor Auger Drive 308 Drive Chain Tension Front Floo
13. AaIIEU OSZ VlO 000 22 0P0 616 H OVS UEL Fig 268 348 C KRONE Appendix Tailgate Hydr blade base lowering Wrapping arm 6 Chain swivel table Valve block 8 Holding arms 9 Tilt swivel table Bale transfer 349 KRONE YO 69L OOF OSL g q0 L lt VLELC6 WU Spg ww OV LP B LLG LCG y GO 1eq SP 266 616 WW S8a WW Sy WLU Sg Y0S26Z WU Sg wu Sp WU Gg r9 009007 8p l L6 AA HA Wu 022 wu OF wu SZ YEWI GLE Od 616 WW G8 WW GZ WLW 9 DL wul EGF lee 8LA 290 616 Comprima CV 150 XC Appendix WLU 6S0 700 LZ G A ygu5 092 V10000 Z ww S9L ww OV ww Ge
14. OL X uol o uuoo 9 VINMd O I COP OW ainpow spiewuo aqehieqn ZLA TX GND tA P V Vl SM LLA N em Y Hire oOE Bums x LLA ia s n ULLAx El r qex I ev SpJem10 U9SINUSAU09S9Q COP OWY ainpow v WOYLS O I g X uono uuoo EM ke qex SW OLA N Tiet qe Bums x OLA re m q0LAX 39 014 Zei I ev v CN uol o uuoo WIWMd O I COP OWY ainpow YNINZ aide Bums LLA ZE CN uono uuoo ZL VWINMd O I COP OWyY ainpow spiewuoj aide Bums OLA u SOA EI SM 8A SN q804X z dn J qwey jeq X 804 el q804X 39 84 I ey x OND a V Yl SM LA SN QZOAX pasojo N Jaqueyo jeq Z0 ei l q 0AX 20114 9 qex l ey 9 ZX uono uuoo 9 CN luono uuoo P WIWMd O I ZO OW ainpow ZC vi O I FOE OWN lnpou dn 1 quieu2 eq 80A p so o Jaquieyo sjeq JOA WO LL oa uolneoo yuejd we Bunsoddns sane q dey p A01d KO X OSL AD 9X SSL AD ved DOC DO LOGL OU JU uInoop oer GND ZA P V N SW LIA SN qZ LAX L aso
15. Transfer wrapper mode Manual with wrapping Transfer wrapper mode Automatic with wrapping Transfer wrapper mode Manual without wrapping Transfer wrapper mode Automatic without wrapping Transfer wrapper mode Manual with wrapping Selection set down mode Automatic or set down mode Automatic without wrapping double leading Sa Number of sheets winds not to standard 112 KRONE KRONE ISOBUS Terminal y 1 4 0711 400 80 I cn C CG000250 Fig 81 of the symbols Il for the function keys F1 to F6 The transfer and if required the wrapping A dt Start transfer wrapper mode process are started if the function key is Z OO activated The depositing of the bale is started Start setting down bales manually if the function key is activated Pre select pick up valve The activated setting is shown lt Pre select valvecutter base adjustment l By actuating the function key the menu level ENEE of the machine will be called Sn Start continue wrapping The wrapping process start is continued process when the function key is activated 113 KRONE ISOBUS Terminal KRONE Description of the symbols Il for the function keys F7 to F12 Tying mode manual triggering net Tying mode automatic triggering net The main menu manual operation is active Manual operation when the function key is activated The menu 2 1 Custo
16. qAEXL CNL AX p I L eeXl ZX AX S D m S a lt 39 IS SA z TEX og TEX d L ge CH e CN G Le i ey i ey ey ey i ey Z CN uolmo uuoo of X luomo uuoo Ov LX luono uuoo Z LN uo mo uuoo 9 LX lJuono uuoo Z YINMd O I LL WIWMd O I L WIWMd O I 8 Vid O I L vi O I CO EI OW 1 einpow d b OWN amnpow gq e OW lnpou PO EI OWN lnpoui PO EI OIM lnpoui we Bulddeim A 8A uoneinBa 90 A UOUEIDOUD YOOIG GOA L uonounj POA y pejq LZA lu unsn pe punolb A g apeiq OZA dn s9 d LA 8 9 G r C L WO OL 99uS uol eo5o yuejd Z sio en oe q dey D A01d KO X OSL AD 9X SS L AD ved DOC DO LOGL OU JUSWUNDOP si q v Joen DO GO aen paea JUL VLA v SM PLA WAX qe Bums x YLA s TA qdr LAX SIE S I ey gt i oo Gi J gt Kai oo SM ELA Qe LAX 2 syonunzg qe6i q 19 x ELA SN L L qE LAX J9 14 ei I ey OL ZX uono uuoo OL VIWMd O I ZO COIN amnpow uleyo aide Bums YLA ZL X uolo uuoo 6 VINA id O I OR ONA ainpow yonunzg aqebieqn L A EX GND ZA P ZV FI SM ZLA E QZLAX t spemo N Y qe6i q 19 CLA U qZ LAX SIDD any I ev
17. Always get on and off with the face towards the machine e When getting on and off ensure three point contact with steps and handrails both hands and one foot are in contact with the machine or both foots and one hand e When getting on and off the machine never use control elements as a handle An accidental activation of control elements may cause functions to be activated unintentionally This holds a danger e When getting off the machine never jump Fig 20 There is a ladder 1 with handrail 2 on the right hand side of the machine next to the wrapping table This ladder can be used to perform maintenance work in the bale chamber WARNING Risk of injury in case of falling down from the ladder Falling from the ladder may cause injuries Always use handrail when climbing or descending e Do not climb up or down the ladder while the vehicle is moving 51 Safety 4 8 4 9 52 Ia KRONE Identification Plate KRONE Maschinenfabrik Bernard Krone GmbH Heinrich Krone Str 10 D 48480 Spelle C Typ Fahrzeugident Nr Bj Made in Zul Gesamtgew kg wA wi Germany Zul Suite vom Ju KR004020 Fig 21 The machine data are located on the type plate 1 which is located on the right hand side of the machine below the twine box Information Required for Questions and Orders Tye o Year of manufacture
18. Fig 10 Note Check the safety equipment for functionality prior to every start up Note If an alarm message Is displayed on the terminal when testing the function of the safety equipment the function is provided If an alarm message is not displayed check and repair the safety equipment Before starting up the machine check that the safety equipment of the bale wrapper functions Switch on the terminal e Press the quick stop switch 1 and check whether an alarm message Is displayed on the terminal Acknowledge the error on the terminal e Press the right bracket 2 and check whether an alarm message is displayed on the terminal Acknowledge the error on the terminal Press the left bracket 2 and check whether an alarm message is displayed on the terminal Acknowledge the error on the terminal Alarm messages see Section KRONE ISOBUS Terminal 43 Safety 4 7 1 44 b KRONE Parking brake Optional WARNING Unexpected movement of the machine The machine may move unintentionally if the parking brake is not activated when parking the machine Thus there is a risk of serious injuries or death e Always apply the parking brake when the tractor is left or the machine is switched off The parking brake 1 is located on the front side of the machine on the drawbar COM00362 Fig 11 a Parking brake applied b Parking brake released The parking brake is used to secure the machin
19. REH p e O LV C g wey I THU cv e Be ASSS Zy e a U k 1 NYO eve XI Wiel ONG GILXL L H NYO Li bel si el gf tb SX ZF it l pE cl cf gf eLGx am e 2 m 2 5 REES Fe 49S re 2b slala sl pl el zl Ss KA k Ve v K T T T l T T T T Te Tee Te Lott LEE Tee Ten Tee Te Te Te Le Tee Tu Te Te Te Te Tee fu gt Lef Lal Qo Qo Qo 7 bal A TER LEF E s 1 eOOSsest 9 29 2 8 det pews EE R P Ee eee GENEE kz ve 3 o Ei o Q Q F LUQO l LG DD Oo OO N N N 3 gt gt gt P Wp 3 I gt S N 3 I T r gt lt N E E E D D D E Sogn 5 DS E SS e Ir S 8 S EE eo s 8 a S E 3 3 5 55 sS 53975 kei ve ve ve gt o gt o lt lt lt lt lt lt lt z Deeg Wm I sae Se NI Ino NI Puya NIT NYM ZEzSU ZEzSU ees PIA Z NVO L NVO L NVO if N er N of s bine L L Sec OS K ee 30 EE EE Ges we r Ded v re Ee go 2 O8b x Org 141 78 OOL IOO Ieutuue snq OSI G location
20. Connect plug 6 7 pole of cable set 5 with socket 7 7 pole of the machine e Connect connector plug 4 article no 00 302 300 0 included in scope of delivery with socket 3 CAN1 OUT of the terminal Connection tractor to machine Note The connection of tractor to machine takes place via a provided power cable 8 article no 20 080 601 0 Connect plug 9 of power cable 8 with continuous current socket 10 of the tractor e Connect plug 11 2 pole of power cable 8 with socket 12 2 pole of the machine 81 Start up 6 6 2 82 KRONE Connecting the Terminal on tractors with integrated ISOBUS system Fig 48 Connection terminal to tractor Note The terminal is connected to the tractor via a special cable set 5 which can be ordered by stating the KRONE article no 20 081 223 0 e Connect plug 2 of cable set 5 with socket 1 CAN1 IN of the terminal Connect plug 4 of cable set 5 with socket 3 CAN1 out of the terminal Connect ISO plug 6 9 pole of cable set 5 with the ISO socket 7 9 pole located in the tractor cabin Connection tractor to machine Note The tractor is connected to the machine via cable set 14 which can be ordered by stating KRONE article no 20 080 384 0 e Connect ISO plug 9 9 pole of cable set 14 with the outer ISO socket 8 9 pole on tractor side Connect plug 10 7 pole of cable set 14 with socket 11
21. If the blockage is not removed due to this oN COM00364 ai r S E Wer ERY ght eS w awk ste Sos TS Sy Fine OA a eee eS ee J Ths ae ZS SE Bezierk 2 aicn gt Sa Ee CA EE Fig 208 Switch off the PTO shaft and the engine of the tractor e Remove the ignition key e Dismount baffle sheet 1 e Loosen spring cotter pin 2 and linch pin 8 right and left Dismount spring 4 e Remove baffle sheet e Remove accumulated crop manually e Fasten baffle sheet right and left with linch pin and spring cotter pin e Mount spring 4 268 b KRONE Settings 12 Settings WARNING If the basic safety instructions are not followed people may be seriously injured or killed e To avoid accidents the basic safety instructions in the chapter Safety must have been read and followed see chapter Safety Basic safety instructions WARNING If the safety routines are not adhered to people may be seriously injured or killed e To avoid accidents the safety routines in the chapter Safety must be read and followed see chapter Safety Safety routines 12 1 Setting the Net Brake Fig 209 Set dimension a to 35 mm on the eyebolt 1 and tighten the self locking nut 269 b KRONE Settings 12 1 1 Releasing the Net Brake Note When the brake moves down into the feed position it should be easy to release the brake to remove the net COM00013_1 Fig 210 Note lt
22. Menu level 2 Counters is divided into two menus O gt O O Menu 2 1 Customer counter O 2 all O O Menu 2 2 Total counters 142 h KRONE KRONE ISOBUS Terminal 8 9 1 Menu 2 1 Customer counter Ee ESC CC000219 CC000303 Fig 105 Displaying the menu Main menu 2 Counters is displayed O You can select menu 2 1 Poy pressing function key Lin O O The symbol is shown in reverse colours Press function key OK The display shows menu 2 1 Customer counter Meaning of the symbols Tene Total number of bales c active customer counter 1 20 J Operating hours counter counts only when P T O shaft is running 143 KRONE ISOBUS Terminal KRONE 144 Activating customer counters CC000303 Fig 106 e Press function key Todt to select the desired customer counter and activate by pressing the function key OK The desired customer counter in this case customer counter 1 is displayed inversely Changing the number of bales e Press function key Todt to select the desired customer counter the customer counter must not be activated e Increase the number of bales by pressing the function key lt e Reduce the number of bales by pressing the function key J Deleting the customer counter e Press function key Tot to select the desired customer counter the customer counter must not be activated e By pressing the function key Xthe selected customer
23. RP 99 019 Fig 260 Lubricate the PTO shafts at the intervals indicated in the drawing with a multi purpose grease Follow the operating instructions of the PTO shaft manufacturer Note The instructions of the manufacturer must be observed with regard to the PTO shaft separate operating instructions cO KRONE Maintenance lubrication 14 4 WALTERSCHEID cam type clutch K64 12 to K64 24 EK 64 22 to EK64 24 CAUTION If work has been performed by a specialist workshop that is not qualified the machine may be damaged A qualified specialist workshop has the necessary expertise qualification and tools for a correct execution of the required works e Always perform work by a qualified specialist workshop Fig 261 Version with 4 locking cams Version with 2 locking cams 5 Coupling housing with hub e Coupling housing A ss fa fn Spring assembly 331 Maintenance lubrication KRONE 332 Maintenance interval refer to chapter Maintenance Maintenance Table Prerequisite The machine is stopped and secured The cam type clutch is removed from the machine Decomposing cam type clutch e Prise the seal ring out of the coupling housing by using an auxiliary tool e g screwdriver e Remove retaining ring e Remove support disc and shim rings e Remove hub from coupling housing Caution Always observe the position of the bevelled edge on the locking cams when pulling out them
24. Wrapping arm not in position swivel table centred without bales Wrapping arm in position swivel table centred with bales Wrapping arm not in position swivel table forward with bales Wrapping arm in position swivel table forward with bales eiee Possible status messages window 2 net motor Tying position reached Ca Feed position reached w w Cut off position reached Positions not defined X w h KRONE KRONE ISOBUS Terminal Possible status messages window 3 bale chamber _ Bale chamber closed QO O ES Bale chamber not closed 00 Bale chamber open 7O00 Bale chamber open lifter not down Bale chamber open lifter not down bale on lifter Bale chamber closed lifter not down Ca 4 00 D Bale chamber not closed open lifter not down OO Bale chamber open lifter not down bale on lifter G O Possible status messages window 4 holding arms Holding arms open Holding arm left open N IS R Holding arm right open N 149 KRONE ISOBUS Terminal KRONE 8 10 3 8 10 4 150 Move manually to tying position CC000283 Fig 110Comprima CF155XC Comprima CV150XC e Drive engine in feed position by pressing function key Opt e Drive engine in cut off position by pressing function key OBL d BE a tunetion AB e Drive engine in tying position by pressing function key d Possible status me
25. cO KRONE 8 16 1 KRONE ISOBUS Terminal Menu 7 1 Virtual Terminal VT o C CC000320 Fig 137 Calling main menu Main menu 7 ISOBUS is called Select menu 7 1 by pressing function key Tt or the symbol is highlighted in colours Press function key OK The display shows menu level 7 1 Virtual Terminal VT The menu Virtual Terminal VT is divided into the following menus Menu 1 7 1 Switching Day Night Lighting Display ba _ Softkeys ISO Terminal only appears on terminals with less Menu Ii than 10 keys Menu 1 7 4 Switching to a Further Terminal fol ili e Pressing the function key ESC closes the called up menu e Pressing the function key ESC and holding it down brings up the basic screen 181 KRONE ISOBUS Terminal 8 16 2 182 Menu 7 1 1 Select day night display lighting Em Z CC000321 CC000322 Fig 138 The Select day night display lighting menu can be used to adjust the brightness of the display Menu 7 1 Virtual terminal VT is opened e Press the tT or 4 function button to select menu 7 1 1 A the icon is highlighted in colour e Press the OK function button The display shows the screen 1 2 Day lighting in menu 7 1 1 Select day night display lighting e Press the Pu button to switch to the gt gt screen The display shows the screen 2 2 Night lighting in
26. qzx 02 AA t w w x w d evLax d eggx g eggx d ez gx d eLLax z 146i p so o Z 49 p solo dn 1 quiguo eq uonisod punos6b dis Jaqueyo ajeq J quueuo eq PL 8g sg cg LL L L L I I I I 1 L evLax L Box l ecgx L ez gx LU eLLax x w w D w wm CO CO CO CO o oJ E on Gei x S 9 os o gt gt gt gt gt O O N N N G r L WO us uoneoo yuejd q dey p A01d uisiueu5S ui Buiddeim siosu s KO JX OSL AD 9X SSL AD ved DOC DO LOGL OU JU uInoop UOJ si qiv Joen DO GO aen paea lppiuu lqe Bums 61g lqe ums g g WDu jqe uo leq 4 9 48 lqe uo leq OLg q g OM lnpou 9q e OW lnpou 9a e OW lnpou 9q e OWN lnpoui LZ Old O I 9 od O I SL od O I ZL ola O I O Zx uoljo uuoo Y EN uol o9 uuoo OL ZX luomno uuoo 8 Zx uo mo uuoo I EM U EM U EM U V 08 qzx H qzx DU qzx 8 qzx gd PGLgdN JuolJ g e8 L qx ppiuu g e Lax g e9 gX e I WO e 49l qe Bus jqe Bus qe1 uo eq jqe uo eq d 6g D Lg j D 44g d 9Ld I I I I LU S6L8xX LU e8 gx LU e gx LU e9 9gX c CO CO CO H ow lt os S oS os gt gt gt gt O O O O 9
27. 10 1 KRONE TSOBUS KC dl E EE 204 10 1 1 Basic screen in case of a connected zero setting of blades option 204 Table of Contents 10 1 1 1 Sensor test actuator Test 206 10 1 1 2 Alarm messages for blade Comfort selection 207 10 2 Hydraulic System Circuit RI el EE 208 I Opera EE 209 11 1 Adjustments Before Starting Work a a a aaa rrssssssss 210 11 2 Travelling en DE 212 11 3 Filingihebale ern e 213 11 3 1 Reducing the Pressure on the Side Walls of the Bale Chamber 215 11 3 1 1 Assembly of Additional Tappet Strips on the Starter Roller 215 11 3 1 2 Assembly of Additional Ejector Plates in the Tailgate 216 Ji Tyngahidadepositing e E 219 Tha SPO O D j E 219 11 5 1 STAGING the pale Clot uu u ua uang a Lu uathaagasasquua ama suhu aaa 219 11 5 2 Tensioning the floor CONVeyOr E 220 11 6 After Balh sariren ena l EEE E EEE E EE REA a E ENER ear ransa nRT 221 11 6 1 Releasing tension on the floor Copvevor 221 Tee SONIC AG ONO e EE 222 11 7 1 Drive Chain for Pick up with Cam type Clutch 222 EE T pp usnu Susu S uu Da naa E E aa 223 11 8 1 Default Setting Working Height Setting 223 11 8 2 Bearing Pressure Relief of th
28. 341 Malfunctions on the central chain lubrication SIV 2 0 ee 345 Malfunctions on the Wrapping Mechanism 346 Manual actuator test 171 Manual operaltion 146 Manual operation baler 147 Manual operation without confirmation prompt 177 Manual operation wrapper 152 Manual Operation Wrapping Am 155 Manual sensor test 161 Menu Level 122 Messages 120 188 Mounting ISOBUS Terminal 198 Mounting onto the Tractor 71 Mounting the bale cloth on the bale turner 94 Move swivel table by hand 152 Move the wrapping arm to zero position 154 N Net brake u uu nisnin 85 Net Wrapping 239 Note ANd messages 191 Number net winds 129 Number ollayers 135 h KRONE Number slide wrappings 136 O Oil Level Check and Oil Change Intervals Gearboxes u uuu assaasaaaaaan 295 Oil Level Check and Oil Change on the EE ele 295
29. 7 pole of the machine e Connect plug 12 2 pole of cable set 14 with socket 13 2 pole of the machine b KRONE 6 7 gt A Start up Using the safety chain WARNING When using a wrongly dimensioned safety chain the safety chain may tear if the machine loosens unintentionally This can result in serious accidents e Always use a safety chain with a minimum tensile strength of 178 KN 40 000 Ibf WARNING If the safety chain is layed so that it is too tight or too loose then it may tear As a result serious injuries or damage to tractor and machine may be caused e Position the safety chain so that it does not tension when cornering Also make sure when laying it that it does not touch the tractor wheels or other parts of tractor or machine Note Using the safety chain Attachment of the safety chain is not stipulated in all countries The safety chain is used as an additional safety precaution for trailed devices should they become detached from the drawbar during transport Attach the safety chain with the respective mounting parts to the hitching device on the tractor or to another specified connection point The safety chain should have just enough play to be able to go around curves 83 Start up 84 Fig 49 e Install safety chain 1 on an eligible position for example RPN00075 Fig 50 e Install the safety chain 1 on the machine a or b on the tractor ZBBP0899
30. Effect Danger to life or serious injuries e Measures for hazard prevention Warning WARNING Type and source of the hazard Effect Injuries serious material damage e Measures for hazard prevention Caution CAUTION Type and source of the hazard Effect Property damage e Measures for risk prevention General function instructions are indicated as follows Note Note Type and source of the note Effect Economic advantage of the machine e Actions to be taken Instructions which are attached to the machine need to be followed and kept fully legible b KRONE 4 1 4 2 Safety Safety Purpose of Use The round balers with integrated wrapping machine of tyoe Comprima CF155 XC Comprima CV150 210 XC are pick up balers with a variable bale chamber These balers cut compact and wrap agricultural crop into round bales These bales can be wrapped with sheet immediately after the baling process If necessary it is also possible to put them down without sheet wrapping Round balers are serially equipped with a net tying and a rotating chopping system WARNING Intake and baling of pressing material not mentioned Effect Damage to the machine Collecting and baling materials that are not cited here is permitted only in agreement with the manufacturer The basic requirements in any case are swath form loading of the crops and automatic intake by the Pick up as it passes over them Intended use The
31. Note With the number of slide wrappings you can adjust about how many wrappings the actual number of the wrappings should distinguish from the specified number of wrappings e Increasing positive values correspond to more revolutions e Negative values correspond to fewer revolutions Set the desired number of layers via function key de or The symbol in the upper line goes out Press function key OK The symbol Lin the upper line indicates that the displayed value is saved e Pressing the function key ESCocloses the called up menu e Pressing the function key longerESCand holding it down brings up the basic screen b KRONE 8 8 3 KRONE ISOBUS Terminal Menu 1 3 3 Type of operation wrapper Fig 99 Displaying the menu Menu 1 3 Wrapper setting is called You can select menu 1 3 3 lt AUTO by pressing function key T or A The symbol is highlighted in grey Press function key OK The display shows menu 1 3 3 Type of operation for wrapper The current status is displayed as an icon Automatic start of transfer with wrapping ve Manual start of transfer with wrapping Manual start of transfer without wrapping E Automatic start of transfer without wrapping Change and save status e Set the desired number of layers via function key Or The symbol in the upper line goes out Press function key OK The symbol WU in the upper line indicates that the displayed val
32. Status displays of the blade group control system Blade group A swivelled in activated Blade group A and B swivelled in activated Blade group B swivelled in activated Blade group A and B swivelled out deactivated Blade group A and B swivelled out and blade base down removal of blades deactivated Note lt In order to be able to counteract a crop accumulation as soon as possible in the area of blades both blade groups as well as the blade base are always lowered when swivelling out the blades So the crop can be conveyed without any resistance into the bale chamber 205 Operation of the Hydraulic Zero Setting of Blades Optional KRONE 10 1 1 1 Sensor test actuator test Additional sensors in the sensor test in comfort blade control system Sensor Description symbol Blade group B swivelled out Blade group B swivelled in Blade group A swivelled out Blade group A swivelled in 206 b KRONE 10 1 1 2 Notes and messages Alarm messages for blade comfort selection Operation of the Hydraulic Zero Setting of Blades Optional We Pawe Posse couse Remedy Blade base is not closed Blade preselection has been changed Blade preselection has been changed Blade selection A sensors set incorrectly Blade A on and Blade A off sensors have same signal Blade selection B sensors set incorrectly Blade B on and Blade B off sensors have same signal Blade B off
33. e Before carrying out any maintenance work on the comfort blade control system or on the cutter base the hydraulic system must be depressurised on tractor side as well as on machine side 203 Operation of the Hydraulic Zero Setting of Blades Optional KRONE 10 1 KRONE ISOBUS Terminal 10 1 1 Basic screen in case of a connected zero setting of blades option Fig 151 In the basic screen it is possible to select between the different blade group control systems via Ke key In this process the selection sequence is defined as shown in the table The selected blade group control system is shown in the display next to the key 2 The status of the blade group control system is shown in the display in display 1 Selection options blade group control system Swivelling in blade group A activating Swivelling in blade group A and B activating Swivelling in blade group B activating Swivelling out blade group A and B deactivating 204 C KRONE Operation of the Hydraulic Zero Setting of Blades Optional After having selected the desired blade group control system the prompt to swivel in or swivel out the blades via the hydraulics on the tractor appears with a delay of approx 2 seconds e Prompts for activating the hydraulics on the tractor Swivelling in blades activating Swivelling out blades deactivating The current status of the blade group control system is displayed in the basic screen
34. e Make sure that there is no one in the swivel range of the machine e Keep distance to moving machine parts 13 Order No 27 007 502 0 2x H 70 mm Danger from sharp blades There is a risk of cuts when reaching into the danger zone of the blades e Wear cut resistant gloves 41 42 b KRONE Re Ordering the Adhesive Safety and Information Labels Note Every adhesive safety and information label is assigned an order number and can be ordered directly from the manufacturer or from an authorized dealer see Section Contact Affixing the Adhesive Safety and Information Labels Note Affixing an adhesive label Effect Adhesion of the label e The surface for affixing the adhesive label must be clean and free of dirt oil and grease Contact Maschinenfabrik Bernard Krone GmbH Heinrich Krone Strasse 10 D 48480 Spelle Germany Telephone 49 0 59 77 935 0 Head Office Fax 49 0 59 77 935 339 Head Office Fax 49 0 59 77 935 239 Spare parts domestic Fax 49 0 59 77 935 359 Spare parts export Email info ldm krone de cO KRONE 4 7 Safety Safety Equipment WARNING Unexpected movement of components due to defective safety equipment Effect Danger to life risk of a serious accident or damage to the machine e Machine must not be started without functioning safety equipment Comprima CF 155 XC Comprima CV 150 Comprima CV 210 XC XC S m i
35. e Remove the locking cams from the hub e Clean all parts e Grease all parts with Walterscheid grease by using a brush To grease use Agraset 116 order no 304291 or Agraset 147 order no 102966 The grease must be purchased from Walterscheid Top up the deepening in the coupling housing with grease Assembling cam type clutch Fig 262 Caution Always observe the position of the bevelled edge on the locking cams when inserting the locking cams Locking cam a right Locking cam b wrong e Insert locking cams into hub e Insert the pre assembled hub into the coupling housing e Insert shim rings and support disc and secure with retaining ring e Apply grease again on shim rings support disc and retaining ring e Insert seal ring KRONE Maintenance lubrication 14 5 Lubrication points The following tables contain a list of lubrication points on the machine and the number of lubrication nipples Left hand side COM00212_2 Fig 263 333 Maintenance lubrication KRONE Lubrication Points Number of Lubrication Grease Nipples Interval Parking jack Tandem axle pendulum arm bearing right left Bearing wrapping table 5 Nipple block left Floor conveyor at front Lower roller Upper roller Cylinder swivel table Nipple block right left Rear rocker arm Bearing drive shaft floor conveyor rear Comprima CV150 CV210 XC p Cylinder bale lifter only Comprima CF155
36. oy S S d ezgx Z Buruun jeu cg I L ezgx S c D gt gt Li ul65u l jeu Lg CO L OW smpou 9 OY4H91A O I ZL LN UOlOSUUOD i v L 39 14 d eLax y 6u9 jou Lg n eLax sW 8 Wel TX a uo us UOleDO jue d C Aq deu uiuo D A01d ueyo 1 eq SlOSu s LO X 0L AD ved LZ900LOSL OU JUBLUNDOP dn sequieyo jeq r g ZO EI L OINM lnpouu OL O84910 O I OL LX UOl OSUuuoo Ve 9 39 19 SW OE ry us q X v z amp vLax dn u qweyo eq uoljisod puno1B6 pejq gg SM 8d 9V amp Y gg 9a L OWN elnpow GL od O I ZL ZX uo no uuoo l V K tb qzx 8 d eggx z uonisod punoiB pejq gg L I eg8gx si qlv Joen LLO SOE ayep p le io dis sg ZOE L OINM lnpou Z Did O I oz LX uo n o uuoo I V a SW d eggx Z dijs gg L d eggx x x on gt S gt N 146s pesojo 1 quueu2 leq z g q e OW mpou zZ Old O I ZZ LX uon o uuoo U EM Ha 2eu 718 BCLON 1UDU p so 5 J qweyo eq N N SW 8 CN Heures YS p solo Joquieyo sjeqL g
37. see chapter Safety Safety routines Warning Risk of injury from uncontrolled movement of round bales On slopes always lay down round bales in such a way that they cannot move on their own On account of their weight and their cylindrical shape they can cause severe accidents if they have once started moving 209 Operation 11 1 210 Adjustments Before Starting Work Before starting work perform or check the following settings Tighten the floor conveyor of the bale chamber Comprima CV150 CV210 XC Please refer to Chapter entitled Before Baling After Baling Working height of the Pick up Position of the roller crop guide Switch the cutting system on or off Cutting length of the cutting system Use of the bale ejector Preselect the baling pressure Comprima CF155 XC Adjust the bale size Comprima CF155 XC Preselect the bale size Comprima CV150 CV210 XC Use additional tappet strips Insert net Insert sheet Function of the chain lubrication system Reset the bale counter as KRONE The Required Working Steps are Described in the Chapters Settings and Operation b KRONE Operation If the cutting system is switched on during baling the bale density will increase substantially which makes it necessary to reduce the baling pressure To do this Short crumbly straw e Reduce the number of cutting blades or turn off the cutting system or remove the cutters The blades
38. 2 until the display of the pressure gauge 1 shows a pressure of 50 bar Parking position e Tighten handwheel 2 again The clamping cylinders of the floor conveyors are depressurised 221 I _sar m Operation KRONE 11 7 Overload protection 11 7 1 Drive Chain for Pick up with Cam type Clutch RPN00021 Fig 161 CAUTION Damage to the machine and loss of the warranty claim e Donotperform any manipulation on the cam type clutch on your own The drive is fitted with a cam type clutch 1 as a protection against overload This coupling has been set in the works of the manufacturer and may not be adjusted without prior harmonisation with the KRONE after sales staff 222 w I KRONE Operation 11 8 Pick up 11 8 1 Default Setting Working Height Setting Note Lift the Pick up for driving in the headland or when driving backward Shut down and safeguard the machine see chapter Safety gt Safety routines Shutting down and safeguarding the machine H eh lt Note When adjusting the pick up the drawbar height of the machine must be adjusted to the tractor see chapter Initial start up The distance from the tines to the ground must be about 20 30 mm Adjust the pick up working height according to the prevailing ground conditions Default setting the setting must always be the same on both sides e Raise the pick up 3 hydraulically e Remove the linch pin 2 S
39. 8 17 186 Menu 7 4 ISOBUS Diagnostics C OK ESC Sa CC000324 Fig 142 Calling the Menu Main menu 7 ISOBUS is called e Select menu 7 4 by pressing function key Tt or the symbol is shown in reverse colours e Press function key OK The display shows menu 7 4 ISOBUS diagnostics b KRONE 8 17 1 KRONE ISOBUS Terminal Menu 7 4 2 Diagnostics Auxiliary Functions AUX CC000489 Fig 143 Calling the Menu Menu 7 4 ISOBUS diagnostics is called The menu 7 4 2 Diagnostics Auxiliary Function shows you with which key on the joystick the auxiliary function is carried out Select menu 7 4 2 by pressing function key Tt or the symbol is highlighted in colours e Press function key OK The display shows menu 7 4 2 Diagnostics Auxiliary Functions When activating a function on the joystick only the assigned symbol will appear in the display The function itself is not performed e Pressing the function key ESC loses the called up menu e Pressing the function key ESC and holding it down brings up the basic screen 187 KRONE ISOBUS Terminal KRONE 8 18 8 18 1 8 18 2 188 Messages Query message for bale chamber CC000299 Fig 144 The query message M1 appears if the transfer from the bale chamber to the swivel table has been started but the tying process is not yet completed e The query message dis
40. If the tension of the spring 4 is stronger the net is pulled more easily However when Starting it pulls to the middle If the tension of the spring 4 is lower pulling the net is more difficult However when starting the net remains further on the outside If the settings on the spring 1 are changed the spring 4 must be adjusted accordingly e Move the net motor to the saved feed position refer to Menu 3 2 Manual Operation of the Baler in the operation terminal e Install the locknut 5 flush with the end of the eye screw 6 e Install the wire rope 7 with the wire rope clamps 8 without pressing together the springs 4 e Tighten the locknut 5 until the spring 4 is pressed together to a dimension of X 130 mm 2 0 b KRONE Settings 12 2 Central chain lubrication system SRE RBV05150 Fig 211 The central chain lubrication system is attached to the left hand side of the machine behind the front guard Each time the drive shaft makes a rotation oil is forced out of the tank 1 via the pump 2 and the lubrication manifolds attached to the left hand and right hand side of the machine and onto the brushes on the drive chains Different nozzles are built into the lubrication manifolds for each lubrication point The delivery rate can be adjusted by means of the eccentric cam 3 on the drive roller VP 2 001 Fig 212 Loosen the screws 2 e Rotate th
41. Maintenance KRONE lt 322 Replacing the filter element Note Store or dispose used oil and oil filters according to statutory provisions e Relieve all pressure from the hydraulic system e Screw the bottom of the filter 4 off the filter head piece 1 and clean it Remove the filter element 3 and replace it by a new filter element Order no 919 730 0 e Push a new filter element 3 onto the valve sleeve 5 e Check the O ring seal 2 and replace it if necessary by a new O ring seal with identical characteristics Screw bottom of the filter 4 back onto the filter head piece e Charge the hydraulic system with pressure and check for leaks cO KRONE 13 18 6 Maintenance Electromagnetic Valves Fig 255 The electromagnetic valves 2 are located on the left hand side of the machine behind the guard A emergency manual activation of the motional function of the pick up and the blade base can be carried out on the electromagnetic valves if the comfort controls fails In the event the comfort electronic system fails Screw in the rear subjacent slot screw 1 or the knurled head screw until the pick up can be lifted or lowered directly from the position of the control valve on the tractor Note As soon as the comfort electronic system works correctly again the slot screw or the knurled head screw on the electromagnetic valve have to be screwed out Only this guarantees the operation of the
42. OC L OMI ainpow L OYSAHVNV O I of LX UOl OSUuuoo i ev a z S el O0Lgx Sai cf os AS L NWEO1A N 98u Buy kel olg L de d kjorax CO Gen ED 018 tro ng q deu Ham p A01d ueyo LO LZ900LO0OG OU JUBLUNDOP Va Du 6g ul uni JOJOLW JOU LN CO LOWY lnpou OC L OINM empou Z OYSHVNV O I Z YLSNMdgH O I CC IX UOl JOSUuuoo si qlv Jost LLO SOE aep p le io 1Jo ouu uoni sod Ce Deg L OW sppou OYSHVNV O I Zv LX UOlJOSUUOD i y a g 8 Cat cl oe AS L NVEOT1A N Z w l Buy 70 6g ON Ae werd TT qogx gig S wm CV d 39 1 z LNX S A TN JO OW Ieu W LIN L d SI LI aL Nx SWI IN I q X I ey ZZ Zx UOlJOSUUNOD L LX Uuol l 9 uuoo L YLSWMddH O I CO O9WM sppou Senat eg eet eg pu x JOJOW JOU LN i ev Ke eel qzx x e e qaZX LX AX ae Ur _ ezX LN AX x e el q 9X FN cf oe AG L nvgo13 n JoJOW uol isod kel org A d zT by qegx gig z CO z UECN LX AX U J zT L qZX LN AX gig m wn D lee s JIN Bo gt gt NON Buluuns jou zg cd L OW mpou L OYSHDIC O I OL LX UOlJOSUUOD i v
43. Parking Support The parking support ensures that the machine is stable when it is not hitched to the tractor HDC00018 Fig 15 Note Risk of hands and feet when the parking support is actuated To raise the parking support e As soon as the machine is connected to the tractor turn the crank 1 several revolutions clockwise until there is no more weight on the parking jack 3 e Withdraw the locking bolt 5 on the lower part of the parking support 2 push in the parking support 2 and secure it in position with the locking bolt 5 e Then crank the parking support 2 up all the way e Turn the parking jack 3 so that the flat side is facing the pick up Lowering the Parking Support RPN00037 Fig 16 e Turn the crank on the parking support several rotations anticlockwise e Remove stake bolt 2 bring the support pipe out of the parking support 1 and then secure again with the stake bolt 2 e Crank the support plate 3 tightly onto the ground until pressure on the drawbar has been relieved Note In order to increase the base of the support jack when the ground is soft use a suitable support 47 Safety 4 7 10 48 AZ KRONE Shut off valve for tailgate WARNING Settings on the machine Danger to life or serious injuries e The shut off valve on the left hydraulic cylinder must be closed Fig 17 The tractor supplies pressure to the machine hydraulics via hoses In addition
44. after the first 8 operating hours and Wheels wheel nuts every time after a wheel is changed after longer downtimes PTO shaft friction clutch after the first 500 bales then every Screws from the floor conveyor 3000 bales but at least 1x per year TI Oil change when the season begins after Chain tension floor conveyor drive approx 5 bales Chain tension floor conveyor Chain tension pick up drive Chain tension roller drive x Chain tension pick up drive i 8 A E After first use approx 30 50 operating hours Gearbox then annually after each season after first use und then after every 1000 bales Floor conveyor tension 2 6 X za KRONE Se e SL see Chapter Maintenanc e b KRONE Maintenance 13 3 Setting of the Scraper Rail to the Upper Spiral Roller e Open tailgate WARNING Settings on the machine Danger to life or serious injuries The shut off valve on the left hydraulic cylinder must be closed RM r CPK00230_3 Fig 216 Swivel shut off valve 1 in the return of the left lifting cylinder from position a to position b the tailgate is locked hydraulically 277 KRONE RPN00064 2 Fig 217 e Install the scraper bar 4 so it is centred in the oblong hole of the side part and slightly tighten the screws e Drive the clamping wedge 5 tightly into place and tighten the screws securely e Move the scraper rail 6 up against th
45. approx 90 mm is set h A KRONE Maintenance 13 17 Wrapping Arm Bearing Shut down and safeguard the machine see chapter Safety gt Safety routines Shutting down and safeguarding the machine COM00210 Fig 245 If the wrapping arm bearing has too much play in the gearbox it must be raised by placing shim rings under it e Remove the protective hood 1 e Remove the cover 2 e Insert shim rings 63x 80 to adjust the play between bearing and cover e Install the cover 2 Set the protective hood 1 in place again e Then activate both bars 3 and check whether the safety switch is working correctly again 309 Am Maintenance KRONE This page has been left blank deliberately 310 b KRONE 13 18 Maintenance Hydraulics WARNING Risk of injury as a result of incorrect handling of liquids under high pressure Effect Escaping high pressure liquids can penetrate the skin and cause serious injury Repair work on the hydraulic system may only be performed by authorised KRONE professional workshops e Depressurise the system before disconnecting lines e When searching for leaks use suitable aids and wear protective goggles e High pressure liquid that is escaping from a small opening is virtually invisible Therefore you should use a piece of cardboard or something similar when searching for leaks Protect your hands and body e If liquid penetrates the skin con
46. en LLO SOE aen uolleoo OU Ju ulInOSop p le iOo UX 0L AD ved jue d kV o 8 LV 8 CV Ca CH c 8 CV c ag FUINL TOL 6 ILXL ASSS 9XL 1 Nui JEIDNL ONE GILXL L HNWO qb SX A LO c co a Ww CH co eL SX Ld H EI E ER N9 ER SM WYO Oe L RY 8i Li gd d d ei f d d Li d s H d aR Sec SH N VW lt k XO iene ills ie eee eee SE Tesi eee ele TL T T titel GO H t Q H 0 TI GO TI Ge Q GO Ze U Z POD O POD O 2 z 2 Z 2 Z Q s Hp D Y2MOeMmeRey DEZ gt Z m Z d gt Z EZ m Z d 9 9 9 lt 9 9 lt 9 9 lt D a 9263 66 lt S Z 9 Z 3 lt S Z 9 Z 2 lt ES Oo Q Q F ol Lo Oo OD LG DO oO N N N 3 gt gt gt gt Wp 3 I Te gt FNN 3 I Te gt SF N E E E D z D D N Sogn 5 gt S S lt lt lt E Es Es a lt g lt CD lt a a a ER e e e a Zo D o 2 e gt o E E E 5 5 5 E 5 5 5 5 C ZS 3 ZS 28 ZS S 8 S 8 lt lt lt lt lt lt lt lt ui u 3 I eufi oepl ni ang M 13u14 NIT La Een Een PPS PIA Z NVO L NVO L NVO ilo oF er ey fe N Yor Les Las OS Loo ee j K j g Lo Boe KEEN
47. q l qr0AX Hazsx Haisx lt a EEX ZX AX I Loes ZX AN m z BEN ZX AX w S U g t AEX zX AN 39 SA H qex oe qgex Ob CY aao CN l ey ey ey Z CN uol uuoo og X uom o uuoo Ov LN uo no uuoo Z WIWMd O I LL WIWMd O I L V TNAAd O I Sa LOW lnpou CO L OW ampow CO L OM ampou V wue Bulddeim aalen uolj n6 1 9 A UOHeINIIIO YOOIG SA SABA UOHOUN YA uo OL us UuOledO jue d Q gt gt i i lt lt lt CO CO z 9204X z GELAX FA rN zl A dn pesojo wequueyd eq ejd saysue XU ox XU eva L L U U l q 0AX l GeLAX e lt SN CY l ey ey OL Zx uo o uuoo ZL x uono uuooS OL WIWMd O I 6 YINMd O I JOE L Oms amnpow CO bi L OWN amnpow pesojo Jequueyo jeq ZA umop 9 e d JOJSUeI LA Z ssoyenjoe Aq deu uiuo D A01d ueyo LO X 0L AD ved LZ900LOSL ou Ju uin5oop gt gt i lt lt 25 25 ES lt LO LO qz LAX q d dE z lI dn z lI ejd 1 Jsuen ale Buims x CLA x LLA L L LU d b qZLAX H qLLAX lt CN CN ey ey OL X uono uuooS r CN uolmo uuoo 9 WIWMd O I WIWMd O I Sa L OWN enpow CO L OWy eampow yo
48. the ground e Shut down and safeguard the machine see chapter Safety gt Safety routines Shutting down and safeguarding the machine COM00343 Fig 53 Removing the bale cloth 1 when used without film wrapper e Remove the screw connections 2 on the right and left e Pull the support tube 3 out of the holders 4 and bale cloth e Store the support tube and bale cloth in a dry and clean location Fitting the bale cloth 1 when used with film wrapper e Guide the support tube 3 through the holders 4 and bale cloth e Attach the support tube and the hooks 5 on the right and left with hexagonal head screw 6 washers 7 and locknut 8 8 Start up 6 12 88 b KRONE Start up Bale Turner The bale turner is used to set bales down from the wrapping table directly on the ground on their front side Bales must be stood up while the machine is stopped Functional safety can only be guaranteed to a limited extent on slopes Check the sheet after the bales have been stood up In extreme situations for example conical bales on slopes standing up the bale could possibly result in damage to the sheet In this case bales should not be stood up and the bale turner must be folded back 1 or removed COBW0021 Fig 54 Note Depending on the setting of the bale turner it can remain folded back on the wrapping table even if bales are not being stood up Note We are unable to honour
49. 150200368 04 CC000298 CC000297_1 Fig 134 Calling the Main Menu e By pressing d function key from the basic screen you get into the menu level of the machine e Select main menu 5 by pressing function key T or the symbol is shown in reverse colours Press OK function key The display shows menu 5 Information Complete software version of the machine SW Complete software version of the machine Software of the job computer ISO ISO software version of the job computer e Pressing the function keyESC closes the called up menu The display shows menu level 5 Info e Pressing the function keyESC and holding it down brings up the basic screen Main Menu 6 Technician Calling the Main Menu Res TE _CC000051 CC000052_1 Fig 135 e By pressing function key d in the basic screen you get into the menu level e Select main menu 6 by pressing function key T or A The symbol is highlighted in grey Press function key OK Main menu 6 Technician is password protected 179 KRONE ISOBUS Terminal KRONE 8 16 180 The display shows the password query Main Menu 7 ISOBUS CC000490 Fig 136 Calling the Main Menu By pressing the function key L from the basic screen you get into the menu level of the machine tod Select main menu 7 by pressing function key RB or Y the symbol is highlighted in colours e Press function key OK The display shows menu level 7 ISOBUS
50. 2 n wwe Bulddesm 1uBi u 9zg Jed WO wie Buiddeum wie Buiddeum Jay dn ajeq MOO Jo H pcg Lcg ozg cg HCH cl L L L L L a I I I I 1 agzax L epzax LT eLzax L eozax I ezzax Il eozgx GE E D Ge D Ge SES e We c c c c Je 8 z z SI S 3 Oo G oO Oo CG E E gt gt gt gt gt gt gt N N O O w w uo us uoleoo jupe d wie Bulddeim njena uolnp nB i 9 A q deu p A01d s10 enpe LO LZ900LOSL UX Ole AD ved UOH eINDIID YOO G GA OU JUSWINIOP si q v Joen LLO SOE aen paea al uoll9unj YA Ga L OWM lnpou CO SI L OWM lnpou ECO EI L 2 2einpow Z WONLS O I WOUYLS O I L WOULS 9 O I X uoosuuoo LE X uonmo uuoo Lp LX uon o uuoo 1 EM I EM U EM ET qex Il qex i lt op lt LO op 39 SA y z UN e q SX JJ zT ptt z 1904X ud Ve ag NS u lspeysle uoAu l o z 9904X 4 Cl wie Buiddeim y 16 roo oe O48 z APOAX AN a wie Buiddeum UOI e NDIIO OO dojs Aouebiews I z I I youms Ajajes z njea uone nB 1 x SOA I 1 D ZS me L aAeA uonounj x 90A d x vOA L Ke a s 2 L U L qS0AX Yo MS Vd Yo l q90AX q
51. 250 AZ KRONE Comprima CV 210 XC Fig 192 HDC00087 Fig 193 e Hook hand lever 4 into the bore hole 5 and hook 6 into the oblong hole of the slip on gear 2 The hand lever can be readjusted in the oblong hole 7 of the hook 6 if necessary e Push the slip on gear 2 into position a by using hand lever 4 and secure with cotter pin 1 e Remove auxiliary device and put it down in the twine box C KRONE Operation 11 18 Bale Wrapper 11 18 1 Special Safety Instructions the case of technical intervention drive elements may start moving Effect Danger to life injuries or damage to the machine e Switch off the engine of the tractor remove the ignition key and carry it with you e Separate power supply voltage 12 volts e Secure machine and tractor against rolling e Switch off the PTO shaft and uncouple it e After the repair maintenance cleaning work or technical modifications are completed install all protective covers and safety devices properly again e There is a risk of injury when working on the cutting device Do not touch the blades of the cutting device e When operating the machine ensure that nobody is within the swivel range of film wrapping arm and cutting device DANGER When performing repair maintenance or cleaning work on the machine or in Note Do not wrap the bale when it rains or when the crop is wet as this could lead to forage of minor quality
52. 251 Operation EEgsg 11 18 2 Components Bale Wrapper Comprima CF 155 XC CPNO00025_ 2 Fig 194 Tailgate Lifter Swivel table Double wrapping arm Stretch sheet roll Setting down bales Sheet roll mounting shaft Holding down device and cutting device OO O O1 WN 252 Y KRONE Operation Comprima CV 150 XC CPN00026_2 Tailgate Wrapping table Swivel table Double wrapping arm Stretch sheet roll Setting down bales Sheet roll mounting shaft Holding down device and cutting device OO O Om WN 253 Operation 254 Comprima CV 210 XC O O OI Go M Tailgate Lifter Swivel table Double wrapping arm Sheet roll mounting shaft Holding down device and cutting device Height adjustment wrapping arm AZ KRONE COM00304 b KRONE 11 18 3 Operation Function Bale Wrapper When the bale chamber is full an audio signal will be heard and the drive must stop the machine The two net guide rollers deliver the net into the bale chamber and the bale is tied If the net tying process is completed the tailgate of the machine opens and the bale falls onto the lifter Comprima CF155XC or wrapping table Comprima CV150XC Just Comprima CF155 XC The lifter lifts the bale onto the swivel table which is fitted behind The lifter is lowered and the tailgate closes again Just Comprima CV150 XC The wrapping table transports the bale onto the swive
53. 26 blades Hydraulic Connections Raising lowering the pick up or blade base 1 x single action control unit 53 Safety KRONE Axle Tandem axle axle base 1100 Permissible weights see information listed on the identification plate Pick up width 2150 mm Width approx 2960 mm Track width 2455 mm Tyres 500 50 17 10 PR 500 55 20 12 PR Length approx 7239 mm Height approx 3080 mm Bale dimensions Diameter approx 1000 1500 mm Width approx 1200 mm Power requirement approx 51 kW 70 PS Drive speed PTO shaft 540 r p m Max permissible operating pressure of 200 bar hydraulic system max Oil temperature 80 Delivery rate hydraulics min 30 I min max 60 I min Electr Lighting 12 volt 7 pole connector connections Operation 12 volt 3 pole connector Net max Width 1300 mm Sleeve length 1250 1330 mm Sleeve diameter 75 80mm Roll diameter max 310 mm 3000 m roll Width 2 x 750 mm 500 mm also possible Pre stretch 50 or 70 Sleeve diameter 75 80mm Roll diameter max 260 mm Overload protection system universal shaft 1950 Nm 17 blades Cam type clutch 540 rom 2300 Nm 26 blades Hydraulic Connections Raising lowering the pick up or blade base 1 x single action control unit 54 b KRONE Safety Permissible weights Tyres Height approx depending on tyres Width approx depending on tyres Diameter approx 1000 mm Wrapping to 1750 mm diameter and a bale weight of 1600 kg
54. Aau TING Ne Bamme TE 91 6 16 Adjusting the parking jack E 92 6 17 Moving the Bale Turner into Transport Hosemton 93 6 18 Mounting the bale cloth on the bale turner 94 Table of Contents 6 19 Removing the bale turner a r a 94 7 Diving arid Wa Te o GE 95 TA Preparations for road travel U uu lulu a kkawaaskakuwakakwapahakkaqkawanqwankaankukuwakaaqiwapa a 96 7 1 1 Fill He TOL uuu a ua ua E ee eee 96 7 1 2 Checking Parking Support a a 97 r n Checking the lighting system a a 97 7 1 4 Attaching the Dale et BN 98 7 2 L l ME 99 7 2 1 Securing the Machine Against the Possibility of Rolling Back 99 7 2 2 Lowering the Parking Suppolrt a a a a aaa r aar 100 7 2 3 Disconnecting the PTO shaft from the tractor 100 7 2 4 Disconnecting the Supply Lmes 101 8 KRONE ISO B WS eege 102 8 1 Installing the terminal into Cam 103 8 2 ISOBUS Short C t BUOM E 104 8 2 1 Connecting the Multi Function Lever to the CCI Terminal on Tractors with an Integrated SY RE 106 8 2 2 Connecting the Multi Function Lever to the CCI Terminal on tractors without ISOBUS system 107 8 2 3 Switching the terminal on off when the machine is not connect
55. C e z KRONE Malfunctions Causes and Remedies Malfunction Possible cause Remedy The net tears off The blade bar has been fallen down Remove impurities directly after the again immediately after the starting starting process or process during wrapping The roller brake is set too strong Check the setting of the brake device Blade bar is too low Check the setting of the blade bar Net is not transported The dimensions of the net are Just use net rollers with prescribed during the starting incorrect dimensions process Net rollers are not inserted correctly Insert net roller according to the operating in the reception device and or the instructions set roller brake roller brake device is not set correctly Net has not been inserted correctly in Pull the net out of the wrapping device the wrapping device and insert it again according to the operating instructions The left right display is In case of Comprima CF155 The Lubricate the inner tube too sensitive spring tubes on the belt tensioning device are running too sluggishly see Chapter entitled Setting the Bale Diameter Net is not cut off Blade bar does not fall completely neatly down Dull blades Change blades Ratchet mechanism does not come Readjust cable up The net does not Net is not decelerated correctly Check the setting of the brake device reach the outside during wrapping process edges of the bale Net has got caught on the
56. Change and save status e Set the desired status via function key E or the symbol in the upper line goes out Press function key OK The symbol in the upper line indicates that the displayed value is saved Use softkey DEF to reset the sheet tear monitoring to the factory setting Pressing the function key ESC closes the called up menu e Pressing the function key longer ESC and holding it down brings up the basic screen h KRONE KRONE ISOBUS Terminal Insert new sheet if sheet is torn CC000279 CC000278 Fig 103 Comprima CF155XC Comprima CV150XC CV210XC Note The basic screen Sheet tear is displayed in the event of a sheet tear alarm during wrapping 4 e The softkey 0 can be used to release the holding arms e Insert the starting end of the sheet in the clamping device refer to chapter Operation Inserting Sheet e Activate o Lau until the holding arms have reached the closed end position GO Continue wrapping process by activating the softkey th 141 KRONE ISOBUS Terminal KRONE OK 8 9 Main menu 2 Counters m s ESC ESC u CC000219 CC000280 Fig 104 Calling the main menu e By pressing the function key d in the basic screen you get into the menu level of the machine You can select main menu 2 GR by pressing the function key T or The symbol is highlighted in grey Press function key OK The display shows menu level 2 Counters
57. Control Shafts A B Mechanically Into the Blade 0 Position Position j Abb 171 e Turn the blade control shafts back so that the blades extend somewhat into the cutting channel and are easier to grasp b KRONE lt Operation Unlocking the Blade Shaft 2 g RPN00015 1 Abb 172 e Unlock blade shaft Pull the locking bolt 1 out of position a and allow it to engage in position b Note The supplied key can also be used for locking unlocking the blade shaft Changing Blades KRS 1 015_1 Abb 173 e Remove the blades 1 Note When inserting the blades 1 ensure that they are located correctly on the blade shaft and centred in the slot 2 e Insert a new or a ground blade 1 Note Before the cutter base is raised check if all blades 1 form a straight line and if they are thus correctly installed 233 Operation 234 RPN00015_1 Abb 174 e Lock the blade shaft Pull the locking bolt 1 out of position b and allow it to engage in position a e Adjust the cutting length turn blade control shafts A B in position After the cutter control shafts have been adjusted the cutters automatically swivel back up into working position e Check to make certain all the cutters have swivelled up If they have not lightly tap any blades that have not already swivelled up with a tool for example a hammer striking the back of the cutters to move them back to
58. Danger from tailgate as it may close in an uncontrolled manner e Staying in the danger zone is only permitted when the lifting cylinder safety mechanism is engaged 7 Order No 939 520 1 2x Danger due to rotating auger There is a danger of becoming caught or wrapped around the rotating auger e Never reach into the rotating auger e Keep a sufficient distance from moving machine parts Danger due to rotating machine parts When the machine is running there is a risk of injury due to rotating machine parts e Before starting up move the guards into their protective position 39 COM00341_1 9 Order No 939 125 1 4x H 100 mm Danger from sharp blades There is a risk of cuts when reaching into the danger zone of the blades e Wear cut resistant gloves Danger from rotating machine parts Rotating machine parts in the range of movement of the wrapping device represent a risk of injury e Actuate quick stop button in order to interrupt all wrapping device functions 40 C KRONE Safety 11 Order No 942 271 0 2x Danger from rotating machine parts When getting on the machine while the PTO shaft is running there is a danger of being pulled in due to rotating machine parts Switch off PTO shaft and engine before getting on the machine Danger from shock The swivelling movement of the machine may cause danger to life
59. Danger if the maximum permitted PTO speed or the maximum permitted operating pressure is exceeded If the maximum permitted PTO speed is exceed parts of the machine may be destroyed or forcibly ejected If the maximum permitted operating pressure is exceeded hydraulic parts may be damaged As a result people may be receive serious or life threatening injuries Observe the permitted PTO speed Observe the permitted operating pressure 3 Order No 942 196 1 8x Danger due to crushing or shearing Risk of injury due to crushing or shearing points on moving machine parts e While parts are moving never reach into areas where there is a risk of being crushed Danger due to rotating pick up There is a danger of being drawn in if you approach the danger zone and if you use your hands or feet to clear clogging e Before working on the pick up switch off the PTO shaft and the engine 37 Safety mprima n COM00340_1 Fig 7 gt OR Fig 8 38 b KRONE Safety 5 Order no 939 529 0 1x Danger due to high pressure liquid The accumulator is under gas and oil pressure If the accumulator is not removed or repaired properly there is a risk of injury e Before removing and repairing the accumulator follow the information in the operating instructions The accumulator may be removed and repaired by a service centre only 6 Order No 27 003 995 0 2x
60. Doug YNY AZL LV LU 490 ue Buo ddh RAA S VIWMd 8 EN S Sl rv lqe Bums LLA VIWMd FEN siosu s Bojeue Ajddns re 2 _ ai e 9v 6 we BuIddEeuA oun uone nB i 90A Z VINA d Z X Lu 21 _ eh 0Z CN oz Josee Ep OZ GND og HI lt DEN ONG 928 SM 24 _ SC BR s nd no V HI Ly X CL Josu s je Bip GND 91A REN GND Led zg 9 2 siosuas jeybip Ajddns o S 4OL SPJEMIO YOSIPHUBMYIS R t Wolls X 1 N Sos SS SM S r N ENZ UOHE NDIID MOOI0 GOA WOULS LE X a LL ag Z X lddns AZ punoi6 1 ONS amp A 8 _ JL GND SLA SM LIA 2 _ _ 84 6 we Buiddeim anjen uoljeinBes 90A Z WOYULS X vI ll S X A ddns ACL puno Tano OO Slo i Ge eXL GND ZLA SM LLA sss _ e gt lt s ol Saved Npe v erg INN 92 X FOI Z X Aiddns AZ punoi6 T ONS _ LICXL GND LLA SM 9LA g N a FJ ZU Albe p9 v zrg Z LUIDW Ee EN a LL ZZ EN lddns AZ punos6 1 ONS o e _ GL GND OLA SM 8LA ei z 2 D L4 8 NO 8Q Jeu 9Zg oz SIG 6L CN LI LL 84 X A ddns AC L puno 6 1 ONG ae z D BL EXL GND SLA SM LA ges _ _ mo l Z4 8 Jeu dn leq zg Glod OF X 720 gaer ouer LOA SMJELA s X lddns AZ punou6 7 AN9 e 93 01 lt G EL CN lddns AZ punoi6 1 ONS 8 EVEX GND ELA SWZIA S _ wi sindul Ga 0l LL X lddns AZ punou 1 ONS LL EXL GND ZLA _ Go 6 EN lddns AZ punosb 1 ONS m 62 EN Aiddn
61. ES SCH SMW 68 2 z 4 6 uonouny YOA k WOULS 9 Ly LX GV OI Vam Ge LN siosu s Bojeue ONS YNY ONS N Ge LXL 68 S I Q F 9V G aq Ze LN suosuas Bojeue GND YNY ONS _ S Ceo LXL 08 ite 13 018 608 _ ao SdS y 6uniin qg 69 Z OHHdHVNV EE LN GV S ag ve LN y BelloA Bojeue YNY AZ _ a OCI a INL 68 luOi8 urs S STAZI R IER 44u 6uniInj g9 019 L OHdHVNV O LN LE LXL OLE 8 siosu s Bojeue Ajddns SS wo F9 Yo p solo Jaquueyo ajeq g Sid vz Lx ep Ter Du pasojo 1 quueuo sje T z ZVZ SW r8 a SE EE C BE 9 N 74 9 IuDu pesojo Joquieyo jeq ZLg _ z Old cz 1X i 6L LXL Lg SM 0r8 _ _ o l sa Zb anoe g Ld LL OYNADIG 8 LX bY Clit Y Ova SM Sd lt aie deeg E X LEZ anyeop g org OL DYADIC 9 LX EN Ol ry qg SW 8 a ies ee FORSA ie 8 4 9 due sg Z OYADIG OZ LX L s at TX ld an ee SE ER SE Nig Ld S fue SR L 9 OYSAHDIG ZL LN LV 9 ag X GZ LX Josuas ED ONG SIG gt _ SOLL Lhd SM Z14 s _ N G Buluuns jou zg L DH OL LX V OI ag ZYY ZIG SWZ8 EZ E z Josuas e 61p zZ ONG OIG x S _ z osu s jeb T T en a zg Q LL LX Josuas ef L ONG OIG P 9 sindul JILL LOA siosuas e iBip Ajddns as mM GER SM 02A IA Gi Se S S ZE LN lddns AZ punoi6 1 ONS L gO US lx WAL GND SW ON N 2 S el S ZZ LN A ddns Az punos6 1 ONS ue m 97 LX Aiddns AZ punos6 1 ONS N amp LO CDI SIXT SOA om 8 LX A ddns Az p
62. Effect Danger to life or serious injuries The characteristics of the lines change depending on pressure heat load and the effect of UV rays The date of manufacture appears on the hydraulic hoses This way the age can be ascertained quickly By law the hydraulic lines must be replaced after six years Use original spare parts when replacing hydraulic hoses Caution Soiling of the hydraulic system Effect Damages to the machine e When connecting the quick couplings ensure that these are clean and dry e Note chafing areas or points of contact b KRONE 6 2 2 Start up Connecting the hydraulic lines Comprima CF 155 XC Comprima CV 150 XC To perform the following hydraulic functions the tractor requires 2 single acting control units 1 double acting control unit Control Function blue T Tank free return e Connection to free return to the tank Single acting control unit Opening closing the tailgate red 1 e Pressure red 1 Open tailgate e Float position red 1 Close tailgate Single acting control unit Raising lowering the pick up or blade base yellow 3 depending on preselected setting on control unit e Pressure yellow 3 Raise the pick up or blade base e Float position yellow 3 Lower the pick up or blade base Double action control unit Lift lower blade bar green 7 green 7 A Pressure green 7 Raising blade bar A e Pressure green 7 Lower
63. Example for a pre stretching of 70 e Mark the sheet on the roll with 2 lines in a distance of 10 cm e Measure the distance between the two lines after the sheet has been wrapped on the bale In the event of a pre stretching of 70 the dimension is now approx 17 cm A too strong pre stretching is probable if a considerably larger number of bales can be wrapped with a roll or if the sheet gets crosswise to small Note In the event of overstretching cancel the wrapping immediately and continuate only if the problem has been eliminated The width of the stretched sheet measured on the flat end of the bale should be at a original width of 500 mm not less than 400 mm 750mm not less than 600 mm 263 Operation KRONE 11 18 8 Adjusting the Gearbox on the Swivel table KR CPN00002 1 Fig 205 Depending on which sheet roll size is used the appropriate setting must be made on the gearbox of the swivel table A label is located on the gearbox of the swivel table This label shows the control settings of the actuating lever 1 for the respective sheet roll size e Reverse the actuating lever 1 into the position shown on the label 2 e Position a of the actuating lever 1 corresponds to the control setting for 750 sheet e The position b of the actuating lever 1 corresponds to the control setting for 500 sheet 264 b KRONE Operation 11 19 Removing the Crop Blockages in the Crop Collection Are
64. G i OQ OQ S S 8 S lt lt lt lt lt gt gt OD oS CG oD OD E E gt gt gt gt gt gt gt O O O O O O O WO 8us uolneoo sio en oe q dey p A01d KU DOC DO LOGL s i qlv Joen 6002 GO REH ue d we Buiddeim eajea uone nBas 90 A JX OSL AD OX SSL AD ved UO EINIID YOOIG GOA z OU JUSLUNDOP paea L uoHoUuns POA oS os ZO b OWN amnpow CO OWN lnpou COEI ON ampow gt a ZWOMLS oi Woss oi wous al oi A A X uol o uuoo LE X luono uuoo Ly LN luono uuoo SR i ES ey e Rey I W gt gt qex Kel agx d 3 39 ZS 1S eat gt x gd ecx CXL AN Zz GG SS gt iw gt OENU ZXL AN 2 z 9904X z 9904X z AVOAX z 80AX z ALOAX T 6 dd T T T T Gl ee ee 4 yoms do s Aouebieue youms Ajayes 4 z WePeld LZA 9 peld Uc A 8A uone nB 1 UOnEInOUD y5ojq IS ZS L uonouny juawjsnipe punob A dn yd LA x 90A x SOA oi Ay j x YOA x 01 X LOA s U d d U U L 4904X L qS0AX L qp0AX L q 04X L q 0AX X
65. Menu 3 2 Manual operation wrapper a a aarrssssssssssssa 152 8 11 1 Opening closing the holding ams 153 8 11 2 Switching on off wrapping am 154 8 11 3 Move the wrapping arm to zero position 154 8 12 Menu 3 2 Manual Operation Wrapping Arm CV 210 a 155 8 12 1 Move the Height of the Wrapping Amms a 156 8 12 2 Drive Height Wrapping Arm Into Parking Position 157 8 12 3 Error messages Manual operalion a a 159 813 Man menu Ee ulla eean E EE A 160 8 13 1 Menu 4 2 Manual sensor Test 161 8 13 2 Actuator Test 171 8 13 3 Menu 4 4 Manual actuator fest 171 8 134 Menu 4 8 Re luet et 176 8 13 5 Menu 4 9 Manual operation without confirmation prompt 177 8 14 Main Menu 5 Information EEN 179 8 15 Main Men 6 Jee LLULLU a Eege inaina 179 8 16 Marn M nu Eeer 180 8 16 1 Menu 7 1 Virtual Terminal VT 181 8 16 2 Menu 7 1 1 Select day night display lighting 182 8 16 3 Menu 7 1 3 Softkeys ISO Terminal aa 183 8 16 4 Menu 7 1 4 Switch to different Terminal 185 8 17 Menu 7 4 ISOBUS Diagnostics
66. OC A gt gt gt gt GH SSL3O 40 4bu anjen dols ZEA GH SSL49 10 ya erjen dols LEA q e uiuo p A01d Bueuo si qle Joen uo DI as ju uudinb Buisu s peo S uo1 5 LO LZ9SO0LOSL uoleoo yep aa pza ou ju uinoop SE Sy cl aa une ane py V H E SS eile GH neg HZ NYO V Lor CH x SN Te Wo W ell gt A wo BO N e T T T T rf Z Uewe 1UDuU 49l y u uui inse uu ypiuny yu w snse w y ypiuny allez 1UDU 1 uoiuj nuo5 eq 098 Gi G cn G 2 Q Oll 2 LD o 4 7 gt unelq Et m e Ee HIE H Z T SH vu neja So Gei Le9ZaX ciel Seel iz p SES ZIJPWU0S y o Se 4 L h vp t L h vp c r q9zgX qgzgx T S r 90NA LGd Sv 90N LO pi Ezib eGGdx z BPAA y JUOY nuo ale 699 gt o Wu Wu o a Y gt ZieMyos SE F neq C glom m men Sala Ss de z BEpAA uBii seas nuo eq gsg e G re z es v Je AS JS ASS Z Vi SC 61 g 2 2 SS z L N Er F o N N z unelg Et gt unelq D Ca gam fz z g m X ne
67. Pick up 2 RPN00047_2 Fig 214 Starter roller Spur wheel Cutting system drive Pick up drive Pick up Net roller Main drive oro O O O D The figures in the brackets state the size of the nozzles for the individual lubrication points Note a Make certain the correct sizes are used when changing the nozzles Each size difference doubles the oil delivery rate MM4 deliveres for example twice as much oil as MM3 2 3 Settings 274 Comprima CV 150 CV 210 XC Fig 215 STO O O O D TEN AN E L a IN a Rollbodenantrieb hinten 4 b Starterwalze 6 b Starterwalze 6 c Stirnrad 6 d Schneidwerkantrieb 5 d Schneidwerkantrieb 5 e Pick up Antrieb 2 f Pick up 2 Rear floor conveyor drive Starter roller Spur wheel Cutting system drive Pick up drive Pick up Net roller Main drive f Pick up 2 g Netzwalze 3 h Hauptantrieb 4 h Hauptantrieb 4 EE KRONE RPNO0048_2 The figures in the brackets state the size of the nozzles for the individual lubrication points Note Make certain the correct sizes are used when changing the nozzles Each size difference doubles the oil delivery rate MM4 delivers for example twice as much oil as MM3 b KRONE 13 P P gt gert Maintenance Maintenance WARNING If the basic safety instructions are not followed people may be seriously injured or killed e To avoid accidents the
68. Slip on Gear HDC00028 Fig 232 Note Perform oil level check and change the oil while the machine is in a horizontal position Shut down and safeguard the machine see chapter Safety gt Safety routines Shutting down and safeguarding the machine Oil level check e For time intervals see Chapter Oil Level Check and Oil Change Intervals Gearboxes Unscrew the inspection screw 2 e The oil level must reach up to the control hole e If necessary top up the oil SAE 90 Screw in the inspection screw 2 Oil Change e For time intervals see Chapter entitled Oil Level Check and Oil Change Intervals on the Gearboxes Unscrew oil drain plug 2 and inspection screw 3 Collect the oil in a suitable container e Screw in the oil drain plug 2 e Top up the oil at the oil filler neck 4 up to the control drill bore Screw in the inspection screw 2 297 S EE Maintenance KRONE 13 11 Screw connections at the front and rear of the floor conveyors COM00363 Fig 233 Set the torque wrench to 40 Nm e Tighten the nuts on the screw connection 1 If the torque is not reached loosen the screw connection 1 e Check the threading on the screw and nut If damaged use new parts The necessary materials can be ordered from the spare parts warehouse using the following material numbers Material number Unit numbers per rod Coach bolt M10x35 90 001 687 0 Detent edged washer
69. The symbol is highlighted in grey Press function key OK Menu level 3 Counters is divided into two menus e Menu 3 1 Manual operation baler in case of an opened bale chamber e Menu 3 2 Manual operation wrapper in case of a closed bale chamber b KRONE KRONE ISOBUS Terminal 8 10 1 Menu 3 1 Manual operation baler 1 2 CC000283_1 C000282_1 Fig 109 Comprima CF155XC CV210XC Comprima CV150XC Calling the menu Main menu 3 Manual operation is called You can select menu 3 1 GH by pressing function key T or A The symbol is highlighted in grey Press function key OK Show in the display 1 Display wrapping arm swivel table 2 Display net motor 3 Bale chamber and lifter display 4 Holding arms display 147 KRONE ISOBUS Terminal KRONE 8 10 2 lt 148 C Status messages Note The following status messages of the 4 indications in the display apply for menu 3 1 Manual operation baler for bale chamber opened as well as menu3 2 Manual operation wrapper for bale chamber closed They are not listed once again Possible status messages window 1 wrapping arms swivel table Wrapping arm not in position swivel table forward without bales ei Wrapping arm in position swivel table centred without bales di Wrapping arm not in position swivel table centred without bales j gt o lt Wrapping arm in position swivel table forward without bales
70. X Aiddns Az punos6 Tano aw PAZ pop g OVE L SIG by YX E Q tO oe F EN Bojeue AZ punoi6 1 ONS o KR s ndul 13 138 _ u er N cV EL g e CL YX p slliqe s Ajddns AZL VNV AZL TNE Q Lo o 5 co i 1 z68 e z z l DV cC L a G ZL YX pasiiqeys Ajddns AC Lu VNV AZL N e qg 2 o 7 x _ g m _ _ X p sliqe s iddnsAZI WNW AZL lt N we _ c o 1x Dags ACL IS ACL OC m 62 VX Ajddns punoi6 1 ONS E Z baal BE EN Aiddns AZL MS TAZL lt O Q ow Ajddns g g D e MS Zems am ZL X Z IWYAL LU se j we Bunioddns GLA r VIl 9 X e Git NVI W amen Zen 6 X TZ NWO V LL solo wie Buyoddng dikh W1 ve X D c CL NYO W ge CN H Z NVO ge ges e _ Z vi 9 x S gt NS V 0L 1qe Buims OLA cl WIWMd ce X vV 6 UOHe NIID YOO G GA LL WIWMd O EN d gt GZ X siosu s Boleue ONS YNY ONS ZV 0L UMOp a e d 1 JSue1 ELA 6 VIWMd ZL X gt x HL EN siosu s Boleue ONS YNY ONS SI ew ees u do wie Bulyoddns 91 A ZL YINMd LZ EN JE EN beyoa Bojeue VNVA8 wo t 1 L dn od eysuey ZLA 9 VINMd OL X T st Sa v2 EN Son Bojeue VNVA8 P LU 490 We Buruiodgps SLA S VINWAd 8 X CN Les S n SS e vV OL ajqe Bums LLA VINMd FEN siosuas Goyeue Ajddns o Q ouwen gt l l z N 5 8y 6 wue Buiddesm A E8A uonenbal 9A Z VINA d Z X 3 kV OI oZ x oz Josusas ef oz ONS 91A ai ei OZ
71. XC 20h 9 Tereiong rode t D 334 KRONE Maintenance lubrication Right hand side CPNO0015_4 Fig 264 335 Maintenance lubrication KRONE Lubrication Points Number of Lubrication Grease Nipples Interval Tandem axle pendulum arm bearing right left 2 50h Bearing wrapping table 5 Nipple block left Floor conveyor at front Lower roller Upper roller Cylinder swivel table Nipple block right left Rear rocker arm Bearing drive shaft floor conveyor rear Comprima CV150 CV210 XC Ga Cylinder bale lifter only Comprima CF155 XC i Tensioning rocker Connection sleeve stub end between main gearbox and 20h slipon gear WARNING Settings on the machine Danger to life or serious injuries e The shut off valve on the left hydraulic cylinder must be closed 336 b KRONE 15 15 1 Placing in Storage Placing in Storage WARNING If the basic safety instructions are not followed people may be seriously injured or killed e To avoid accidents the basic safety instructions in the chapter Safety must have been read and followed see chapter Safety Basic safety instructions WARNING If the safety routines are not adhered to people may be seriously injured or killed To avoid accidents the safety routines in the chapter Safety must be read and followed see chapter Safety Safety routines At the End of the Harvest Season Before placing the machine in
72. and lubricants may cause you to lose your footing e Always keep the steps and platforms clean and in a proper condition to prevent people from losing their footing e Never climb up and down while the machine is moving Face the machine when climbing up and down e When climbing up and down maintain a three point contact with the steps and hand rails always two hands and one foot or two feet and one hand on the machine e When climbing up and down never use the controls as handles Inadvertent activation of the controls may cause functions to be unintentionally actuated which could be hazardous e When climbing down never jump off the machine e Climb up and down using only the steps and platforms designated in these operating instructions see chapter Description of machine Ladders Dangers associated with certain activities Work on the machine Work on the machine only when it has been shut down If the machine has not been shut down and safeguarded parts may move unintentionally or the machine may start moving As a result people may be seriously injured or killed e Before performing any work on the machine such as making adjustments cleaning preparing for road travel preparing for work servicing or rectifying malfunctions shut down and safeguard the machine see chapter Safety Shutting down and safeguarding the machine Maintenance and repair work Incorrect maintenance and repair work will endanger operat
73. at most hydraulic system max 200 bar max 60 l min Bale dimensions Irene oron OO Sleeve diameter men nee mme O O Overload protection system universal shaft 2300 Nm 17 blades Cam type clutch 540 r p m 2300 Nm 26 blades Hydraulic Connections Raising lowering the pick up or blade base 1 x single action control unit For design with hydraulic support jack 1 x double action control unit For design with hydraulic knife selection 1 x double action control unit 55 C Commissioning KRONE 5 Commissioning 56 gt P PP WARNING Risk of accident or damage to the machine due to an incorrect initial operation Only an authorized service technician is permitted to carry out the initial operation WARNING If the basic safety instructions are not followed people may be seriously injured or killed e To avoid accidents the basic safety instructions in the chapter Safety must have been read and followed see chapter Safety Basic safety instructions WARNING If the safety routines are not adhered to people may be seriously injured or killed e To avoid accidents the safety routines in the chapter Safety must be read and followed see chapter Safety Safety routines WARNING Risk of injury due to the unsecured machine rolling away If the machine is not secured against rolling away when it has been switched off there is a risk of people being injured by the machine rolling awa
74. bale diameter make certain the stop 6 for the soft core setting is in Pos Ill soft inner bale core A setting may only be made on the sensor 7 only in this position Soft core setting Open the bale chamber Remove the screw 5 e Move stop 6 to Pos Ill soft inner bale core e Install and tighten the screw 5 e Close the bale chamber 167 b KRONE KRONE ISOBUS Terminal lt lt 168 Note Make certain the feeder rake 4 is resting on the stop 6 release floor conveyor if necessary The bale chamber must be closed and empty Dimension X must be 105 mm after the setting Loosen the sensor 7 and turn it in the oblong hole until the bar 1 is positioned inside the rectangle 2 in the bar display Note An audio signal sounds if the bar 1 is inside the rectangle 2 Save value e Press the function key 1 until the symbol EI the upper line appears briefly Note The value is stored when the left bar has adopted the value of the right bar C KRONE KRONE ISOBUS Terminal Setting B28 Height Wrapper Fig 126 Caution The parking position of height wrapper must be approached and saved Note They can only be saved if the bar is in the lowest or highest rectangle of the bar display Lifting Wrapper e Use the softkey to move the wrapper upwards as long as the softkey is activated Lowering Wrapper e Use the softkey V to move the wrapper do
75. can be stored on the left hand side of the machine Switch off P T O shaft in headland position Small flat swaths Reduce PTO speed or e Increase travelling speed Straw varies greatly in structure Even if no cutting system is used it is not always possible to work with the highest possible pressure Adapt the round baler setting to prevailing conditions Note If the cutting system is not connected for long periods the cutting blades can be replaced with blind blades to prevent soiling of the slots on the blade base and wear to the blades The blind blades can be ordered from the KRONE spare parts department under part number 200654050 211 Operation KRONE 11 2 lt 212 Travelling speed The forward speed during use depends on the following factors e type of crops moisture content of the crops height of swaths ground conditions Note The recommended travelling speed is 5 12 km h and must be adapted to local conditions in actual practice e Do not overload the round baler e When baling a round bale reduce speed at the start and end of the baling process Setting in case of slip of the floor conveyor if the grass is very wet and only with little structure e Drive with less blades or turn off the blades or remove them and reduce the baling pressure e Adjust inner bale core to soft see Chapter entitled Adapt Soft Core e Driving without blades CAUTION Damages to the
76. chapter Driving and transportation b KRONE 4 3 14 4 3 15 4 3 16 Safety Parking the machine safely The parked machine may overturn People may be crushed and killed e Park the machine on a stable and even surface e Before adjusting repairing servicing or cleaning the machine ensure that it is securely positioned If in doubt support the machine e Inthe chapter Driving and transportation note the section Parking the machine Unattended parking Adults and children are at risk from an inadequately secured and unattended parked machine with or without a connected front attachment or trailer e Before leaving the machine Shut down and safeguard the machine see chapter Safety Shutting down and safeguarding the machine Consumables Unsuitable consumables Consumables which do not comply with the requirements of the manufacturer may impair the operational safety of the machine and cause accidents Use only consumables which comply with the requirements For the requirements of fuels see chapter Description of machine Consumables Protection of the environment and disposal Consumables such as diesel fuel brake fluid antifreeze and lubricants may damage the environment and the health of people e Do not release consumables into the environment e Absorb leaked consumables with an absorbent material or with sand place in a liquid tight labelled container and dispose of according to the offi
77. control shafts A B to the zero position of blades turn both blade control shafts A B to position Lower the conveyor floor mechanically or hydraulically e Clean the cutter base and especially the cutter slots thoroughly After cleaning Set the desired chop length After the blade control shafts A B have been adjusted the cutters automatically swivel back up into working position If they have not lightly tap any blades that have not already swivelled up with a tool for example a hammer striking the back of the cutters to move them back to working position e Raise the cutter base cO KRONE Operation 11 11 3 Zero position of the cutter WARNING Blades are pre tensioned with spring force Risk of injury when attaching or removing the blades e Wear suitable gloves when touching the blades Blades are installed and removed from behind when the tailgate is open e Open tailgate WARNING Unintentional closing of the tailgate Effect severe injuries Secure the open tailgate to prevent it from closing unintentionally CPK00230_3 Swivel shut off valve 1 in the return of the left lifting cylinder from position a to position b the tailgate is locked hydraulically CAUTION Damage to the Machine e Before lowering the cutter base always raise the Pick up 231 Operation 232 AZ KRONE Abb 17 Lower the cutter base 1 mechanically or hydraulically Move the Blade
78. counter is set to zero e Pressing the function key ESCcloses the called up menu e Pressing the function key ESCand holding it down brings up the basic screen b KRONE 8 9 2 KRONE ISOBUS Terminal Menu 2 2 Total bale counter CC000221 Fig 107 Calling the menu Main menu 2 Counters is displayed e You can select menu 2 2 Zait O O py pressing function key or A the symbol is highlighted in grey Press function key OK The display shows menu 2 2 Total bale counter The total number of bales is the sum of all bales pressed They are not assigned to any customer counter Meaning of the icons Bale counters cannot be deleted G Operating hours counter counts only when P T O shaft is running c 1 Season counter 1 can be deleted Moz Season counter 2 can be deleted Deleting season counter 1 or daily counter 2 e Pressing the function key2C1 sets season counter 1 to zero e Pressing the function key2C2 sets season counter 2 to zero e Pressing the function key ESCcloses the called up menu e Pressing the function key ESCand holding it down brings up the basic screen 145 KRONE ISOBUS Terminal KRONE 8 10 146 Main menu 3 Manual operation E ESC OK CC000281 Fig 108 Calling the menu e By pressing the function key d in the basic screen you get into the menu level of the machine You can select main menu 3 D with function key Por
79. current is shown under the status display if measured State 1 ON Actuator on OFF Actuator off get 4General actuator error FUSE 4 No power supply fuse is probably defective C KRONE KRONE ISOBUS Terminal Possible digital actuators depending on how the machine is equipped No Sensor symbol Description Y01 YE G Pick up valve kl i SE Ground monitoring valve Function valve 05 CO x Valve cutter base position Wrapping arm control valve Close the bale chamber Open bale chamber Swivel table forward Swivel table back Reversing the wrapping table Comprima CV XC Lifter forward Comprima CF XC Wrapping table back Comprima CV XC Lifter back Comprima CF XC Open holding arms Close holding arms Disable holding arms 173 KRONE ISOBUS Terminal KRONE Additional digital actuators for Comprima CV210 XC no Symbol Lift valve wrapper Lower valve wrapper 174 A KRONE KRONE ISOBUS Terminal Possible motors depending on machine configuration CC000765 Fig 131 e Press the Po function button to extend the motor inching operation only e Press the Po function button to retract the motor inching operation only ES State OI ON Actuator on OFF Actuator off ere actuator error FUSE 4 No power supply fuse is probably defective e Pressing the function keyESC closes the called up menu The display shows
80. cutting Check setting of cutting blades blades Starter rollers of film wrapping device Check wrapping device and replace it if are bent necessary Crop between spiral roller and Readjust scraper scraper Net spreader does not work Rotate the net spreader The scraper of cutting roller or Change once again the side in the swath conveyor roller is blocked before net is inserted Tailgate cannot be Hydraulic hose not plugged in Insert hydraulic hose into the appropriate opened correctly coupling The tailgate cannot be Sand stones etc have accumulated Install the cover sheet of the collection closed on the collection plate plate by one bore hole to the rear The bale does not roll The sides are filled too much or the Do not drive sideways too far or rolls just slowly out baling pressure is too high of the bale chamber The floor conveyor Material is too brittle for example a Remove blade ee forage up at straw b Reduce baling pressure ront 343 C S EE Malfunctions Causes and Remedies KRONE Malfunction Possible cause Reme Slip of floor conveyor Very heavy grass without structure In case of slip of floor conveyor drive with Belt slips for example clover grass less blades or turn blades off or remove them or reduce the baling pressure The inner bale core must only be set to soft for Comprima CV150 refer to chapter Adapting Soft Core In case of
81. documented 213 Operation ee rr 214 A KRONE Comprima CV 150 CV 210 XC Note Barrel shaped round bales can cause damage to the floor conveyor Distorted and thick round bales are detrimental to proper silage production Note To prevent overload on the round baler when handling certain types of crop e g wet silage the baling pressure should be reduced The baling pressure should never be set above 200 bar Comprima CF 155 XC Note The binding process should be started at the latest when the baling pressure indicators reach the red range the buzzer sounds if the comfort electronic system Is fitted Note To prevent overload on the machine when handling certain types of crop e g wet silage the binding process should already be started at an earlier point Permanent overload of the machine can drastically reduce the service life b KRONE Operation 11 3 1 Reducing the Pressure on the Side Walls of the Bale Chamber For very critical forage and extremely hard bales the bales can be given additional protection against turning as follows e In order to reduce the pressure on the side walls there should not be extreme driving to the right left e Reduce the number of the outer cutting blades or turn off the cutting system or remove the cutters 11 3 1 1 Assembly of Additional Tappet Strips on the Starter Roller WARNING Unintentional closing of the tailgate Effect severe injuries S
82. key ESC and holding it down brings up the basic screen b KRONE 8 16 4 KRONE ISOBUS Terminal Menu 7 1 4 Switch to different terminal Note e Menu 7 1 4 only appears if several ISOBUS terminals are connected e Menu 7 1 4 can be used to switch to the next connected terminal depending on how many terminals are connected e The first time you switch the configuration of the machine is loaded to the next terminal Loading may take a few minutes The configuration is saved in the memory of the next terminal Note The next time a call is made the machine is no longer available in the previous terminal Note When restarting the system first attempts to start the last terminal used If the last terminal used is no longer available the restart is delayed as the system looks for a new terminal and loads the specific menus to that terminal Loading may take a few minutes Fig 141 Opening the menu Main menu 7 1 Virtual terminal VT is opened e Press the Tt or 4 function button to select menu 7 1 4 j the icon is highlighted in colour Press the OK function button The displays shows menu level 7 1 4 Switch to different terminal Press the function key OK or AR on the touch screen to switch to a different connected terminal e Pressing the ESC function button closes the open menu e Pressing and holding the ESC function button opens the home screen 185 KRONE ISOBUS Terminal KRONE
83. menu level 4 Service e Pressing the function keyESC and holding it down brings up the basic screen 175 KRONE ISOBUS Terminal KRONE 8 13 4 176 Menu 4 8 Diagnostics ES ESC 7 7 Ke SSS CC000294 CC000295 Fig 132 Displaying the menu Call the Service main menu 4 Press function key T or d to select menu 4 8 the icon is shown in reverse colours Press function key OK The display shows menu 4 8 Diagnostics Pressing the function keyESC closes the called up menu The display shows menu level 4 Service Pressing the function keyESC and holding it down brings up the basic screen b KRONE 8 13 5 A KRONE ISOBUS Terminal Menu 4 9 Manual operation without confirmation prompt Danger Unexpected actions on the machine Effect Danger to life or serious injuries machine damages e The person performing must know which machine parts are activated via manual operation without confirmation prompt If necessary the set machine parts have to be secured against inadvertent lowering e There must be no persons animals and objects in the danger zone ESC AU I Seve CC000296 CC000305 a CC000304 Fig 133 Displaying the menu Call the Service main menu 4 Select menu 4 9 i A by pressing function key T or the icon is shown in reverse colours Press function key OK The display shows the menu 4 9 Manual operation without confir
84. multi function levers can be assigned with functions of the connected job computers A programmable key can also be assigned with several different functions If key assignments are saved accordant menus will appear on the screen when switching on the terminal The following functions are available in the Auxiliary AUX menu Auxiliary functions graphic display 9 ENEE P o CO 0 Increase set filling a 200 h KRONE ISOBUS operation 9 3 1 Example of joystick assignment for Fendt default setting Note lt For further guidelines please refer to the operating instructions of the terminal being used Fig 149 201 h ISOBUS operation KRONE 9 3 2 Recommended settings for a WTK multi function lever default setting Note For further guidelines please refer to the operating instructions of the terminal being used Switch 1 on the rear in upper position LED 2 lights up red Fig 150 202 b KRONE Operation of the Hydraulic Zero Setting of Blades Optional 10 Operation of the Hydraulic Zero Setting of Blades Optional Danger Unexpected actions on the machine Effect Danger to life injuries or damage to the machine Always make certain that the drive and the engine are switched off before doing any repairs maintenance or cleaning Remove the ignition key DANGER The hydraulic system is pressurised Risk of injury due to spurting out of hydraulic oil
85. of the single blade locking device must turn slightly when they are turned on tension of safety springs with multipurpose key after blades are installed If they do not the result will be an increased amount of force when switching The individual knife retention will not work properly increased blade breakage To prevent this lubricate the safety rollers 1 if they no longer turn easily However at least once a year Note To lubricate the safety rollers use an EP long term grease NLGI 2 order No 926 045 0 400 grams 300 b KRONE Maintenance 13 14 Checks and maintenance on rear floor conveyor Shut down and safeguard the machine see chapter Safety gt Safety routines Shutting down and safeguarding the machine Comprima CV 150 CV 210 XC Note Perform the following check after producing around 1000 bales to prevent damage or tearing of the rear floor conveyor COM00348 At a bale diameter a between 800 and 1000 mm check whether the distance b between the front tensioning rocker 1 and the rear tensioning rocker 2 is at least 20 mm If the distance is at least 20 mm everything is OK If the distance is less than 20 mm the deflection roller 3 must be adjusted see Adjusting the deflection roller maintenance chapter 301 Am Maintenance KRONE 13 14 1 Adjusting the deflection roller Prerequisites The left side protector is raised The left plastic protector is detach
86. oil level is correct If the inspection glass shows a level below 3 4 e Clean the area around the filler neck e Top up the oil up to the 3 4 mark using the filler neck Oil Changing Interval e Every 500 operating hours e Atleast after each season Oil change Prerequisite The tailgate must be closed Collect escaping oil in a suitable container Unscrew the locking screw and drain the oil Screw in the locking screw e Pour in fresh oil up to the 3 4 mark of the inspection glass using the filler neck cO KRONE Maintenance Comprima CV 210 XC COM00305 1 Fig 250 1 Scale 2 Ventilation filter 3 Drain screw To check the oil level Prerequisite The tailgate must be closed e Read off the oil level on the scale If the scale shows a level between 40 and 45 the oil level is correct If the scale shows a level below 40 l e Clean the area around the ventilation filter Top up the oil up to the 45 mark using the ventilation filter Oil Changing Interval e Every 500 operating hours e Atleast after each season Oil change Prerequisite The tailgate must be closed Collect escaping oil in a suitable container Unscrew the drain screw and drain the oil e Screw in the drain screw e Pour in fresh oil up to the 45 mark on the scale using the ventilation filter 317 Am Maintenance KRONE 13 18 4 318 Changing the filter on the hydraulic tank Compr
87. out of the filter housing e Insert the new filter element into the filter housing and screw in until the filter element clicks into place e Insert the filter housing into the hydraulic tank e Screw in the cover and retighten lightly using a spanner Note The filter element must be ordered from the KRONE spare parts warehouse quoting part number 27 011 472 0 b KRONE 13 18 5 Maintenance Replacing the Hydraulic Oil Filter ENVIRONMENT Disposal and storage of used lubricants and oil filters Effect Environmental damage Store or dispose used oil and oil filters according to statutory provisions d ki lt dE Je lt COMo0006 2 pits COM00021 The filter takes up depositions of solid particles of the hydraulic system The filtering of the hydraulic circuit serves as a prevention of damages on components o the circuit The filter is equipped with an optical contamination indicator 7 The contamination indicator 7 informs optically about the degree of contamination of the filter Note Check the contamination indicator before the machine is used If the display field is green the filter element is OK if the display field is red the filter has to be changed When starting in cold condition the button on the contamination indicator 7 can hop out Only insert the button after achieving the operating temperature In case it immediately hops out again the filter element needs to be changed 321 Am
88. pick up via the operation terminal 323 Am Maintenance KRONE 13 19 A 324 Grinding blades Warning Grinding blades Effect Severe injuries to the eyes e Always wear safety gloves and goggles when grinding the blades Fig 256 Check the sharpness of the blades 2 daily If necessary grind the blades after they have been removed on the back of the cutting edge 1 Grind only the ungrooved side When grinding make certain no notches are made in area 3 Note If at all possible use the KRONE grinding mechanism for grinding The Part No for the blade holder for the KRONE blade grinding tool is 940 003 0 Avoid allowing the blades to heat up too much when grinding them The cutting blades are too hot if you can see discolouration in them Excessive heat reduces the service life of the cutting blades The blades 2 must be checked before installation in area 3 contact point to the stop bar for accumulations and thoroughly cleaned if necessary Otherwise it may no longer be possible to swivel the blade bar in completely b KRONE 13 20 gt gt P Maintenance Maintenance brake system special equipment WARNING If the basic safety instructions are not followed people may be seriously injured or killed e To avoid accidents the basic safety instructions in the chapter Safety must have been read and followed see chapter Safety Basic safety instructions WARNING
89. positions below e Install and tighten the screw 5 Note Make sure that the stop 6 on the right hand and left hand side of the machine is set equally 246 b KRONE Operation The following positions can be set to alter the strength of the bale inner core VPNO0012_3 VPNO0012_2 VPN00012 1 Fig 189 Position Il is recommended for baling as the machine runs at its quietest in this position and the bale start procedure is simpler 247 b Operation KRONE Setting of Spring for Front Floor Conveyor Tension The dimensions X and Z on the right hand and left hand side of the machine must be set to the following values Fig 190 Comprima CV 150 XC X 130mm Z 690 mm Comprima CV 210 XC X 115 mm Z 540 mm 248 cO KRONE 11 17 Operation Blockage Due to Jammed Crop Shut down and safeguard the machine see chapter Safety gt Safety routines Shutting down and safeguarding the machine Comprima CF 155 XC Comprima CV 150 XC CPK00221_1 Fig 191 Remove blockages of the machine due to jammed crop To uncouple remove the cotter pin and bolt 1 for the slip on gear 2 Use a lever 3 to pull out the slip on gear 2 and disconnect with the bolt Switch on tractor PTO e Open tailgate and remove blockage e Close tailgate again e Switch off tractor PTO e Insert the slip on gear 2 again and secure with bolt and cotter pin 1 249 Operation
90. r 3a Bale firmness left B9 X CF155 XC 3b Bale diameter left B9 X Rotary CV150 XC CV210 XC potentiomete r 4mm 18 10Nm 10 Nm Bale chamber open B14 4 mm Slip sensor B5 281 A Maintenance KRONE Rear Side of Machine rima CED m CPNOO eg 014 2 Fig 220 Sensor designation Distance Operating Sensor type Tightening Transmitter terminal torque Sensor CCl Bale on swivel table left B16 Swivel table centre B18 Swivel table front B19 WG ee a 4mm Sheet tear control B24 TI zero position B21 B20 F 282 b KRONE 13 4 1 13 4 1 1 13 4 1 2 Maintenance Adjusting the Sensors Namur sensor d 12 mm P VFS 088 1 Figure 221 The dimension between the encoder 2 and the sensor 1 must be a 2 mm Setting e Loosen the nuts on either side of the sensor e Turn the nuts until dimension a 2 mm is reached e Tighten the nuts again Namur Sensor d 30 mm BPXC0172 Fig 222 The dimension between the encoder 2 and the sensor 1 must be a 4 mm Note The dimension must be set to 2 mm for sensor Net runs B2 Setting Loosen the nuts on both sides of the sensor e Turn the nuts until dimension a 4 mm is reached e Tighten the nuts again 283 284 Maintenance AZ KRONE 13 4 1 3 Sensor Position Cutter base B8 COM00022 Fig 223 CAUTION Damages to the machine When setting th
91. rolling back before uncoupling it Take care when cranking down the parking support There is danger of crushing your feet Only remove the universal shaft when the PTO shaft and the engine are switched off and the ignition key is removed Place universal shaft into the support provided The tailgate must only be actuated when the baler is connected properly to the tractor When connecting the hydraulic hose to tractor hydraulics and when disconnecting it from the tractor hydraulics the system on tractor and machine must be depressurized Move the appropriate control valves into float position Securing the Machine Against the Possibility of Rolling Back Fig 66 Park the machine on firm level ground Place two wheel chocks 1 under the wheels to prevent the machine from rolling away The wheel chocks are located in front on both sides of the machine Always place wheel chocks 1 in front of and behind the tyres This will prevent the machine from rolling away 99 KRONE Driving and Transport 7 2 2 Lowering the Parking Support RPN00037 Fig 67 Remove stake bolt 2 bring the support pipe out of the parking support 1 and then secure again with the stake bolt 2 Crank the support plate 3 tightly onto the ground until pressure on the drawbar has been relieved 7 2 3 Disconnecting the PTO shaft from the tractor Fig 68 e Disconnect the PTO shaft 1 on the tractor side Place the PTO sha
92. safe position outside the moving machine parts e Make sure that there is no one in the danger zone Menu 4 4 Manual actuator test The actuator test is used to test the actuators installed on the machine An actuator can only be tested if power is flowing through it In the manual actuator test the actuator must therefore be controlled manually for a short time to be able to determine if there are any errors in the actuator system CAUTION Unexpected actions on the machine The P T O shaft must not be turning during the actuator test The tractor hydraulics must be deactivated CC000228 Fig 128 Calling the menu Main menu 4 Service is called e Pressing the function key T or 4 to select Menu 4 4 Xex D The symbol is highlighted in grey Pressing the function key OK The display shows menu level 4 4 Manual actuator test Selecting the actuator e Pressing the function key T or d to select Actuor The symbol is highlighted in grey 171 KRONE ISOBUS Terminal KRONE 172 M01 Net setting motor CC000764 Fig 129 Softkey Po moves the engine out The function is contact only Softkey JE moves the engine in The function is contact only Y06 Wrapping arm control valve Fig 130 e Press the function button de to activate the control valve so that the flow rate increases e Press the function button to activate the control valve so that the flow rate reduces The current electrical
93. the ground bales are standing Eliminate sheet damage immediately with adhesive strips The wrapped bales must be used up to 12 months after wrapping Note The storage area should not intended to be in high grass on hedges fences buildings or under trees Compacted bales with the recommended dry matter can be piled threefoldly while loose compacted or too moist bales cannot be piled on top of each other A layer consisting of water permeable material which contains no sharp objects for example sand serves as top layer for all stored bales An additional safety device by protecting strips for birds or polypropylene silage nets is recommended Fence the bearing area in so that it cannot be reached by cattle Check the bale packs regularly Protect the bales against the infestation of bugs by using pesticides according to manufacturer s recommendations The applicable environment regulations must be heeded for this Note Chemicals like fertilizers herbicides mineral oils and solvents accelerate the decomposition of the sheet It is necessary to avoid that such chemicals soak on the sheet Note We are unable to honour claims for damage due to spoiling during storage because numerous factors involved are beyond our control C KRONE Operation 11 18 5 Inserting Sheet Fig 197 Note a Up to 10 sheet rolls can be stored in both sheet boxes 2 to the right and to the left Open sheet box door 1 e Forswivelli
94. they are tight Check the tyre pressure at regular intervals and refill if necessary The tyre pressure depends on the size of the tyres The values are listed in the table Tightening Torque mm per hub pieces ace gien weng a e Nm S20Nm weng Is o sonm somm weng 3 s an ene 292 b KRONE Maintenance 13 8 2 Tyre air pressure Check the tyre pressure at regular intervals and refill if necessary The tyre pressure depends on the size of the tyres The values are listed in the table Tyre designation Minimum Maximum Recommended tyre pressure bar pressure pressure bar Vmax lt 10 km h bar Vmax lt 10 km h 500 50 17 10 PR This recommendation applies especially to the typical mixture of operation field road at the maximum permitted machine speed If necessary the tyre air pressure can be reduced to the minimum air pressure However the associated maximum speed must then be observed 293 Am Maintenance KRONE 13 9 13 9 1 294 h Drawbar Shut down and safeguard the machine see chapter Safety gt Safety routines Shutting down and safeguarding the machine RPN00049 Fig 229 e Tighten screws after 10 operating hours Check screws every 50 operating hours Hitches on the Drawbar KDW02330 Fig 230 Caution If the wear limit of the socket in the towing ring has been reached it must be replaced Work on the drawbar must only be perfor
95. to different parts the shut off valve 1 on the left hydraulic cylinder should particularly be mentioned lt is presented as a safety part which prevents unintended closing of the tailgate Position a Hydraulic cylinder return is opened The tailgate can be closed Always reset the shut off valve after working in the bale chamber or on the tailgate to position a to be able to close the tailgate Position b The hydraulic cylinder return is locked The tailgate cannot be closed Move the shut off valve always to position b when working in the bale chamber or on the open tailgate cO KRONE 4 7 11 Safety Step for working on the linkage WARNING Risk of injury when climbing up and down People who behave carelessly when climbing up and down may fall off the ladder People who climb onto the machine without using the designated ladders may slip fall and seriously injure themselves Dirt as well as operating fluids and lubricants may cause you to lose your footing e Use the designated ladders only Always keep the steps and platforms clean and in a proper condition to prevent people from losing their footing e Never climb up and down while the machine is moving e Face the machine when climbing up and down e When climbing up and down never use the control elements as handles Inadvertent activation of the control elements may cause functions to be unintentionally actuated which could be hazardo
96. ufug p A01d ueyo IOJJuo5 pe q uodo LO L Z900L0SL FCO OU Ju ulInOSop Sieg Joen aen payee Anoe v erg A e p9 v rg ene g Lyd anyeop g OVE G oO bi L OWN lnpoui oO bi L DNM 2ainpow GO bi L OWN ampow GO bi L OWN ampow gt d Fo O I old O I e510 O I L og O I A A 8 yx J uono uuoo GC X J uono uuooS Ov yx uomo uuooS Ly yx uono uuoo Se e I EM I EM I EM I EM e pi ge SC ory WT gt gt qrx qvx qyx qrx g S g E m m m m lt lt gt g q0 X 9 q0Lx i q0 X Z q0Lx LO c FN EN NX EN el g p z e0 x e0 x e0 x e0 x S S S g S gt gt m m m m GLCAX OO AN z Cevax z BON z eltax z 20vax i i i I T T m Kei W pa Z Z Z Z Z Z ju uu sn pe punoiB dnyoid anor V anyep y aaoe g anyje p g x LZA x OZA eyg cvg Lyg org de e T T q T qLZAX q0ZAX l ecrgx l ezrgx l era l eovax w wn LO LO LO 1 BOLNX BOLS POLX uPOLX s iu d A Q qOLXx qOLX qOLXx qOLx m m S S g CO c wn wn L qx 9 LX K C l ey ey Ge E S Z X uo o uuoo 9g LX l uomo uuoo Y Y Y Y 8 VINMd O I L vi O I E E E FOI L OW ampow FOI L OW ampow z z z z ju uu sn pe punosb LZA dnyoid OZA G P
97. 00287 Fig 122 In the manual sensor test the sensors that are installed on the machine are checked for errors In addition the sensors can be correctly adjusted in the manual sensor test There is no guarantee the machine is working correctly until after the sensors have been adjusted Caution The P T O shaft must not be turning during the sensor test Calling the menu Main menu 4 Service is called You can select menu wold by pressing the function key T or The symbol is highlighted in grey Press function keyOK Selecting the sensor Select the sensor by pressing the function key T or lt b The selected sensor is displayed inversely and is tested Setting values The minimum and maximum setting values with the sensor alive metal in front of the sensor are shown in the upper part of the bar display The current setting value actual value is displayed under the bar display The distance from the sensor to the metal must be adjusted so that in the alive state the bar is in the upper mark Next check whether the bar is in non alive state in the lower marked area 161 KRONE ISOBUS Terminal KRONE Diagnostics Namur sensors Possible sensors depending on how the machine is equipped Net runs Wrapping arm in zero position Position of wrapping arm Net length Holding arm left Holding arm right Sheet tear control Lifter forward Comprima CF155XC Bale on lifter Comprima CF155XC St
98. 1 ONS Fl LEY 804 A m G ZX lddns AZ punos6b ONS PL ZX lddns AZ punos6 ONS GZ ZX lod v Aiddns T NAEAZL cet _ w 8 ZX vsz end 4eqn Ajddns T NAZAZL lt O A ddns x FIN Z IWYAL DE LN TZ NYO LX TZ NYO Cd dnysid OZA L vil 9 LX m 8 LX H Z NWO OV ZL yuawuysnipe punosb LZA 8 VWIWMd Z LX ZIX H Z NWO GE A BA uonouni PA L VTWAAd OF LN SERA 39 Ni Z NV _ lt ra S ulunidojJouu JOU Uu Z MLSWMddH ZE LX 8a L Q LXL L INYO Di _ m 9 LN TL NYO G pue xe Jojow jeu Uu L ULSWWMdaH L IX 27 lt G S LN HL NWO 89 1 SIX COM es S s nd no N q lt SM 68 12 Z Z N 4 6 SABA UOHOUNY tA L WOYNLS 9 Ir LX SV S ag EIER Ee Zen Ge LN siosu s Bojeue GND VNV GND aN i Ka DV CT ce LX siosu s Boleue GND YNY ONS 2 f LVL OLG oe lyord 60g _ ao S4S yal Burl eg Z OYAHVNV EE LX SV GI ve LX a6e 0n Bojeue VNVA8 _ pe LX 6g 13 09 _ Te 24 S 1uBu Bull OL L OHJHYNY O LX 9V G Cm LE LN a6e 0n Bojeue YNYAS N Le Xb OG 8 ka siosu s Hojeue Ajddns o o aol y pasoj Joquieyo ejeq g SIG FE LX 2 Z E oa zao 1uBii pesoj Jaquueyo leq z g Z SEI SS L q GL LX LL Josuas jey 61p LL GND SIG are _ _ 6L LXL OSA swrig _ Do lppiuu JOJO OSA LL OYADIC BL LX SV OI iL LX O Josues Ieufp OL ONS 91A y _ JUIXL VL gw _ o Saar dn sequieyo leq Lg OL Oz3d9IG 9 LX cV
99. 10 on the right Never secure the holding tube 3 through the boreholes of the supports 15 89 Start up 6 14 90 as KRONE Positioning the Bale Turner Fig 56 e Push the bale turner 1 on the holding tube 3 to the right until the pivot point I of the bale turner is about a 200 mm to the right outside of machine centre centre borehole on the holding tube 3 e Fasten the bale turner 1 in this position with a screw 8 and nut 9 Note During road travel the baffle plate 13 must always be folded out otherwise the left rear light would be covered b KRONE 6 15 6 15 1 Moving the Bale Turner into Working Position A COBW0008 1 Fig 57 e Swivel the locking bar 12 out of position l by removing the bolt 11 e Fold out the bale turner 1 e Swing locking bar 12 into position ll and secure with bolt washer and cotter pin 11 Adjusting the Baffle Plate The height of the baffle plate 13 is adjustable Making the adjustment e Loosen screw connections on the baffle plate 13 e Move baffle plate 13 to the required position and secure with bolts washers and nuts Note We recommend using the centre borehole a for the baffle plate setting 91 Start up 6 16 92 KRONE Adjusting the parking jack Fig 58 The height of each parking jack 14 is adjustable Note The parking jacks have been pre adjusted in the factory We recom
100. 18 7 Setting the Pre stretch of the Foil a 263 11 18 8 Adjusting the Gearbox on the Swivel table a 264 b KRONE Table of Contents 11 19 Removing the Crop Blockages in the Crop Collection Area 265 11 19 1 Crop blockage Under the cutting rotor a 266 11 192 ele Be lee Let Al ICID ves u u uuu u uuu u uuu inu Qawana aswanwan susaua apaq 268 GC E ut CN 269 Jo Setting the Net Drake 269 12 1 1 Releasing the Net Brake 270 12 2 Central chain lubrication system u a aaa asas asas sasaasssasss sssssss naianei iaaa 271 d en 275 J p i PI CC 275 Te bin manae bj u nancsncteanenas samen onan case sunsets cueiataaia titedion canine tea uncun sustweuscamm G 2 6 13 3 Setting of the Scraper Rail to the Upper Spiral Holler 277 To DR egen nn Ee 279 13 4 1 Adjusting the Ee Te 283 13 4 1 1 Namur sensor d 12 mm 283 13 4 1 2 Namur Sensor d 30 mm 283 13 4 1 3 Sensor Position Cutter base D 284 13 4 2 Checking and Setting Axial Play of the Net Brake 285 e GN elei tg Le tege EE 286 13 6 Tightening torques countersunk screws a a 287 E e T e EE E E E E E EE A A E E TEE E E E 288 13 7 1 Setting of t
101. 6 b KRONE Operational safety Technically perfect condition Operation only when the machine has been started up correctly If the machine is not started up correctly according to these operating instructions the operational safety of the machine is not ensured As a result accidents may occur and people may be seriously injured or killed e Do not use the machine unless it has been started up correctly see chapter Start up Technically perfect condition of the machine Improper maintenance and adjustment may affect the operational safety of the machine and cause accidents As a result people may be seriously injured or killed e Perform all maintenance and adjustment work according to the chapters Maintenance and Adjustment e Before performing any maintenance or adjustment work shut down and safeguard the machine see chapter Safety Shutting down and safeguarding the machine Danger resulting from damage to the machine Damage to the machine may impair the operational safety of the machine and cause accidents As a result people may be seriously injured or killed The following parts of the machine are particularly important for safety Brakes Steering Safety devices Connecting devices Lighting Hydraulic system Tyres Universal shaft If there are doubts about the operational safety of the machine for example due to leaking consumables visible damage or an unexpected cha
102. 6 13 16 1 4 Conveyor Auger Dtve a aa aasan rrarssssssssrrrsssssasa 308 Sek a E Roer DIVE EE 308 19 17 Wrapping Arn EE uer 309 WAS AY Te 311 13 18 1 Shut off valve for tailgate a a 312 19 182 OnbDoad Aydraulie System uu uuu uu aan Qu a i 313 19199 Aydaraulic En 315 Table of Contents 13 18 4 Changing the filter on the hydraulic tank a 318 13 18 5 Replacing the Hydraulic Oil Eiter 321 13186 JEICCUFOMAGMCUGC EE emgeet 323 TTS SPICE SS uuu E 324 13 20 Maintenance brake system special equipmentl 325 13 20 1 Coupling heads non interchangeable 326 13 20 2 Air filter for pipelmes a a raras assassrsssssssssssa 327 13 20 3 Compressed air reservoir a aaa sassa raaassssssssrssssssssiaassssa 328 LG SN Ee TE Tt LL E 329 TAT Beete os u u u uu aun a a aan lia SS E 330 A2 i G ee 330 143 E eieiei RE E 330 14 4 WALTERSCHEID cam type clutch K64 12 to K64 24 EK 64 22 to EK64 24 331 14 5 Lubrication e e a 333 15 Tele rel Re e E 337 151 At the End of the Harvest Geaeon u 2 aouasmwasqawankaswasawaanpawsmahanayaykiwwaqpawkuqqanqhuysasunaa 337 15 2 Before the Start of the NEW Geaeon uu LLL uui Qiawawaqasqakaqussh
103. 9 SIA E HE EN z Josuas e 6Ip Z ONS og 8 8 SIG be vx Z EN Josues jey 6Ip GND og gt X S Z SIC vx X Se 2 siosu s je p Ajddns N Ta e FA o Q S ol EN lt F N 2 r SIG 8 EN N OL EN A ddns ACL punoJ6 Yano gt lt Q n SIG 6 X 8px A ddns AZ punos6 T ONS Z SIC Ov vx 9 EN A ddns AZ punos6 T aNS gt m SIG by YX _ Hi wW FEN Bojeue AZ punos 1 ONS S ndul Vl p siliq s 8 EL EN lddns AZ YNY ACL E e c VL pesiiqeys ZL EN lddns AZ YNY AZL N amp LO WL pasiliqeys 2 N E EN lddns AZ YNY AZL EN Ayayes AZL IS AZL m 62 VX Ajddns punou6 1 ONS m BC tX lddns ACL MS T1AZL lt oO lt Ajddns JL EN Z IWMAL CN LL se j wie Bulyoddns GLA v vil 9 X BE EN 12 NYO FV LU asojo we Hulyoddns L A V1 ve X 8 EN H Z NVO LOL pasoj JOQUIEYS SHPIWAA ZC vil 9 CN e MS V OL aide Bums OLA ZL WIWMd ZE X T PA SV 6 UOHE NDIID y90lq GOA LL WIWMd 0E X i N Ca T S i PVZ a SZEXI ONS Cra I a SZ X siosu s Boleue GND YNY ONO S V 0l onunz9 eqebieqn LA 6 VIWMd ch X CV L a XL OND Zra QL X siosu s Boleue GND YNY ONS eV LL uedo wie Bulyioddns 91 A ZL VINA d L X 2 Z EN y BelloA Boleue YNY AZL c ee S Ole spuemioy aqebieqn ZLA 9 VIWMd OL CN A s 5 pz EN y BelloA
104. Adjusting the Sheet Brake esssssssssneenennnen 262 Adjustment baler 127 Adjustment of bale firmness 118 Adjustment of target bale diameter 119 Adjustment wrapper 134 Adjustments Before Starting Work 210 Affixing the Adhesive Safety and Information Riet 42 Anor ae WE 221 Air filter for pipelines 327 Alarm messages 190 ele ill E 348 Assembly of Additional Ejector Plates in the Ta EE 216 Assembly of Additional Tappet Strips on the Slarter EE 215 At the End of the Harvest Season 337 Attaching the bale Cloth 98 Attaching the safety Cable 45 Auxiliary function AUX 5 200 B Bale diameter 128 Bale Wrapper 251 Basic Safety instructions 14 BASIC Screen Uu L ua aasukkasaqewakaskaaq 111 Basic screen in case of a connected zero setting of blades option 204 Bearing Pressure Relief of the Pick up 224 Before baling 219 Before
105. Blade B on Sensor or line Close blade base using tractor hydraulics Check the setting of the Blade base monitoring sensor Engage activate blade using tractor hydraulics Disengage deactivate blade using tractor hydraulics Check the setting of the blade selection A sensors Check the setting of the blade selection B sensors Perform sensor defective test Blade A off Blade A on Check sensor and line for damage 207 E600d88Z SCH gue L tie u 2 u T s LULU GZ LULL A H Zi 4 98 86Z SSES a WL S9 LULU OF LULL G Z SSF Z00 2Z LULU GEL T ww 8 wv FOO 6L6 WU kk SC6 000 22 Operation of the Hydraulic Zero Setting of Blades Optional Hydraulic System Circuit Diagrams 10 2 Fig 152 208 b KRONE 11 gt gt P Operation Operation WARNING If the basic safety instructions are not followed people may be seriously injured or killed e To avoid accidents the basic safety instructions in the chapter Safety must have been read and followed see chapter Safety Basic safety instructions WARNING If the safety routines are not adhered to people may be seriously injured or killed e To avoid accidents the safety routines in the chapter Safety must be read and followed
106. Comprima CV150 a second drive can additionally be installed It can be ordered via spare parts number 200636500 Machine does not run The setting of the inner bale core is Ensure a softer setting of inner bale core smoothly too tight refer to chapter Adapting Soft Core The bale start is Reduce baling pressure difficult 344 C hh e e KRONE Malfunctions Causes and Remedies 16 2 Malfunctions on the central chain lubrication system Malfunction Possible cause Remedy Low oil consumption Low pressure Pump works with difficulty dirt in the pump area e Clean Pump is not pressed to a full stroke e Adjust according to the operating instructions Pump valve does not close correctly e Remove and clean or replace Oil is too thick e Replace with recommended oil System contaminated e Clean or replace all measuring valves Oil consumption too high Main pipe torn e Repair or replace Oil too thin e Drive with thicker oil e Reduce the pump stroke Machine is dry No pressure Pump not running e Repair adjust or replace Main pipe torn e Repair or replace System has no oil Vent the system see chapter Central chain lubrication system System blocked Dirt e Clean the system and clean or replace all measuring valves Pipe jammed e Repair or replace Pump is not pressed to a full Oil is too thick nozzles clogged e Replace with recommended oil stroke e Clean nozzles 345 S EE Malf
107. Designations for Gearboxes Filling i i Bio degradable Quantity Aaea iTS lubricants Litres Brand name Brand name Slip on gear SAE90 On request Gearbox on wrapping Fluid gear grease GFO 35 arm permanently lubricated with grease 295 Am Maintenance KRONE 13 10 3 Main drive The main drive 1 is located behind the drawbar in the front area of the machine Inspection screw and filler plug 3 are located on the side of the gearbox The oil drain plug 2 is located below on the gearbox 4 Note Perform oil level check and change the oil while the machine is in a horizontal position Shut down and safeguard the machine see chapter Safety gt Safety routines Shutting down and safeguarding the machine Oil Level Check e For time intervals see Chapter entitled Time Intervals for Oil Level Check and Oil Change on the Gearboxes e Unscrew the inspection screw 3 e The oil level must reach up to the control hole e Refill oil if necessary SAE 90 Screw in the inspection screw 3 Oil Change e For time intervals see Chapter entitled Oil Level Check and Oil Change Intervals on the Gearboxes e Unscrew oil drain plug 2 and inspection screw 3 e Collect the oil in a suitable container Screw in the oil drain plug 2 e Fil in oil up to the overrun by means of the control drill hole 3 Screw in the inspection screw 3 296 b KRONE 13 10 4 Maintenance
108. Disassemble the PTO shaft e Install each half 2 and 3 on the tractor and machine side respectively e Check the special section tubes and guard tubes Shorten special section tubes and guard tubes to an extent that the PTO shaft can move freely in the shortest operating position e For additional operating instructions refer to the operating instructions of the PTO shaft manufacturer 65 b Commissioning KRONE 5 4 2 A 66 Mounting the PTO shaft on the machine side Danger Rotating PTO shaft Effect Danger to life or serious injuries Install or detach the PTO shaft only with the engine switched off and the ignition key removed Secure the tractor against rolling Make sure that the PTO shaft is coupled properly the lock of the PTO shaft must have snapped in Make sure that the protective devices are attached properly Never use a PTO shaft the protective devices of which have not been attached Replace damaged protective devices immediately Attach the safety chain of the PTO shaft so that the guard tube does not rotate simultaneously with the PTO shaft Danger Observe drive speed Effect Danger to life or serious injuries This machine is driven at a maximum PTO speed of 540 rpm Note When mounting the universal shaft make sure that the overload protection system will be installed on the side of the machine KRONE Commissioning RP 99 012 Fig 35 Switch off the engine and
109. E ISOBUS Terminal KRONE de mi 7 0 function key once The The wrapping arm moves into parking position by pressing the 0 function key process can be cancelled during moving by using ES The symbol db Wrapper in Parking Position appears in the status bar when the parking position is reached lt b e _ CC000309 158 A KRONE 8 12 3 KRONE ISOBUS Terminal Error messages Manual operation e No defined state no error message r The bale chamber is not closed 2 00 D The lifter is not down DO D S The wrapper is not in zero position TE Zeg STOP Quick stop is not active D The bale chamber is not opened OO D 5 The swivel table is not in position 159 KRONE ISOBUS Terminal KRONE OK OK ESC FSC 8 13 Main menu 4 Service A EZ ES S B SSS CC000284 CC000287 Fig 121 Calling the main menu e By pressing the function key d in the basic screen you get into the menu level of the machine e Youcan select main menu 4 ZE with function key T or gt The symbol is highlighted in grey Press function key OK The display shows menu level 4 Service Menu level 4 Service is divided into three menus H y Menu 4 2 Manual sensor test Zx d Menu 4 4 Manual actuator test gt Menu 4 8 Diagnostics 160 b KRONE 8 13 1 KRONE ISOBUS Terminal OK Menu 4 2 Manual sensor test x ESC CC0
110. EXL 9Z8 sw zzg _ o lo sindino gt V 8 ey zE Ly X CL Josuas jeybip ONS 91A e Q SpJeAu0J siosu s jeybip Ajddns D 7 Sl EJO a1qe Bums OLA t WOULS EE X La LU SM SLA S m Adana St OND 8 N ENZ UO E NIIID YOOIG SA WOULS LE X Co lla LEIEXL GLA SM LIA A ex ET EE Tano CO 3 84 6 wue Duddeuw aajen uonenbaI 9A Z WOH1S E X GEIENL ZLA SWHA SE _ XIN 3 Uipw 9Z CN va Ol Z SN Ajddns ACL punos6 1 ONS z LICXL IA awa g SS Z INNI E CN d LL em co EN Ajddns ACL punos6 T ONS SS CCIEXL OLA SM BLA eo u D k A g MO aq Jeu 97 OZ od GL X va LL 84 CN A ddns AZ punos6 T ONG ee 8 ES En SLA SM PLA wes may EE TONS 0 Bt 74 8 Jeu dn leq zg EL OYADIC OF X OU PLA awe e _ 94 01 lt Se EL X Ajddns ACL punos6 1 ONS 8 ELL ELA SWZA vu Sumdu 9a 0L 8 LL X Ajddns AZ punos6 1 ONS T ICT ZLA E S 5 oO v 6 EN Aiddns Ag punos6 1 ONS x m BS EN Ajddns Az punoi6 CNS oi g LO Gl EN lddns ACL punos6 ONG ae 3 vl L X Ajddns AZ punos6 ONS N9 pY _ a 8 EN vsz Zn e a lddns T NAZAZL cay AZL W ac zr X WSZ La e a lddns T NALAZL Se DI m A PL EN A ddns T NALAZL lt 5 x Q Ajddns oO 0 B To D II ea ee N KE x Z Su Oo VW VW Dou oO NM woy us uol eoo uejd Jajeq SJOSU S X 0L AD ved 45u Gully oL g
111. G SEI S bor LEZXL 6 8 sw8g8g 2 _ Te ZA L aide Bums dn leq 468 841 SIG OL ZX tV 9 1 EL ZX GL 1osu s jey 6ip GL ONS SIq a es a CLUCOL 898 SM LI _ _ v ba Z aide Bums dn opp aL AL o 8 zx CV JI Lb ZX 9 1osu s jey6ip 84 ONS Slaq t i z LL cXl JL SM 918 os _ _ _ 2 ee EFA aide Bums 8 4 91 o r ZX LV JI 6 ZX L 1osu s jey6ip JL ONS OIG e _ _ 6 ZX OLE sm 818 ei 4 8 uolyisod osz Wie Duddeun ozg FL OYADIC 92 ZX CH Ji Z ZX 9 Josu s je ip 94 GND og Ni I 2 i JIL 819 Smyozg E 2 o GK uonisod wie Duddeuw z8 ZL OYADIC 6L ZX cV 9 g Cm ZZ ZX y Josuas jeybip vl GND OIG yN _ _ JOEL DCH swizg s _ QNL 6 ONADIG Z ZX PV OI oZ CN ZL Josuas ey6Ip ZL ONS 91A o e _ S DCL bcg 2 G y uue Bunioddns zzg 8 DYADIC Ee ZX EN 6 1osu s ED 6 GND oO CN ale _ _ i SM zza 2 z SIb e AZ2AI 1uBii we Dumuoddnme ezg S OYAHDIG ZX SV JI ve ZX 8 Josuas eum 8 ONS Old D OCL cca sm eza 2 _ Ni a G4 8 1 9 llo peg v OYNSAHDIG SE ZX 9V ESCH lt 8 ZX S 1osu s IEUDIn G ONS SIG amp k O SV OI 9 ZX y Josuas Jepp v aN9 SIG DICH ved o 8 sjndul co siosuas jeybip Ajddns ef SW A n Z3 01 a LL ZX Ajddns AZ punos6 1 ONS Pi JUEYXL LA SW A x z _ on 93 Lag Y SL SM ZA s ZE ZX Ajddns AZ punos6 T ONS Sa LL 8 OZI Z SMSA X BE ZX lddns AZ puno i6 T ONS N 8 E _ LO 3 0L a X IZ ZX A ddns AZ punou
112. G r C L WO us uoneoo yuejd yOu up ezg Z wsiueyosw Hulddeim siosues yo wie Bunsoddns zzg q dey p A01d KO IX OSL AD 9X SS L AD ved B65unuu y3 129 lO zg DOC DO LOGL OU JU uInoop uonisod wie Duddeiuw zg s i qlv Joen 6002 GO REH paea uonisod oiez wie BuiddeiA 0zg Jeu dn ajeq zg NO 8Q 1 4 OCF 9a ONS amnpow 9a OWN einpow Sieg OWN npou 9q e OWN lnpou 9q e OW lnpou ZO OWN lnpoui ZO b OWN lnpoui S OYSHOIC O I 8 DYADIC O I v OY4H91Q O I ZL OYADIG O I t Old O I OYADIG O I oz Old O I Z ZX uolno uuoo CC zx uolo uuoo CC ZX Juolb uuoo GL ZX luono uuoo 9Z Zx luono uuoo Ov X luono uuoo GL CN luono uuoo 1 EM L EM U EM U V U V U V U EM LE qzx HI qzx Se qzx 6b qzx D I qzx 0 gex 6b agx gd BC CN a eccgx g BbCHN d e cgx d eozgx d aka d e9zgx 7 46u z7 ya 2 Bunuu yg g i uonisod 2 uollisod O19Z 2 we Bunioddns we Buroddns JE9 10 we Buiddesim wwe Buiddeim Jay dn ajeq AO Jeu ezg ccd tcg LC OCH JC OCH T r I I I I 1 L ec zgx I ezzgx I erzgx LU ezgx L eozax LU amp 27ax L e9zax CO CO CO CO CO CO CO Ge
113. I Vehicle ID number II O Note The entire identification plate represents a legal document and should not be altered or rendered illegible When asking questions concerning the machine or ordering spare parts be sure to provide type designation vehicle ID number and the year of manufacture To ensure that these data are always available we recommend that you enter them in the fields above Note Authentic KRONE spare parts and accessories authorised by the manufacturer help to ensure safety The use of spare parts accessories and other devices which are not manufactured tested or approved by KRONE will result in the revoking of the liability for damages resulting thereof b KRONE Safety 4 10 Technical data All information illustrations and technical data in these operating instructions correspond to the latest state at the time of publication We reserve the right to make design changes at any time and without notification of reasons Axle Tandem axle axle base 1100 Permissible weights see information listed on the identification plate Pick up width 2150 mm Width approx 2950 mm Track width 500 55 20 12 PR Height approx Bale dimensions Diameter approx hydraulic system Roll diameter max 310 mm 3000 m roll Width 2 x 750 mm 500 mm also possible Pre stretch 50 or 70 Sleeve diameter 75 80mm Overload protection system universal shaft 1950 Nm 17 blades Cam type clutch 540 rom 2300 Nm
114. ISOBUS operation 9 ISOBUS operation General aspects The ISOBUS system is an internationally standardized communication system for agricultural machines and systems The designation of the related series of standards is ISO 11783 The agricultural ISOBUS system makes an information and data exchange between tractor and device of different manufacturers possible To this end both the necessary plug connections and the signals are standardized which are necessary for the communication and command transmission The system also enables the operation of machines with control units terminal which are already existent on the tractor or have been attached in the tractor cabin The relevant details can be found in the technical documentation of the control unit or on the device itself Those KRONE machines which are ISOBUS equipped are adapted to this system Note The KRONE ISOBUS systems pass the ISOBUS COMPATIBILITY TEST DLG VDMA on a regular basis The operation of this machine requires at least implementation level 3 of the ISOBUS system DANGER AN When using terminals and other control units which have not been delivered by KRONE mind that the user e has to take the responsibility for the use of KRONE machines when using the machine on control units terminal other control elements which have not been delivered by KRONE must check the machine before operation on all machine functions if they are performed as described in th
115. If the safety routines are not adhered to people may be seriously injured or killed e To avoid accidents the safety routines in the chapter Safety must be read and followed see chapter Safety Safety routines WARNING Risk of injury resulting from damage to the brake system Damage to the brake system may impair the operational safety of the machine and cause accidents As a result people may be seriously injured or killed Adjustment and repair work on the brake system must only be performed by authorised professional workshops or recognised brake services e Have the brakes checked regularly by a specialist workshop e Have damaged or worn brake hoses replaced immediately by a specialist workshop irregularities or malfunctions in the brake system must be rectified immediately by a specialist workshop e Only a machine with an intact brake system may be used for work in the field or for travelling on roads e No changes may be made to the brake system without the approval of KRONE e KRONE is not responsible for natural wear defects caused by overload or changes made to the brake system 325 Am Maintenance KRONE 13 20 1 Coupling heads non interchangeable RP A 031 RP A 032 RESERVOIR coupling head colour red BRAKE coupling head colour yellow Fig 257 The coupling heads are installed in the dual line compressed air braking system to connect the reservoir and brake line of the tractor with t
116. KRONE spare part storage by stating the following spare parts no Spare part Spare parts no Ejector plate 2754790 A KRONE Operation Comprima CV 150 XC BA x lt I Fig 156 lf the completed bales do not fall out of the front bale chamber two ejector plates 1 can be assembled right and left in the tailgate of the machine e Install the ejector plates 1 with the screws 2 on the insides of the bale chamber into the existing bore holes e lfthe completed bales do even not fall out of the front bale chamber after having installed the ejector plates 1 remove the sliding plates 3 from the machine housing right and left The ejector plates 1 can be ordered with suitable screws from KRONE spare part storage by stating the following spare parts no Spare part Spare parts no Ejector plate 2754790 217 Operation KRONE Comprima CV 210 XC HDC00062 HDC00063 Fig 157 lf the completed bales do not fall out of the front bale chamber two ejector plates 1 can be assembled right and left in the tailgate of the machine e Install the ejector plates 1 with the screws 2 on the insides of the bale chamber into the existing bore holes e f the completed bales do even not fall out of the front bale chamber after having installed the ejector plates 1 remove the sliding plates 3 from the machine housing right and left The ejector plates 1 can be ordered with suitable screws from KR
117. L fq e uiuo p A01d Bueuo WO eh Fer einsseid Buljeq uondo LO LZ900L0SL ot SS uo1 eo0 ayep TEE pza OU Ju ulInOoop mamapas OLZAO QH OSLA 8q Jm GH SS dO 8q Inu OLZ QH OSLAD einsseid Buljeq OC A GH SS dO 40 1uBu sinsseid zeg GH SS dO 40 Hal einsseid Log 9q t L OW amnpow 9q r L9 ANM lnpou 9q r L9ANM amnpow L WOULS 9 O I Z ILINW O I IANN O I vl yx uono uuooS ve yx uo o uuoo CC X uoo uuoo E E d SS i ev ev a Wh apx Wars SET qyx L L CO ow a a e qcsdax e qL Sgx r T 7 ezogx e eLGax xo lt 5 CO CO e qI Sgx e qil Sgx z OOC AN T T e OC AN z OLCAN T T T 4 Z 4 Y aunsseid Buljeq n 3 CH n A heli Y jy6u anajen dols Y yo A JPA dols OC A CEA LC Zil Z 1 e dr Go de Go de de OOC AN qil Sgx qil Sgx qZ Ax OLCAN 8 os lt z UPP z 2 bSax S de dr A e qzsgx q Sgx gig SE gt gt CO CO S qvx ee 6 qrx I ey ey I ey GL X uon o uuoo Z YX uoll9 uuoo 6 bX uoll9 9uuoo L WIWMd O I e D Pa V TWAAd O I Z VIWMd O I q t L OWN amnpow 6 Z o q t L OWN amnpow q t L OW amnpow OLZ QH OSLAOD E E E E einsseid uleq
118. N lt CO e GecAX z q AxX H q8 AX AN ON CN z1 Jomo Ju z oo wsiueyo w Buiddeum uusiueuoS ui BuIddEeuA wie Bunioddns x EZAT x CCA x 8LA L L L e e de qEZAX qZZAX q8 AX D m 5 sy E BEX ZX AX m m l x Loes ZX Ax lt T m qzx Zy qzx g HEX CY N iN ey ey ey L ZX uoo uuoo Zy ZX uono uuoo g CN uoll9 uuoo Y YLSWMdaH O I YLSNMdgH O I S VINMd O I 2Q L OWM 2npow q e L OWM 2inpow gar L OWM lnpoui Jamo Wsiueyoow Duddeiw EZA UI Wisiueyoow Duddeiw ZZA yoo wie Bunioddns 8LA ge LA CN P SW IL SN N m T 39 A paea qZ LAX so 5 wie Bunioddns ZAS qZ LAX pe qex an CM ve X Uuol lo uuoo vi O I PO bi L OWN ampow asojo wue Bunioddns ZLA zor A P V l SW SLL SN S A 39 9 I q9 L AX u do wie Bunioddns 9LA q9 L AX CM L X UOlJOSUUNOD Z WIWMd O I COP L OWM 2inpow uedo wie Buryoddns 91 A Teer sta P V Pi SW ELL e 20191 z ISLAX se 1 we Bunioddns GLA K L qSLAX 9 qex fa v 9 X Uuol j9 uuoo v vi O I PO bi L OWN 2inpow se j LUS Bunioddns GLA uo cl us uoleoo ued Si nejp u q deu
119. NE Connecting the Multi Function Lever to the CCI Terminal on tractors without ISOBUS system 8 2 2 CC000546 Fig 75 Note amp The terminal is connected to the multi function lever via a special cable set 9 which can be ordered by stating the Krone product no 20 081 676 0 Connect plug 2 of cable set 9 with the socket 1 CAN1 IN of the terminal Connect socket 3 of cable set 9 with the plug 4 of the cable set 5 Connect ISO plug 8 9 pole of cable set 9 with the ISO socket 7 9 pole of the multi function lever Connect plug 6 7 pole of cable set 5 with the socket 7 7 pole of the machine 107 KRONE ISOBUS Terminal KRONE 8 2 3 108 Switching the terminal on off when the machine is not connected OKRONE GO CC000023 Fig 76 Note Before switching the terminal on for the first time make sure that the connections on the device are fastened right and securely By pressing and holding for approx 2 sec the key 1 x ON OFF the terminal will be switched on or off Note For further information on the functioning of the ISOBUS terminal CCI refer to the terminal operating instructions included with delivery Betriebsanleitung Version 1 0 CC ISOBUS ISOBUS Terminal CCI 100 200 A4AS 08WS BPXC0317 Fig 77 b KRONE KRONE ISOBUS Terminal 8 2 4 Switching the terminal on off when the machine is connected O KRONE Ome J
120. OI IZ LX A 1osu s e bip Z ONS Ola o e ZX Sg swisg 2 SS 4 9 due sq Z ONADIA OZ LX LV GI Cen CL LX 9 Josuas Dn 9 GND SId gt D L LXL 19 swuig io _ _ gt x r o EE ul6u l you Lg 9 OYAHDIG ZL LX kV OI SZ LX Josuas e ip ONS Old _ S XL LL sw zl Q _ _ SUR Z3 S Buluuni jou zg L OYAHDIC OL LN V 9 23 XI zia SWZ CC LX z Josuas IEUuDp zZ ONE SIG bAb ba O T Josu s IEU DI z S A Lo a W G H LX L jey 61p L GND og ei g Sumdu lt a co LEILXL OCA siosuas jeybip Ajddns ya ioe 93 SM ON D a Z Xx lddns AZ punos6 1 ONS S SOU IXL ONG KE u z o 5 lt ZZ EN Ajddns AZ punoi6 1 ONS X 92 LN Aiddns Az punos6 ONSE N Q SMWLZ Si z lo 94 L 8 8 LX A ddns ACL punos6 1 ONS Es B LXL LCA _ A a ot X A ddns AZ punoi6 T ONS gaz SB ia Sr vl LN IWHAL Aiddns AZL IWHAL NAAZL 62 LX Ajddns ACL punos6 ONS BA L RULL NAAZ s _ _ guer gc LX voe 9N4 BIA lddns ug AZL Se 8C De 6 LX 1ndu BelloA p uollAs AS SS lt S SCC GCILNL GND 3 NH3 AL S fat Al Ajddns l 9g Z 39 AS SS lt 8d L 6 LXL ASSS lt m oO O LLI
121. ONE spare part storage by stating the following spare parts no Spare part Spare parts no Ejector plates 200679180 Countersunk screw with hexagonal 9040453 socket Note lt If the ready bale jams in the tailgate and is raised when the tailgate is opened the discharge plates 1 must be removed 218 cO KRONE Operation 11 4 Tying and depositing bales Just before the net is fed ensure that you are driving centred over the swath This will ensure that the net is drawn along evenly over the edges e Start the tying and or wrapping process see chapter Operation Continue receiving crops until the tying or wrapping material from the crop is conveyed into the bale chamber and caught by the round bale The nominal speed of 540 1 min must be maintained until the tying process is complete e Stop the tractor and wait until the tying or wrapping process is complete e Transfer round bale to the wrap system e When the bale chamber has been closed again start the next baling process e The round bale on the swivel table is wrapped in film during the baling process e In automatic mode the bale is deposited by the swivel table after the next tying process has started The bale can be deposited manually at any time outside the tying process also in automatic mode e If the bale is deposited while the tractor is moving the film must be checked as the film may be damaged depending on the surface Note a If sheet is wr
122. On board Hydraulic Sytem 313 le e eesi a 209 Operation of the Hydraulic Zero Setting of Blades O u ua E 203 Operational safety Technically perfect condition E 16 Overload protection 222 P AICI uu ations E T 99 Parking DraK uu U uuu u S a niiina 44 Parking Support 47 Parking the machine Safely 21 Personal protective equipment 19 Personnel qualification 14 Physical messages 194 Pick up 223 306 Placing in Storage 337 Platform on the Wrapping Table 51 Position of the Adhesive Safety Stickers on the Ee NNG uuu u aus En rara SAE 28 Position of the Sensors 279 Preparations for road travel 96 Preparing the machine for repair maintenance and adjustment wolk 27 Pre signaling eissir 131 E te 65 Purpose of Use 13 R Rear Floor Conveyor Drive 305 Reduce the Pressure on the Side Walls of the Bale Chamber 215 Releasing tension on th
123. RONMENT Disposal and storage of lubricants Effect Environmental damage e Store lubricants in eligible containers according to statutory provisions e Dispose used lubricants according to statutory provisions DANGER Settings on the machine Danger to life or serious injuries Swing the shut off valve 1 on the left hydraulic cylinder from position a to position b in order to secure the open tailgate against unintentional shutting 329 C Maintenance lubrication KRONE 14 1 Lubricants 14 2 General aspects d 14 3 330 Depending on the design the machine may be equipped with different lubrication systems Soft supple NLGI Class 2 lithium soap greases in accordance with DIN 51825 should be used as lubricating greases We recommend that you do not use lubricating greases with any other base material Note Do not use greases containing graphite There may be problems when different greases are mixed together Lubricants based on Bio lubricants mineral oil FINA Marson EPL 2A Shell Alvania Ep2 ARAL Long term grease H BP Energrease LS EP2 Glissando EP2 On request ESSO EGL 3144 Lubrication points on the machine must be lubricated at regular intervals The position of the lubrication points and the lubrication intervals can be seen in the lubrication plans in the operating instructions Remove the grease that comes out of the bearing points after lubrication Lubricating the PTO shaft
124. SE LS ne de d z Ka ZIeMYJS r gt ZIeMYJS s aScl 90N Ld VSCl 90NLG dh dh CY d S Ge CEPS am q PYX i iz le p e J9 le 18 16 lalulg acPYX iz je l le Jo jz leie lorier izi r e T sassa RG Z pl el zi p 990X P Z LU PB6SgxX A 2 dede S 9 da le 16 dorli li Jt i 18 2 8 6 dorli di III 11 l N A ein ex IIJ l l J kal A N Vi kal AG W on rm T TT l z Be8AA I ra ji lt 2 Z 9 9 2 2 2 SEET y Ia nuo eq x x x x x x x x x x x Xx x Se PPO0OZZ322m0 0 ier ee so D HRH KB G G G G lt Ze CG mr mim mm rr T O ke lt O O o 19g x EE E eat sl e Fle ty e m m me m T6 Z02625 oO C QO O O o C Lo 4 2 S S S O C G a r a ZIEMYOS CG n i nelq Bunssewejyone4 V 3 7 SE NVO SWG Jouidug j u ui inse uu 39104 vy pV Ma une q b KRONE 19 Index A ACOUSTIC warminmngds u uuu uu ata aysa 190 Activating customer counters 144 erf tel 171 Additional digital actuators for Comprima CV210 EE 174 Additional equipment and spare parts 15 Adjust sensor B9 B10 bale diameter 167 Adjust Soft Core 246 Adjust the Gearbox on the Swivel Table 264 Adjusting the baffle plate 226 Adjusting the deflection roller 302 Adjusting the Sensors 283
125. SKM 10 00 909 909 1 Locknut M10 A3G 00 908 758 0 Note The tightening torque for the screw connection is 70 Nm and it is absolutely essential that it is observed Loctite high strength high strength thread locker 50 ML bottle can be ordered from the spare parts warehouse using order number 935 512 0 298 C Am KRONE Maintenance For changing all screws on the floor conveyor of the machine the following unit numbers are needed Designation Material no Comprima Comprima CV150XC CF155XC Floor Floor conveyor conveyor at front at rear Coach bolt 90 001 687 0 220 100 164 264 M10x35 Detent edged 00 909 909 1 220 100 164 264 washer SKM 10 Lock nut M10 A3G 00 908 758 0 220 100 164 264 Comprima CV 210 XC Designation Material number FWWIIIIGIWIwWC O OE conveyor conveyor Coach bolt M10x35 900016870 laee Coach bolt M10x60 Detent edged 00 909 909 1 116 washer SKM 10 Countersunk screw 90 000 521 0 116 Torx M10x25 13 12 Novo Grip belt on the floor conveyor The Novo Grip belts consist of a composite material rubber and tissue Under load franges come into being on the cutting edges They must be removed regularly e Check the Novo Grip belts at least once a week on the formation of fringes and cut off the fringes if necessary 299 Am Maintenance KRONE 13 13 Checking the Safety Rollers of Single Blade Locking Device RPN00079 Fig 234 The safety rollers 1 on the levers
126. SOBUS Terminal Menu 1 2 3 Number net winds Fig 91 Displaying the menu The main menu 1 2 Settings is active You can select menu 29 n by pressing function key Tok The symbol is highlighted in grey Press function key OK The display shows menu 1 2 3 Number of net winds Ea The SE the upper line indicates that the displayed status is saved Setting the number of net winds The number of net wrappings is indicated in revolutions e g 3n Set the desired number of net winds with function key db The symbol in the top line L disappears OL s e Press function key OK the adjusted status is saved the symbol in the upper line appears e Pressing the function key ESCcloses the called up menu e Pressing the function key longerESCand holding it down brings up the basic screen 129 KRONE ISOBUS Terminal KRONE 8 7 3 lt 130 Menu 1 2 4 Sensitivity of the Direction Display Only Comprima CF155 a a ea l l CC000260 Fig 92 Setting the sensitivity of the direction display Calling the Menu The main menu 1 2 Settings is called Select menu 1 2 44 by pressing function key Tt or the symbol is highlighted in grey Press function key OK The display shows menu 1 2 4 Sensitivity of the Direction Display The bar display shows the set sensitivity The higher the bar the greater the sensitivity of the direction display The symbol in t
127. SS7 c00 2e lOO616 ry E ww p EGE 16 WW OLE WW GZ Ege 6a M A91 ZW3 OGS zt LOO000 ZE 8v FLc6 IEW 89L 0VO6L6 SZ E L _ OvG ugu x468 000 Le TX I canal 4eq 002 eects VSIELA Fig 269 350 C mo gt LS Tailgate Hydr blade base lowering Wrapping arm 6 Chain swivel table Valve block 8 Holding arms 9 Tilt swivel table Bale transfer Front clamping arms Rear clamping arms 351 KRONE
128. Turn the handwheels 2 and 3 all the way in observe minimum baling pressure see below if the baling pressure has fallen below 50 bar e Receive crop with the machine until the baling pressure builds up to about 10 bar higher than the desired baling pressure e Set the desired pressure by using the handwheel 3 Clockwise increase the pressure Anticlockwise decrease the pressure Note lt The baling pressure will only adjust itself when crop is being supplied to the chamber The maximum pressure must not exceed 180 bar The minimum pressure must nol fall below 50 bar Do not use the machine to perform work at a baling pressure of less than 50 bar 236 b KRONE Operation Comprima CV 150 XC CPK00221_1 Fig 177 After an extended standstill time prior to placing the machine into service again only if the baling pressure has dropped below 50 bar To uncouple remove the cotter pin and bolt 1 for the slip on gear 2 Use a lever 3 to pull out the slip on gear 2 and disconnect with the bolt Switch on tractor PTO Open tailgate once and close again to build up minimum pressure Then set the desired baling pressure as described above Switch off tractor PTO Insert the slip on gear 2 again and secure with bolt and cotter pin 1 Note A pressure range of 50 180 bar is preset for the baling pressure setting Crop Pressure range bar Hay low Straw medium high 23 Operation KRONE Com
129. _1 b KRONE 6 8 6 9 6 9 1 1 Start up Net Brake CP103360 Fig 51 e Before starting up for the first time remove the sheet cleanly from the brake surface 1 of the net brake disk 2 Running in Period The time during which the first 100 round bales are formed may be considered the running in period i e until the colour on the bale chamber walls is ground off Note The machine is designed for the specified bale diameters and firmness levels Wrapping bales of excess size or increased bale pressure too frequently will result in increased wear and may result in premature damage to the machine floor conveyor and drive Cam type Clutch Engaging If the cam type clutch engages slips through during the baling process proceed as follows e Turn off the PTO shaft e Allow the PTO to run at idle until the cam type clutch has engaged e Allow the PTO to run at nominal speed 85 b Start up KRONE 6 10 Wrapping table Shut down and safeguard the machine see chapter Safety gt Safety routines Shutting down and safeguarding the machine CP100010 1 e f the wrapping table 1 was used as a transfer table e g in straw without film wrapper the straw remnants must be removed before it is used in silage with film wrapper 86 b KRONE 6 11 Start up Using the bale cloth The bale cloth protects the film on the wrapped bale from damage when the bale is put down on
130. a Shut down and safeguard the machine see chapter Safety gt Safety routines Shutting down and safeguarding the machine CAUTION Sharp parts Effect severe risk of injury Always wear protective gloves when removing blockages Fig 206 Crop blockages can occur in the following areas 1 under the cutting rotor 2 at the pick up Note lt If there is a crop blockage under the cutting rotor also check the pick up for a possible crop blockage 265 Operation 11 19 1 266 as KRONE Crop blockage under the cutting rotor Proceed as follows to remove the accumulated crop e Turn off the PTO shaft e Drive backwards e Raise the pick up Engage the PTO shaft and test whether the blockage clears while idling If the blockage is not removed due to this e Turn off the PTO shaft e Hydraulically lower the blade base If the blockage is not removed due to this e Also move the blades to zero position a For version with manual blade control system Switch off the PTO shaft and the engine of the tractor e Remove the ignition key e Move the blade control shafts to the blade zero position setting A B see Changing the blade chapter b For version with hydraulic blade control system e Turn off the PTO shaft Hydraulically lower the blade base Engage the PTO shaft and test whether the blockage clears while idling f the blockage is not removed due to this S
131. appears by pressing function key The transfer is cancelled and you can proceed e Press function key mE e The bale chamber is opened and the transfer to the swivel table is adjusted Query message manual operation oo CC000300 Fig 145 The query message M2 appears if the manual operation with confirmation prompt shall be started or if the wrapping process is not yet completed The query message disappears by pressing function key XC Manual operation will not be started and you can proceed e Press function key T e The manual operation is started b KRONE 8 18 3 KRONE ISOBUS Terminal Prompt message Repeat wrapping CC000816 Fig 146 GO Prompt message M3 appears if the function button th is pressed again after wrapping to start a second wrapping process e Pressing the gt function button clears the prompt message The wrapping process is not stored GO e Press the function button th to start the second wrapping process The bale is wrapped again Caution The film must be cut off before the second wrapping 189 KRONE ISOBUS Terminal KRONE 8 18 4 8 18 5 190 Alarm messages E a G NW 000000 CC000240_ 1 Fig 147 Alarm message If a fault occurs on the machine an alarm message appears in the display and an acoustic signal sounds at the same time continuous horn Descriptions of the faults their possible causes and how to resolve them
132. apped around the bale a second time the sheet must first be cut off manually 11 5 Before Baling 11 5 1 Detaching the bale cloth CPN00024_1 Fig 158 e Remove the bale cloth 1 from the side hooks 2 219 Operation KRONE 11 5 2 lt 220 Tensioning the floor conveyor Comprima CV 150 CV 210 XC Note Clamp the floor conveyor of the bale chamber before the P T O shaft is turned on Fig 159 To do this e Screw in the handwheel 2 completely working position After an extended standstill time of the machine and before it is started up for the first time Open the tailgate and close it again once see menu Manual Operation Baler open close bale chamber e Turn on the PTO shaft This will build up the baling pressure to the factory setting or the last pressure set The baling pressure can be changed with the turn dial 3 See Chapter entitled Baling pressure setting Due to the hydraulically design of the accumulator connection block it can occur that the baling pressure drops throughout a certain period of time In order to reach the set baling pressure again open the tailgate once again and close tt cO KRONE 11 6 11 6 1 Operation After Baling Releasing tension on the floor conveyor Comprima CV 150 CV 210 XC g a Abb 160 The tension on the front and the rear floor conveyor must be released after baling work is complete e Loosen handwheel
133. aqaqqushuktahaykaqaqqkaquwqa 338 15 2 1 Maintenance work before the beginning of the NEW SEASON 339 15 2 2 Venting the overload coupling on the PTO shalt 340 16 Malfunctions Causes and Remedi es J J J J J Q T T J J 341 16 1 General malfunctions eege eege Eesen 342 16 2 Malfunctions on the central chain lubrication system 345 163 Malfunctions on the Wrapping Mechanism sssssssnnssnsnnnsnssrnrnnesrnnrsnsrrnrrrrnrnnrrennnnrenrnrnrernrnnnrenne 346 16 4 Error Messages of KRONE Operation Temmmal 346 TZ DISD OSAl OF TING un Te ln E 347 11 Disposal OR the IAC MMIC EE 347 16 PADD E Le GE 348 18 1 Hydraulic System Circuit Dagorams a a assrrrsssssssssssssssaa 348 18 2 Electrical circuit diagram a rr rrsrrsssssssrsnsssssssssssssssssssssa 354 7 Jji E 355 b KRONE 3 1 3 2 3 3 To this Document To this Document Validity These operating instructions are valid for round balers of types Comprima F 155 XC X treme Comprima V 150 XC X treme Target group of this document This document is intended for the farmer and for other users who have no agricultural training but who have been instructed in the use of
134. ard the machine see chapter Safety Shutting down and safeguarding the machine Lower the support jack Depressurise the tractor hydraulics Switch off the electronic systems Only uncouple the hydraulic hoses if the hydraulic systems on the tractor and the machine are depressurised Uncouple the compressed air brake depending on the version of the machine Uncouple the hydraulic brake depending on the version of the machine Disconnect the lighting cable from the tractor Disconnect the power cable from the tractor Uncouple the universal shaft and place it on the holder provided Never stand between the tractor and the machine when uncoupling the machine from the tractor b KRONE 4 4 5 4 4 6 Safety Preparing the machine for repair maintenance and adjustment work WARNING Risk of injury during repair maintenance and adjustment work on the machine If the machine has not been shut down the machine or machine parts may move unintentionally As a result people may be seriously injured or killed If the machine is not supported securely the machine or machine parts may roll fall or drop As a result people may be seriously injured or killed e Before starting repair maintenance and adjustment work perform the following steps e Shut down and safeguard the machine see chapter Safety Shutting down and safeguarding the machine e The raised machine or machine parts must be securely supported see cha
135. are described in the Alarm messages chapter Note All functions in the menu that is covered over are still active The softkeys that are covered by the alarm message are disabled To reset the alarm e Briefly press the X function button the alarm is reset and the acoustic signal is stopped If the fault occurs again the alarm message will appear again To delete an alarm e Hold down the button for the AC softkey for 5 seconds the acoustic signal stops immediately and the alarm is deleted If the fault occurs again no alarm message will appear The alarm message does not appear when the fault occurs until after the control unit is turned off and back on Acoustic warnings IUU Wrapping is triggered _ ee Ge ee ee ee Filling reached pre signal reached wrapping complete bale chamber closed Continuous tone Rapid interval TLO LI P Medium interval Jj LTF L Long interval C KRONE KRONE ISOBUS Terminal 8 18 6 Note and messages No Symbol Acoustic signal Description 2 MAX The maximum filling has been k T L Net has not been trailed Error while inserting the net No net separation takes place Weg Bale chamber not closed 11 Quick stop valve active STOP 3 ae a Wrapping arm not in zero position s 9 ffe SS EE Time problem bale chamber open not reached 191 KRONE ISOBUS Terminal KRONE 192 cy 18 One sided sheet tear U 1 2 19 T
136. ate C 1 E Ave iron 2 vk Not alive no iron 3 e em Broken cable 4 H Short circuit 162 KRONE KRONE ISOBUS Terminal Diagnostics analogue sensors Setting values The bar must be inside the marked area of the bar display Possible analogue sensors depending on how the machine is equipped Position of net motor Bale diameter left Comprima CV150 CV210 XC Bale firmness left Comprima CF155 XC Bale diameter right Comprima CV150 CV210 XC Bale firmness right Comprima CF155 XC Height of wrapper arm Comprima CV210 XC 0 7 O K Alive iron Broken cable short circuit ERROR Notalive no iron 163 KRONE ISOBUS Terminal KRONE gt 164 B3 Adjusting position of net engine Retracting extending the motor and saving positions state 1 ror 2 SU 2 5V ESC 1 0V 41 9U 2 5V 4 3V CC000290 Fig 123 Caution The feed and cut off positions must be approached and stored Note They can only be saved if the bar is in the lower or upper rectangle of the bar display Moving the engine out e Softkey Po moves the engine out as long as the softkey is pressed or until the feed position is reached see Menu 3 1 Manual operation baler Storing a value Press function button OK until the symbol GC Note The value is stored when the right bar has accepted the value of the centre bar appears briefly in the upper line b KRONE KRONE ISOBUS Termi
137. ation wrapper AUTO Menu 1 3 4 Type of operation swivel table CIT AUTO Zu Menu 1 3 5 Sheet width a Ok Menu 1 3 6 Sheet tear monitoring b KRONE 8 8 1 KRONE ISOBUS Terminal Menu 1 3 1 Number of layers ml OK ver CC000756 Fig 97 Displaying the menu Menu 1 3 Wrapper setting is called n e Select the menu LU by pressing the function key f or The symbol is highlighted in grey Press function key OK The display shows menu 1 3 1 Number of layers Adjusting the number of layers The time delay is shown in seconds Note How many layers will be applied Le Set the desired number of layers via function koy P or The symbol Lk the upper line goes out Press function key OK The symbol WU in the upper line indicates that the displayed value is saved e Use softkey DEF to reset the operating mode to the factory setting Pressing the function key ESColoses the called up menu e Pressing the function key longerESCand holding it down brings up the basic screen 135 KRONE ISOBUS Terminal 8 8 2 136 Menu 1 3 2 Number slide wrappings CC000761 Fig 98 Displaying the menu Menu 1 3 Wrapper setting is called e You can select menu 1 3 2 by pressing function key Por A The symbol is highlighted in grey Press function key OK The display shows menu 1 3 2 Number of slide wrappings Adjust the number of slide wrappings
138. bar height so that the transition from Remove blockages pick up to channel is more even The baffle sheet moves upwards Remove the spring completely from the baffle sheet The transfer of short The machine is too low at front Hinge the machine higher at front adjust crop from the pick up to drawbar height so that the transition from the cutting roller is pick up to channel is even inadequate The floor conveyor The inner bale core is set too tight Adjust the soft core or reduce the baling takes forage up pressure In case of barrel shaped The bale chamber is not filled Drive over the swath on alternate sides bales the wrapping evenly material tears in the The number of wrappings is too Increase number of wrappings middle small Net brake is too tight Loosen net brake Net spreader is set too tight Adjust spreading device Floor conveyor switches too late Change switching time Bale is formed conically The bale chamber is filled on one Make sure when baling that the bale chamber is filled evenly Slow down especially at the end of the bale Speed is too high at the end of Slow down at the end of the baling baling process process Twine or wrapping material torn Just use twine or wrapping material in the provided quality The number of wrappings is not Set the twine tying device to a closer tying sufficient Wrapping material distance or increase the number of loosens wrappings of the wrapping material 342
139. basic safety instructions in the chapter Safety must have been read and followed see chapter Safety Basic safety instructions WARNING If the safety routines are not adhered to people may be seriously injured or killed To avoid accidents the safety routines in the chapter Safety must be read and followed see chapter Safety Safety routines Spare Parts Note To ensure problem free operation of the machine and to reduce wear and tear specific maintenance and upkeep intervals must be observed These include cleaning greasing lubricating and oiling parts and components ENVIRONMENT Disposal and storage of used lubricants and oil filters Effect Environmental damage Store or dispose used oil and oil filters according to statutory provisions ENVIRONMENT Disposal and storage of lubricants Effect Environmental damage Store lubricants in eligible containers according to statutory provisions e Dispose used lubricants according to statutory provisions Warning Using non approved spare parts Effect Danger to life serious injuries or loss of warranty claims as well as exclusion of liability e Use only authentic KRONE spare parts and accessories authorised by the manufacturer The use of spare parts accessories or additional equipment not manufactured tested or approved by KRONE will exclude any liability for consequential damage 2 5 Maintenance 13 2 Maintenance table Maintenance interval Machine part
140. before road travel 7 1 1 Lifting the Pick up Bu T me 3 el I Fig 62 Raise pick up 1 hydraulically 1 2 Secure pick up 1 with chain 2 3 Check the lifted and secured pick up 1 96 b KRONE Driving and Transport 7 1 2 Checking Parking Support Fig 63 e Interrupt power supply for operation e Check transport position of the parking support 1 7 1 3 Checking the lighting system E 2 CPN00023 e Connect the lighting system to the tractor electrical system Fig 64 e Check the function of the tail lights 2 and rear reflectors 1 and clean them The same applies to the yellow reflectors located on the sides of the machine and the front white side lights 97 Driving and Transport 7 1 4 Attaching the bale cloth CPN00024 _1 Fig 65 e Attach the bale cloth 1 to the side hooks 2 so that it does not touch the ground 98 b KRONE 7 2 7 2 1 Driving and Transport Parking DANGER Unexpected movements of the machine Effect Danger to life serious injuries Make sure that there is no one in the danger zone The machine must only be uncoupled when the engine is switched off and the ignition key is removed Put machine down on level and firm ground Increase surface of the parking support when putting the machine down on unfortified ground Secure the machine with wheel chocks against the possibility of
141. brake buttons 3 below the net roll Insert Net WARNING Risk of Cuts Due to Sharp Cutters Serious injuries especially to hands e Wear protective gloves when working in the area of the blades and the blade bar e Wear also protective gloves when threading in or removing the net CAUTION Contamination of the twine and tying mechanism by oil and grease Effect Machine damage and problems when unrolling twine e The twine twine tensioner and eyes must not be contaminated by oil or grease e The parts of the tying unit through which twine or net run must not be contaminated by oil or grease 241 Operation lt lt 242 as KRONE e PEP FF rer FO k re j Le t k 2 COM00200_1 Fig 183 e Before threading in the net press the blade bar 1 back with your hand until the ratched mechanism 2 engages E N O RPN00008_7 Fig 184 e Guide the net 11 over the deflection shaft 8 under the net compensation 3 e Place the net 11 further over the spreading bracket 12 and under the guide roller 13 round over the retaining plate 4 and guide it under the synthetic cloth 10 Note To increase net tension extend net further outward the net can also be laid under the cross tube 15 The net must be stretched with no problems when doing this The net must be approx 200 mm above the retaining plate 4 Swing the net roll mounting shaft back into
142. cae aha asua EEN 57 c00 Z2 I I f an I 6S0 P00 Z2 X 5 LA 3 wee E Ee j ee egz G C j EE r x 5 x IK S AO 4 LJ ey TPLL LZ6 dh EGI t6 ww abe Som SC ww et 4 BESSE 289 G90 0 WLIO 7 1 9 290 02 BFL TZ6 uw SZ gt a 1 ATA j lt H ww epg wu OG ww 0g 4 EE Zee 90 02 Ww z E aps lt Z5 800 Ze Hy RODEN D EE ww 0Z8 sgt WW DS A ae WO 09L ADI E WO 09L ww ggZ Aa wo FOL e WL DE 06267600722 0 6S9 800 Z2 ww Sp 00 616 sv 822 90 02 wuu gg x 960 090 02 TH zoz lt _ d WG gt K ww og BLA ww WW SZ W fa a 290 616 SI EG O V eska gs _ E gt zL LL OL 6 8 Z 9 s z r gt lt ww g p lt EEGENEN a EE ENEE 7 7 KSE EE KEE T 8 n A aw Lips pese Be Lef Lef e Les SN Zig PLA gt TTT O j G 0 GES E10 Ze l Oe Ke 19 SLA 8 9C0 800 Z2 _ a ae ee lt O BA EE N E D lt n 2 ir 352 C KRONE Appendix Tailgate Hydr blade base lowering Wrapping arm 6 Chain swivel table 7 Valveblock Hldingarms 9 Tilt swivel table 10 LBaiemaneier o Z o oo 353 KRONE 18 2 Electrical circuit diagram 354 WO oa uoneoo jueld Aq Ven D IPUIUUG JOO KO IX OSL AD 9X SSL AD ved DOC OO LOS OU JUSLINIOP si q V een
143. ch of the tractor Fig 41 Note Risk of hands and feet when the parking support is actuated To raise the parking support e As soon as the machine is connected to the tractor turn the crank 1 several revolutions clockwise until there is no more weight on the parking jack 3 e Withdraw the locking bolt 5 on the lower part of the parking support 2 push in the parking support 2 and secure it in position with the locking bolt 5 e Then crank the parking support 2 up all the way e Turn the parking jack 3 so that the flat side is facing the pick up 71 Start up 6 2 6 2 1 72 A KRONE Hydraulics Special Safety Instructions Warning Connection of the hydraulic line Effect severe injuries due to penetration of hydraulic oil under the skin e When connecting the hydraulic hoses to the hydraulic system of the tractor the system must be relieved of the pressure on either side e Due to the risk of injury when searching for leaks always use suitable tools and wear protective goggles Seek medical help immediately should injuries occur Danger of infection e Depressurise prior to uncoupling the hydraulic hoses and working on the hydraulic system e Check the hydraulic hose lines at regular intervals and replace them if damaged or worn The replacement hoses must fulfil the technical requirements set by the equipment manufacturer WARNING Hydraulic hose lines are subject to ageing
144. cial regulations Dangers associated with the operational environment Danger of fire Combustible materials can accumulate in the machine due to operation or animals such as rodents or nesting birds The danger of soiling applies in particular when working in dry or turbulent conditions Dust soiling and harvest residues can ignite on hot parts and cause fires that can seriously injure or kill persons e Check and clean the machine every day before using it for the first time e Regularly check and clean the machine during the working day e Keep the fire extinguisher ready to use at all times 21 Safety 4 3 17 22 b KRONE Sources of danger on the machine Noise may damage your health When working continuously with the machine health may be damaged such as hardness of hearing deafness or tinnitus When the machine is used at high speed the noise level also increases e Before starting up the combination of tractor and machine estimate the risk caused by noise Depending on the ambient conditions working hours and the working and operating conditions of the machine specify and use suitable hearing protection In doing so consider the sound pressure level see chapter Description of machine Technical Data e Specify rules for the use of hearing protection and for the working time e During operation keep the windows and doors of the cabin closed e Remove the hearing protection when travelling on the r
145. cifically it must be emptied e daily in winter when being used otherwise weekly and e atleast after 20 operating hours The drain valve 2 on the bottom of the compressed air reservoir 1 is used for draining Switch off and secure the machine e Open the drain valve and allow the condensation to run out e Check the drain valve clean it and screw it back in Note If the drain valve has a heavy accumulation of dirt or is leaking it must be replaced by a new one WARNING Risk of injury from corroded or damaged compressed air reservoirs Damaged or corroded compressed air reservoirs may burst and cause serious injuries Observe the inspection intervals according to the maintenance table see chapter Maintenance Engine Maintenance table e Have damaged or corroded compressed air reservoirs replaced immediately by a service centre b KRONE 14 gt t P P Maintenance lubrication Maintenance lubrication WARNING If the basic safety instructions are not followed people may be seriously injured or killed e To avoid accidents the basic safety instructions in the chapter Safety must have been read and followed see chapter Safety Basic safety instructions WARNING If the safety routines are not adhered to people may be seriously injured or killed To avoid accidents the safety routines in the chapter Safety must be read and followed see chapter Safety Safety routines ENVI
146. ck b KRONE Malfunctions Causes and Remedies 16 Malfunctions Causes and Remedies WARNING If the basic safety instructions are not followed people may be seriously injured or killed To avoid accidents the basic safety instructions in the chapter Safety must have been read and followed see chapter Safety Basic safety instructions WARNING If the safety routines are not adhered to people may be seriously injured or killed To avoid accidents the safety routines in the chapter Safety must be read and followed see chapter Safety Safety routines 341 S EE Malfunctions Causes and Remedies KRONE 16 1 General malfunctions Malfunction Possible cause Remedy Pick up cannot be Hydraulic hose not plugged in Insert hydraulic hose into the appropriate lowered coupling Clamping pressure Handwheel is in parking position Screw in handwheel completely does not build up Screw out handwheel for baling Set handwheel for baling pressure to the pressure desired pressure Blockages in the feed Swaths are of uneven height or too Split swaths area In case of large blockages stop Driving speed too high Reduce driving speed Slow down at the immediately and turn off beginning of the baling process until the the PTO shaft as the picked up crop rolls into the bale floor conveyor strips chamber can be damaged The machine is not hitched Hinge machine higher at front adjust otherwise horizontally draw
147. claims for damage due to spoiling of silage because numerous factors involved are beyond our control Note Under difficult conditions for example on slopes the functional safety of the bale turner can be increased by using the largest possible tyres 500 55 20 12 PR KRONE Start up Shut down and safeguard the machine see chapter Safety gt Safety routines Shutting down and safeguarding the machine 6 13 Mounting the Stop Holding Tube e 3 Van A L COBW0004 _1 Fig 55 e Remove the bale cloth from the swivel table and keep it in a protected place for later reinstallation e Install the stop 2 with bolts 4 washers 5 detent edged washers 6 and nuts 7 on the right and left of the swivel table e Guide the holding tube 3 through the support 15 from the outside machine hole series of the holding tube must point to the right as seen in direction of travel e Guide the holding tube 3 through the bale turner 1 and on through the support 15 on the other side of the swivel table e Secure the holding tube 3 on the left as seen in the direction of travel with a screw 8 and nut 9 and on the right as seen in the direction of travel with a bolt 16 and spring cotter pin 10 CAUTION Holding tube 3 secured incorrectly Effect Damage to the machine Make certain that the holding tube 3 is secured on the right side pos a by the screw 9 on the left or spring cotter pin
148. control unit 8 communicates information to the driver and performs settings to operate the machine This information is received and further processed by the job computer b KRONE 8 1 KRONE ISOBUS Terminal Installing the terminal into cabin Note Please mind the terminal operating instructions included with delivery for the installation of the terminal into the tractor cabin Betriebsanleitung Version 1 0 CC ISOBUS ISOBUS Terminal CCI 100 200 T 4SDBLIS BPXC0317 Fig 71 103 b KRONE ISOBUS Terminal KRONE 8 2 A 104 ISOBUS Short Cut Button DANGER risk of injury by running machine Your machine supports the ISOBUS short cut button e By actuation of the ISOBUS short cut button 1 the machine functions are switched off in order to be able to initiate a secure condition of the machine in hazardous situations Process oriented procedures perform to the end Therefore machine parts continue to run after actuating the ISOBUS short cut button This can lead to injuries e The ISOBUS short cut button does in no case interfere with tractor functions i e neither universal shaft functions nor hydraulic functions will be affected in any way Therefore the machine can continue to run after actuating the ISOBUS short cut button This can lead to injuries When actuating the ISOBUS short cut button 1 of the terminal which is of the pushbutton design a stop command is sent onto the ISOBUS This comma
149. ction rollers again by loosening the locking lever 4 261 Operation KR201120 Fig 202 Warning Crushing Hazard in the Sheet Clamping Device Effect Jamming crushing of fingers e Do not work on the sheet clamping device 1 as long as parts are moving there 3 Open holding arm 2 see Open Holding Arms Close Holding Arms entitled in Chapter Operation Terminal 4 Insert the starting end of the sheet in the clamping device 5 Close the holding arm 2 see Open Close Holding Arms in Chapter entitled Operation Terminal After the first bale has been wrapped the sheet holding arm 2 holds the sheet 3 in position 11 18 6 Adjusting the Sheet Brake The sheet brake 7 must be readjusted as follows if the sheet roll coasts down 6 Unscrew the counter nut 8 7 True up screw 9 8 Tighten counter nut 8 262 b KRONE 11 18 7 Operation Setting the Pre stretch of the Foil Fig 204 The pre stretching can be set between 50 and 70 by selecting the wheel pairs 1 or 2 on the wrapping arm Upper pair of wheels 1 50 pre stretching Lower pair of wheels 2 70 pre stretching The following work steps must be performed on both sheet holders both sheet holders must always have the same setting 1 Loosen the threaded pins 3 2 Select the appropriate pair of wheels 1 or 2 and secure with threaded pins 3 Check Pre stretching
150. cut resistant gloves 6 Order no 27 005 010 1 2x Comprima CF 155 XC Danger from energised spring WWO Risk of injury due to ejected machine parts e Never unscrew screw connection 27 005 010 1 Danger due to rotating auger There is a danger of becoming caught or wrapped around the rotating auger e Never reach into the rotating auger e Keep a sufficient distance from moving machine parts Danger due to rotating machine parts When the machine is running there is a risk of injury due to rotating machine parts e Before starting up move the guards into their protective position 31 Safety KRONE Com PO 0 s s e CPNO00007_5 Fig 3 32 KRONE Safety 9 Order no 939 529 0 1x Comprima CV 150 XC Danger due to high pressure liquid The accumulator is under gas and oil pressure If the accumulator is not removed or repaired properly there is a risk of injury e Before removing and repairing the accumulator follow the information in the operating instructions e The accumulator may be removed and repaired by a service centre only 10 Order No 27 003 995 0 3x Danger from tailgate as it may close in an uncontrolled manner e Staying in the danger zone is only permitted when the lifting cylinder safety mechanism is engaged Danger from shock The swivelling movement of the machine may cause dange
151. cylinder should be mentioned It is designed as a safety component to prevent the tailgate from closing unintentionally Position a Hydraulic cylinder return opened The tailgate can be closed To close the tailgate always return the shut off valve to position a after working inside the bale chamber or on the tailgate Position b Hydraulic cylinder return locked The tailgate cannot be closed Always move the shut off valve to position b for work inside the bale chamber and on the open tailgate 312 cO KRONE Maintenance 13 18 2 On board Hydraulic System DANGER The hydraulic system is pressurised Effect Danger to life injuries or damage to the machine Before any work is performed on the hydraulic system of the machine e the complete hydraulic system must be switched depressurised the handwheel 1 must be completely screwed out from the accumulator connection block 2 parking position e the tailgate must be closed 313 h A Maintenance KRONE The on board hydraulic pump is driven via a gear directly by the PTO shaft The hydraulic tank is located on the left rear machine side The hydraulic filter of the on board hydraulic system is located at the front left on the machine The control valves are located at the sheet compartment on the left side of the machine wa Oe Centres iiil Fig 248 Y04 Function S10 Y012 Transfer forward S5 Y05 Valve block YO13 Transfe
152. d tyres Fitting removing wheels and tyres Improper fitting or removal will endanger operational safety As a result accidents may occur and people may be seriously injured or killed The fitting of wheels and tyres requires adequate knowledge and approved tools e lf there is a lack of knowledge have the wheels and tyres fitted by the KRONE dealer or by a qualified tyre service e When fitting tyres on the wheel rims never exceed the maximum permitted pressure specified by the tyre manufacturers otherwise the tyre or even the wheel rim may explode e When fitting the wheels tighten the wheel nuts to the stipulated torque see chapter Maintenance Tyres Behaviour in hazardous situations and when accidents occur Neglected or incorrect procedures in hazardous situations may obstruct or prevent the rescue of people in danger Difficult rescue conditions will impair the chances of helping and healing the injured e In principle Switch off the machine Gain an overview of the hazardous situation and identify the cause of the hazard e Safeguard the accident location e Rescue people from the danger zone e Withdraw from the danger zone and do not enter again e Alert rescue teams and if possible fetch help e Take immediate life saving measures b KRONE 4 4 4 4 1 4 4 2 Safety Safety routines Stopping and securing the machine WARNING Crush hazard due to movement of the machine or machine parts If
153. devices Re install all removed safety devices and all other parts and move them into protective position before starting up the machine If it is doubtful whether all safety devices have been correctly installed and are functional have a service centre check them Personal protective equipment The wearing of personal protective equipment is an important safety measure Missing or unsuitable personal protective equipment increases health risks and injuries Personal protective equipment is for example Work gloves Safety boots Protective clothing Breathing protection Hearing protection Face and eye protection Specify and provide personal protective equipment for the particular job Use only personal protective equipment which is in proper condition and offers effective protection Adjust personal protective equipment to the person for example the size 19 Safety 4 3 12 4 3 13 20 b KRONE Wear suitable clothing Loose clothing increases the risk of it becoming caught or wrapped around rotating parts and of it becoming caught on protruding parts As a result people may be seriously injured or killed e Wear tight fitting clothing e Never wear rings chains or other items of jewellery Cover long hair with a hairnet e Wear sturdy shoes or protective work boots Safety signs on the machine Safety stickers on the machine warn of hazards in danger areas and are an important component of the safe
154. e Follow the coupling instructions see chapter on starting up Connect the machine to the tractor e Note the modified driving behaviour of the combination Structural changes to the machine Structural changes and enhancements may impair the functionality and operational safety of the machine As a result people may be seriously injured or killed e Have structural changes and enhancements performed by an authorised service centre only Additional equipment and spare parts Additional equipment and spare parts which do not comply with the requirements of the manufacturer may impair the operational safety of the machine and cause accidents e To ensure operational safety use original or standard parts which comply with the requirements of the manufacturer If in doubt have parts verified by the dealer or manufacturer Workstations and passengers Control of the moving machine The moving machine requires the driver to react quickly at any time Otherwise the machine may move in an uncontrolled manner and seriously injure or kill people e Start the engine from the driver s seat only e Never leave the driver s seat while the machine is moving e Never climb in or out of the machine while it is moving Passengers Passengers may be seriously injured by the machine or fall off the machine and get run over Ejected objects may strike and injure passengers e Never let people ride on the machine 15 Safety 4 3 8 1
155. e Pick up 224 119 TOM T OS uuu uuu u un a E a 225 11 10 Adjusting the baffle polate r a a 226 Ted CUNO SY SUC E 227 11 111 General EE 227 MMe Ne GOUNG Eng uu uuu uuu amauta E E ase E A EEEE 228 11 11 3 Zero position of the cutter EE 231 11 12 Setting the Bale Diameter LIL UIII ua a aaia aia aaa ia 235 11219 Seting Baling GE EE 236 Wale NOC pipi NEE 239 KN ae Eelere DOS u u u u u u uuu unn a s 239 11 14 2 Function of the Net Tying a aaa rrssssssasassa 239 Talker THE limg INCU Ce E 240 112157 MIS OEE N0lu uuu u u u au as is maupaaaakawaayapusakaqkayauquqaikpanaqhusqssnakabusashakaukakaq 241 11 15 2 Setting of the Feed Poeton Lu aa aauaaeaaakuwawuakaquaawkakawawaua quuaaykaqawaqkankulaaawa 243 11 15 3 Setting of the Tying Position a aaa raaaasssssssrrsssssa 244 11 15 4 Selecting the Number of Net Wumde a a aaasaaaa aaa 244 Nee Ende De i EE 245 11 46 Adusia SoN EE 246 1h17 Blockage DUC 10 Jammed Grop WEE 249 11 189 BIE e ee 251 11 18 1 Special Safety Instruchons a aa aasararrrrssssssssisssaa 251 11 18 2 Components Bale Wrapnper a aaa aaa aaaasssssrrrrssssssssiiissa 252 11 18 3 Function Bale VWrapper rr rrrssssssssssssssssssssasaa 255 TBA Stre TE 256 tietoa Meen rr E 257 HUNG Adjusting ihe Sheet EE 262 11
156. e eccentric cam disc 1 e Retighten the screws 2 2 1 Settings 2 2 as KRONE RP100007_2 Fig 213 Depending on consumption check the oil supply in the container and top off if necessary If the lubricant container is empty the central chain lubrication system needs to be bled Top up the reservoir with oil Remove the container hose 4 of the pump and wait until oil is leaking Install the hose to the pump again Open venting screw 3 and actuate the pump manually until oil flows without bubbles out of the valve block Note Replace filter 2 once a year First remove empty and then thoroughly clean the tank 1 Only then replace filter 2 Do not remove filter 2 if oil is present in the filter Note lt must absolutely be ensured that no water or dust can enter the tank 1 Note Use recommended oils only Different types of oil can be used The viscosity should be similar to 15W40 cold surrounding SAE 30 warm surrounding SAE 90 Only use biodegradable and non toxic oils for example Fuchs Mineral Oil Plantogear 100 N or Castrol Optimol Optileb GT 100 Do not use adhesive oils for chains since these would get stuck inside the system KRONE Settings Comprima CF 155 XC ION a Starterwalze 6 a Starterwalze 6 e Pick up 2 b Stirnrad 6 f Netzwalze 3 c Schneidwerkantrieb 5 g Hauptantrieb 4 c Schneidwerkantrieb 5 g Hauptantrieb 4 d Pick up Antrieb 2 e
157. e enclosed operating instructions as possible should only couple those systems to each other which have passed a DLG VDMA test so called ISOBUS COMPATIBILITY TEST before e has to follow the operating and safety instructions of the supplier of the ISOBUS control unit e g terminal e must guarantee that the control elements and machine control systems fit together according to the IL IL Implementation Level describes the compatibility status of the different software versions requirement IL same or higher 197 ISOBUS operation KRONE 9 1 Mounting ISOBUS Terminal IFC000001 CAUTION A Failure of control unit When installing make certain that the connection cables are not tight when cornering and that they do not touch the tractor wheels or any other parts of tractor or machine 9 1 1 Connection Terminal to Tractor Note For further details on the attachment consult the operating instructions of the ISOBUS terminal manufacturer 9 1 2 Connection Tractor to Machine Connect ISO plug 3 9 pole of cable set 1 with outer ISO socket 2 9 pole on tractor side Connect plug 4 7 pole of cable set 1 with socket 5 7 pole of the machine Connect plug 6 2 pole of cable set 1 with socket 7 2 pole of the machine 198 b KRONE 9 2 ISOBUS operation Differing functions to KRONE ISOBUS terminal CCI Via the accessory unit the ISOBUS control unit will provide information and c
158. e floor conveyor 221 Releasing the Net Brake 270 Removing the transport holding down tensioning ale 60 Remowing the Crop Blockages in the Crop Collection Area 265 Re Ordering the Adhesive Safety and Information Labels 42 Roller crop guide 225 Rollers on the Wrapping Table 000nnnnn000nnnaan 50 Running in period 85 S d E 13 Safety routines 25 Safety signs on the machine 20 Select day night display lighting 182 Select the Number of Net Winds 244 Sensitivity of the Direction Display 130 D VIC D ee 160 Set Baling Pressure 236 Setting Cut off Position 245 Setting of the Brakes with Hydraulic Linkage S I EE 290 Setting of the Feed Position 243 Setting of the Scraper Rail to the Upper Spiral Breil 277 Setting of the Tying position 244 Setting the Net Drake 269 Setting the Pre stretch of the Foil 263 CLIPS eege 126 269 SIHHeSLWIdii uu ll uuu sss nsssssasataqanwa 139 Shut off valve for tailgate
159. e from rolling away accidentally especially when the machine is disconnected from the tractor To apply the parking brake e Press button on the end of the lever and pull lever 1 up as far as it will go To release the parking brake e Press the button on the end of the lever and push down lever 1 as far as it will go Note To prevent the machine from rolling away use the wheel chocks in addition to the parking brake b KRONE Safety 4 7 2 4 7 3 Attaching the safety cable ee T AN og Bom A Dax JZ Wanye KWT20026 ek KS Fig 12 The safety cable 1 applies the parking brake 3 if the machine breaks away from the tractor while it is driving Attaching the safety cable to the machine e Attach the safety cable to the parking brake To do this pull the safety cable through the small loop on the cable and through the ring 2 Attaching the safety cable to the tractor e Attach the other end of the safety cable to a suitable point at the rear of the tractor Make sure that the cable cannot slip or become detached Wheel chocks Comoo360 Fig 13 The wheel chocks 1 are kept in a holder at the front left beside the drawbar Each one is locked in position in the holder by a spring clip 45 Safety 4 7 4 4 7 5 4 7 6 4 7 7 46 as KRONE Secure the machine against the possibility of rolling back KR 1 081 Fig 14 e T
160. e of the pick up X oe P I ss 190 Ve bh A A mW Ba oa a f J e U z g gt e A gt amp S j gd E mees F tit amp AA x ws VA ASS VPN00617 VPN00618 Fig 242 Note After repairing the main drive 1 ensure during installation that the disc springs 2 are arranged as shown in Fig VPN00618 307 b Maintenance KRONE 13 16 1 4 13 16 1 5 308 Conveyor Auger Drive Shut down and safeguard the machine see chapter Safety gt Safety routines Shutting down and safeguarding the machine Fig 243 The auger conveyor drive 1 is located on the pick up on the left hand side of the machine The drive chain is tensioned by the clamping element 2 Check the Chain Tension The length of the spring when tightened must be a 30 mm Correct the Chain Tension e Turn the nut 3 to increase or reduce the spring tension of the compression spring 2 until distance a approx 30 mm is set Roller Drive Shut down and safeguard the machine see chapter Safety gt Safety routines Shutting down and safeguarding the machine RPNO0055 Fig 244 The roller drive 1 is located on the right side of the machine Check the Chain Tension The length of the spring when tightened must be a 220 mm Correct the Chain Tension e Turn the nut 3 to increase or reduce the spring tension of the compression spring 2 until distance a
161. e sensor 1 for the position of the cutter base the cutter drawer 2 must rest closely against the cutting system housing 3 Therefore existent soiling in this area needs to be removed before the setting b KRONE 13 4 2 Maintenance Checking and Setting Axial Play of the Net Brake CAUTION Damage to sensor B2 e Before setting the sensor B2 net runs the axial play of the net brake must be checked and set if necessary Fig 224 Checking Axial Play e To release the net brake 2 press the lever 1 downwards e Determine the play a of the net brake 2 to the adjusting ring 3 by pushing forward and pushing backward the net brake 2 visual inspection The axial play a must be 1 2 mm H ee m7 87 9 Fig 225 Set the axial play if the distance a is larger than 2 mm e Lift lever 1 Swivel the net brake 2 with the net roll mounting shaft 4 to the front and remove the net brake 2 e Unscrew the threaded pin 5 out of the adjusting ring 3 and remove it e Slide the shim rings on the net roll mounting shaft 4 and install the adjusting ring 3 with the threaded pin 5 on the net roll mounting shaft 4 e Slide the net brake 2 on the net roll mounting shaft 4 and swivel it back into the machine 285 Maintenance KRONE 13 5 286 b Tightening torques A Thread size the stability class can be seen on the head of the screw Tig
162. e seriously injured or killed e The roller crop guide is used for accident protection and must not be removed during operation The roller crop guide 1 makes it possible to regulate how crop is moved It ensures that the pick up collects crop evenly Adjust the height of the roller crop guide 1 so that the holding down roller 2 runs continuously above the swath Height of the roller crop guide For large swaths the roller crop guide 1 can be adjusted to forage weights To do this hook in the chains 3 correspondingly higher Note The setting must be the same on both sides of the roller crop guide 225 h Operation KRONE 11 10 Adjusting the baffle plate Comprima CV 210 XC The height of the baffle plate 1 can be adjusted to the swath Position is the factory default setting If the crop is very moist moving the baffle plate to position Il is recommended DM N Miia RPNOO119 1 Fig 165 Moving the baffle plate 1 from position I to position Il On the left and right side of the machine e Toremove the bracket 2 remove the linch pin 3 unscrew the round head bolt 4 remove the spring 11 detach the bracket e Remove the linch pin 5 e Move the baffle plate 1 to the upper bore and secure with the linch pin 5 e To fit the bracket e insert the round head bolt 4 into the front square hole 6 and secure with a spacer tube 7 washer 8 and locknut 9
163. e spiral roller 2 e Then tighten the hexagonal head screws 3 and threaded rods e After the setting is made run the machine manually and check whether the scraper rail 6 comes in contact with the spiral roller 2 e Ifthe scraper rail 6 does not rest on the spiral roller 2 the screw connection on the clamping wedge 5 must be loosened e Turn the clamping wedge 5 by 180 degrees and retighten the screw connection the dimensions of the clamping wedge of the oblong hole to the upper and lower stop edge are different 2 8 cO KRONE Maintenance 13 4 Position of the Sensors Right hand Side of the Machine Comprima so CPN00012_2 Fig 218 279 Am Maintenance KRONE Sensor designation Distance Operating Sensor type Starting Transmitter sensor terminal CCl torque 1 Net length B Namur 1 Net running B2 X B3 encoder 4 Bale chamber closed 2 mm A Namur 10 Nm right B12 B10 CF155XC encoder gt lt Rotation pulse encoder Namur 10 Nm Bale diameter right B10 CV150XC 5b Bale on swivel table right B17 B23 x x gt lt Sheet tear control B24 280 C Am KRONE Maintenance Left hand Side of the Machine COM00308 Fig 219 Sensor designation Distance Operating Sensor type Tightening Transmitter terminal CCl torque sensor d 1 Position of cutter base B8 Bale chamber closed left B11 Rotary potentiomete
164. ecure the open tailgate to prevent it from closing unintentionally RPN00046_3 Abb 154 The assembly of additional bars 2 on the starter roller is recommended to increase the protection against turning of the bales Assemble the bars 2 on the starter roller in the inside of the bale chamber Swivel the shut off valve 1 in the return of the left lifting cylinder from position a to position b the tailgate is locked hydraulically e Open the tailgate e Assemble the 6 bars 2 on the starter roller and fasten them with countersunk screws 3 Swivel the shut off valve 1 in the return of the left lifting cylinder from position b to position a the tailgate is locked hydraulically e Close the tailgate 215 Operation 11 3 1 2 216 AZ KRONE Assembly of Additional Ejector Plates in the Tailgate Comprima CF 155 XC I S RPN00107_1 Fig 155 View closed bale chamber lf the completed bales do not fall out of the front bale chamber two ejector plates 1 can be assembled right and left in the tailgate of the machine e Install the ejector plates 1 with the screws 2 on the insides of the bale chamber into the existing bore holes e f the completed bales do even not fall out of the front bale chamber after having installed the ejector plates 1 remove the sliding plates 3 from the machine housing right and left The ejector plates 1 can be ordered with suitable screws from
165. ed 108 8 2 4 Switching the terminal on off when the machine is connected 109 8 3 o r E E E E E A E E 111 8 3 1 Adjustment of bale firmness display for Comprima CF 155 XC 118 8 3 2 Adjustment of target bale diameter display for Comprima CV150XC 119 8 3 3 Adjusting the Target Bale Diameter Display for Comprima CV 210 XC 119 8 4 NS SS Let 120 8 5 I GU V sence EE AT EA E AE E E TE E E AO V E E A EN E EE E 122 8 5 1 OME OV EI VICW uu 2 E E EEE 122 8 5 2 Calling up the menu level 125 8 6 Main Runa 126 8 7 Ment 1 E Er En DA E 127 8 7 1 Menu 1 2 2 Bale diameter Only for Comprima CF155XC 128 8 7 2 Menu 1 2 3 Number net WINS cccccccsecceceesececceeceeceeececeeeceeseeeeceeseaeeesseaecesseneeessaeeeeeas 129 8 7 3 Menu 1 2 4 Sensitivity of the Direction Display Only Comprima CF155 130 8 7 4 Menu 1 2 5 Pre signalling ccccccseeceeeeeeeeeeeeeeeeeeeeeeeesaeeeeeeeesaaeeeeeeesaaeeeeessaaeeeseesaaeeeesessanseeees 131 8 7 5 Menu 1 2 6 Filling CGorrechon 132 8 7 6 Menu 1 2 9 Tying Start delay ccccccccccccssessseeeeeeeeeeeeseeeeeeeesseeeseeeeeeesseeaaseeeeeeesseneasseeeesennags 133 8 8 Menu 1 3 Adjustment wrapper s ssssssossennneesensstnrtrtrroes
166. ed VPNO0616 Fig 236 e Dismount scraper 1 e Remove the threaded pin from the adjusting ring on the deflection pulley 2 and remove the adjusting ring Dismount deflection shaft 2 and mount with deflection shaft 3 in position a e Push the adjusting ring onto the deflection shaft 2 and secure with threaded pin e Mount scraper 1 at a higher position e Check whether the tensioning rocker still touches the belt brush marks Move scraper and deflection pulley up into hole b if necessary Note e Only mount the deflection roller 3 1 hole higher as otherwise the belt is unnecessary loaded 302 b KRONE RROME Maintenance 13 15 Wrapping table chain The wrapping table chain 1 must be tensioned on both sides of the wrapping table 2 so that it is positioned on the chain guides 3 e Always check the tension of the wrapping table chain before use lf the wrapping table chain is positioned on the chain guides the chain tension is correct If the wrapping table chain is not positioned on the chain guides e Retension the wrapping table chain using the chain tensioner 4 303 304 Maintenance 13 16 13 16 1 13 16 1 1 AZ KRONE Drive chains WARNING Danger of entanglement in the drive chains Effect Risk of injury caused by entanglement of loose long hair or loose clothing e After working on the chains always reassemble or close the safety devices All dr
167. ed or killed To avoid accidents each person who works with the machine must satisfy the following minimum requirements He is physically capable of controlling the machine He can work safely with the machine in accordance with these operating instructions He understands the method of operation of the machine within the scope of his work and can identify and avoid the dangers associated with the work He has read the operating instructions and can implement the information in the operating instructions accordingly He is familiar with driving vehicles safely For road travel he has adequate knowledge of the highway code and has the stipulated driving licence b KRONE 4 3 3 4 3 4 4 3 5 4 3 6 4 3 7 Safety Children in danger Children cannot assess danger and behave unpredictably As a result children are especially at risk e Keep children away from the machine e Keep children away from consumables e Especially before starting up and moving the machine ensure that there are no children in the danger zone Connect the machine to the tractor If the tractor and the machine are not correctly connected there is a risk of causing serious accidents When connecting front attachments or trailers follow all operating instructions The operating instructions for the tractor The operating instructions for the machine The operating instructions for the universal shaft
168. ength RL 9 Activate the brake To do so the cylinder stroke X must be between 25 mm and 50 mm Note If the cylinder stroke X is too great readjust the brake linkage 2a 2b increase the length of the brake linkage After the brake linkage 2a 2b has been readjusted check whether e the wheels turn freely when the brake is released If they do not the brake linkage 2a 2b must be readjusted shorten the brake linkage e the threading overhang 6 of the brake linkage 2a 2b on the clevises must be min 0 mm If the threading overhang 6 min 0 mm cannot be reached the brake lever 4 5 should be moved on the brake shafts against the operating direction 7 10 Tighten counter nuts 1 3 on the brake linkages 2a 2b Note Before placing the brake into service again check the safety equipment for functionality 289 Am Maintenance KRONE 13 7 1 290 CO Comprima CV 210 XC After the first few kilometres of driving the transfer mechanisms and the brake linings of the brake drum will have adjusted The play resulting from this must be compensated for Setting of the Brakes with Hydraulic Linkage Setter HDC00036 Fig 227 e Check the linkage setter 1 every 200 operating hours e Activate the linkage setter 1 manually in the pressure direction If the clear path a is max 35mm the setting of the linkage setter 1 must be modified e Readjust the linkage setter 1 by usin
169. ength of the spring a when tightened approx 495 mm CV150XC must be approx 465 mm CV210XC Correct the Chain Tension e Turn the nut 4 to increase or decrease the spring tension of the tension spring 2 on the threaded rod until the distance a is set on the above mentioned values 305 S EE Maintenance KRONE 13 16 1 3 A 306 h Pick up WARNING Crush hazard Effect Foot injuries e Lower pick up to the ground Shut down and safeguard the machine see chapter Safety gt Safety routines Shutting down and safeguarding the machine F RPN00056_1 Fig 240 The main pick up drive 1 and the pick up drive 2 are located on the pick up on the right side of the machine The drive chains are tightened with clamping elements 3 Check the Chain Tension The length of the spring when tightened must be a 30 mm Correct the Chain Tension e Turn the nut 4 to increase or reduce the spring tension of the compression spring 3 until distance a approx 30 mm is set PN00058 Fig 241 The cutting roller drive pick up 1 is located on the right hand side of the machine Check the Chain Tension The length of the spring when tightened must be a 200 mm Correct the Chain Tension e Turn the nut 3 to increase or reduce the spring tension of the compression spring 2 until distance a approx 200 mm is set b KRONE Maintenance Spring discs on the main driv
170. er the harvest season Draw up a list of all soare parts you will need This will make it easier for your KRONE dealer to process your orders and you will be certain that your machine will be ready for use at the beginning of the next season 337 b Placing in Storage KRONE 15 2 Before the Start of the New Season A 338 DANGER During repair maintenance cleaning work or technical interventions on the machine drive elements can start moving Effect Risk of death injuries or damage to the machine e Turn off the tractor engine remove the ignition key and take it with you e Disconnect the 12 V power supply voltage e Secure the machine and tractor against rolling e Turn off and disengage the PTO shaft e After repair maintenance cleaning work or technical interventions on the machine replace all protective covers and safety devices correctly e Avoid oil grease cleaning agents and solvents coming into contact with the skin e Hydraulic fluids escaping at high pressure can cause severe injuries In the event of injuries or burns due to oils cleaning agents or solvents contact a physician immediately e To prevent injury and accidents follow all safety instructions e Before placing the machine in service again trigger a tying or wrapping process and run through it manually As you do check the functions of the starting devices of the tying or wrapping process e Grease all lubrication points and oil the chain
171. et roll 2 by activating the bolt 3 e Hook the tension spring 5 into the perforated bar 7 in a way that the locking screw 8 is pressed against the flat iron 9 Note a e When using a big sheet roll 750 mm hook the tension spring 5 into the upper area of the perforated bar 7 e When using a small sheet roll hook the tension spring 5 into the lower area of the perforated bar 7 259 260 Operation AZ KRONE COM00213 Fig 200 DANGER Loss of the Sheet Roll Injuries or damage to the machine After insertion of the sheet roll 2 secure it immediately by hooking the tension spring 5 Check if the locking bolt 8 is pressed tight to the flat iron 9 Only this guarantees the tight seating of the sheet roll After installing the sheet roll make certain that e the wrapping arm can rotate freely in all positions the pre stretching unit is lubricated well KRONE Operation Fig 201 WARNING Fingers Between the Section Rollers Effect Jamming crushing of fingers e Do not push the fingers between the section rollers 2 3 as long as parts are moving there e Do not push the fingers between the section rollers and the section roller mount The following work steps must be performed on both sheet holders both sheet holders must always have the same setting 1 Guide the sheet of the sheet roll 1 around the forward section roller 2 to the forward section roller 3 2 Tension the se
172. et the perforated bar 1 in the required position Secure in place using the linch pin 2 223 Operation KRONE 11 8 2 Bearing Pressure Relief of the Pick up i mg mg EN E Oo oOo b E E EN b 7 RPN00023_3 Abb 163 In order to be able to pass over unevenness better the pick up is supported by means of two springs The springs can be set by means of the ring bolt 1 Both springs should be set equally In the default setting dimension a is left 150 mm right 42 mm Note Load on the guide wheels must be sufficiently relieved For extreme soil conditions regulate the raking height of the pick up with the chains 2 on both sides right and left hand side of the machine e Raise the Pick up hydraulically e Move the guide wheels 3 up Set the desired raking height of the pick up by suspending the chain 2 Note When used in straw the pick up should be set as high off the ground as possible Use the chain 2 to adjust the pick up guide wheels in that way that they do not touch the ground Note If the pick up is hooked in higher the height of the drawbar must be adjusted see Chapter entitled Start up Adapt Drawbar Height 224 b KRONE 11 9 Operation Roller crop guide WARNING Risk of injury if the machine is used without a roller crop guide If the machine is operated without a roller crop guide people can b
173. ft 1 inside the PTO shaft support 2 100 A KRONE 7 2 4 Driving and Transport Disconnecting the Supply Lines RPN00065 Fig 69 e Disconnect the hydraulic hoses 1 and electrical connecting cables and store them properly in the corresponding receptacle on the twine box Disengage the hitch coupling or pull the bolt e Drive the tractor away slowly 101 KRONE ISOBUS Terminal KRONE 8 A 102 h KRONE ISOBUS Terminal Note In the operating instructions which follow the terminal will also be referred to as the control unit Caution Protect Control Unit Effect Damage to the control unit e The control unit must be protected against water e lfthe machine is not used for an extended period of time for example during the winter the control unit must be stored in a dry place e For mounting and repair jobs especially for welding jobs on the machine disconnect the power supply to the control unit Overvoltage can damage the control unit CC000013 J s CPK00009 Fig 70 The electronic equipment of the machine consists essentially of the job computer 1 the terminal 3 and the control and function elements The job computer 1 is located on the front left of the machine under the side hood Its functions are e Control of the actuators installed on the machine e Sensor system actuator diagnostics e Bale counter e Transfer of alarm messages The
174. g an adjusting screw 2 Set the clear path a to 10 12 of the connected brake lever length b Example In case of a lever length of b 125 mm the clear path must be 12 15 mm b KRONE 13 8 Maintenance Tyres Warning Tyre fitting incorrect Effect Injuries or damage to the machine e Fitting tyres requires sufficient knowledge and the availability of proper tools e If tyres are not correctly fitted it could explode when pumped up This can cause serious injury If you do not have sufficient experience of fitting tyres have tyres fitted by the KRONE dealer or a qualified tyre specialist e When fitting tyres on the wheel rims the maximum pressure given by the tyre manufacturer must not be exceeded The tyre or even the wheel rim could explode and or burst e Ifthe tyre heels do not fit properly when the maximum permitted pressure is reached let out the air align tyres lubricate the tyre heels and pump up the tyre again e Detailed information about how to fit tyres onto agricultural machinery can be obtained from the tyre manufacturers 291 Maintenance KRONE 13 8 1 Checking and maintaining tyres aot Lei ds KS 0 034 Fig 228 When loosening and tightening the wheel nuts observe the order indicated in the illustration 10 operating hours after they have been mounted check the wheel nuts and retighten them if necessary After that check them every 50 operating hours to make certain
175. g as the softkey is activated or the desired position has been reached 1 0 e Press 1 softkey and hold it down until the wrapping arm has reached the zero position e Pressing the function key ESCcloses the called up menu Possible Status Messages Window 2 Height Wrapping Arm le wrapping arm in parking position c R e wrapping arm in wrapping position to 150 cm bale size ool R wrapping arm in wrapping position to 175 cm bale size A R Wrapping arm in pushing position in case of a bale size larger than 175 mm Gel Ka only if the wrapping arm is deactivated 156 b KRONE 8 12 2 lt KRONE ISOBUS Terminal Drive Height Wrapping Arm Into Parking Position Note Before starting road travel move wrapping arm into parking position If the wrapping arm is not in the parking position e if there is no bale on the wrapping table or e if the work sequence is complete i 0 the function button tt Wrapping arm in parking position is displayed on the home screen _ CC000318 Fig 119 BR e Pressing the function button moves the wrapping arm to the parking position Note To insert new film rolls or if the filling of the bale chamber takes longer the wrapping arm can be moved to the parking position when the bale has been put down by pressing the function 0 button Au Before ejecting the next bale the wrapping arm automatically moves to the wrapping position 157 C KRON
176. g bales 219 Tying Start delay 133 Type of operation swivel table 0 000000000000 138 Type of operation wrapper 137 Jy uuu um O ua u 291 U Uncoupling the machine safely 26 Using the bale cloth 87 Using the Safety chain 83 V Virtual Terminal V T 181 358 A KRONE W WALTERSCHEID cam type clutch K64 12 to K64 24 EK 64 22 to EK64 24 331 Wheel chocks 45 Workstations ANd passengers 15 Wrapping Arm Bearing 309 Wrapping Eege Uu UL ass u 86 Wrapping table chain 303 WTK multi function lever default setting 202 Z Zero position of the cutter 231 CO KRONE THE POWER OF GREEN Maschinenfabrik Bernard Krone GmbH Heinrich Krone Stra e 10 D 48480 Spelle Postfach 11 63 D 48478 Spelle Phone 49 0 59 77 935 0 Fax 49 0 59 77 935 339 Internet http www krone de eMail info ldm krone de
177. g fluids and lubricants must be brought separately to an environmentally friendly disposal point or recycling centre Operating fluids and lubricants Operating fluids and lubricants diesel fuel coolant gear oil oil from hydraulic system must be brought to a disposal point for waste oil Synthetic materials All synthetic materials must be brought to a recycling centre for synthetic materials Rubber Rubber parts hoses tyres must be brought to a rubber recycling centre Electronic scrap Electronic parts must be brought to a disposal point for electronic scrap 347 A lt KRONE vO 891 OOL OSL HN ww g gt ww OLS ww OP ww Sd Zie io ugt WW 022 SE eg ww Op ww SZ x Llc LPG o Wem WWS L gt ww 9 EL 126 O va Tube il a 8 190 616 61Z 0v2 T BETE 1 o S pb nn kk a EE rm ed e T 8 p E amp amp 2 F YO L Ne gt gt PP POPP DE G Ze8 000 Z 2 x T 5 SPA p 2 TE SE a gt o lt O ooo ae lly amp amp D P Ka T A V CH Set t SOLA satt 2 o E E l e e Ooo dL o ww GQ L wae id ww gz z0 P Si AdI EWO OGZ V10 000 22 ww OU eize WWOLZ wu SZ x 98 E6
178. g table Fig Remove cable ties 2 for fixation of the wrapping table 59 h Commissioning KRONE 5 2 Removing the transport holding down tensioning device 60 lt A Comprima CF 155 XC Note If the clamping arms of the machine were pulled down and attached for transportation with the tensioning system not all truck types the tensioning system must be removed before the machine is started up Removing the tensioning device from the right and left sides of the machine DANGER The tensioning rocker and the attached tensioning device are under pressure Effect Injuries or damage to the machine e Noone is permitted inside the danger zone Fig 27 ATTENTION The floor conveyor is tensioned by loosening the screws 1 e Keep out of the danger zone e Remove the screw 2 by slightly tightening or loosening the screw 1 e Loosen the screws 1 on left and right equally on both sides and remove COM00310 Fig 28 e Remove the cotter pin and bolt 4 and remove the slip on bushing 3 downwards Re attach the bolt 4 and secure with the cotter pin Azz KRONE Commissioning Fig 29 Remove the screw connection 5 e Remove the connecting tube 6 and link 7 Note Dispose of all removed parts properly Reuse is not permitted Fig 30 e Connect the plug connection 8 for the sensor on the left side of the machine e Mount the supplied plate 9 on the upper deflect
179. he Brakes with Hydraulic Linkage Setter 290 J O Ty e E A A A N 291 13 8 1 Checking and maintaining tyres a 292 13 8 2 Tyre air pressure EE 293 i SO AN eege 294 13 9 1 UNG Me SOM the EI EE 294 13 10 Oil Level Check and Oil Change on the Gearboxes 295 13 10 1 Oil Level Check and Oil Change Intervals Gearboxes 295 13 10 2 Filling Quantities and Lubrication Designations for Gearboxes 295 ECG Le o Wil dee 296 163403 Slip on EE 297 13 11 Screw connections at the front and rear of the floor conveyors 298 13 12 Novo Grip belt on the floor Comnvevor 299 13 13 Checking the Safety Rollers of Single Blade Locking Device 300 13 14 Checks and maintenance on rear floor Gomvevor 301 13 14 1 Adjusting the deflection roller AA 302 19 15 Wapping Ee TT D 303 1016 DIA en E 304 12161 Tensionng the Drive TEE 304 13 16 1 1 Front Floor Conveyor Drive a a r a asas rrrsssss s 304 13 16 1 2 Rear Floor Conveyor Drive 305 J 1 PICK Uee E EEEE 30
180. he machine e After uncoupling close the cover or connect the coupling heads in the empty couplings provided for this purpose so that no dirt can get in them e Replace damaged sealing rings Check whether the coupling heads lock into place and make certain there are no leaks e Replace faulty heads 326 b KRONE 13 20 2 lt Maintenance Air filter for pipelines lt s ge CP102200 Fig 258 1 Spring 4 Spring 7 Clasp locking ring 2 Filter 5 Sealing ring 3 Spacer 6 Cover cap The air filter 8 cleans the compressed air and protects the brake system from malfunctions Note The brake system is ready for operation even when the filter insert is clogged in both directions of flow Removing the Filter Insert e Press cover cap 6 and loosen the clasp locking ring 7 e Remove the filter insert Maintenance of the Air Filter Clean the filter insert before the beginning of the season Installation of the filter insert Installation is in reverse order to removal Note Observe the correct sequence when assembling the filter insert 327 Maintenance 13 20 3 A 328 as KRONE Compressed air reservoir CP102170 Fig 259 The compressed air reservoir 1 stores the compressed air that is pumped by the compressor Therefore condensation water may settle in the compressed air reservoir 1 during operation The compressed air reservoir must be emptied regularly Spe
181. he power lifter is unintentionally actuated the machine may make hazardous movements Defective or insecurely attached electrical cables may cause fatal electric shocks Defective or insecurely attached hydraulic or pneumatic lines may become detached and flail around Hydraulic oil may escape under high pressure and cause serious injuries to the skin or face Clothing may become caught and wrapped around an exposed PTO shaft or a damaged or incorrectly installed universal shaft When the drive is switched on machine parts may rotate or swivel Hydraulically raised machine parts may descend unnoticed and slowly If the danger zone is not observed people may be seriously injured or killed e Keep people away from the danger zone of the tractor and the machine e Do not switch on the drives and engine until there is nobody in the danger zone The safety clearance is 3 metres on either side of the machine 5 metres behind the machine e Before working in front of and behind the tractor and in the danger zone of the machine Shut down and safeguard the machine see chapter Safety Shutting down and safeguarding the machine This also applies to brief inspection work Many serious accidents in front of and behind the tractor and the machine occur due to negligence and running machines Consider the information in all relevant operating instructions The operating instructions for the tractor The ope
182. he upper line indicates that the displayed value is saved Setting and Saving the Sensitivity of the Direction Display Comprima F155 The higher the sensitivity of the direction display is set the stronger the indications for the direction of motion in the form of arrows 1 WV e Set the sensitivity by using function key ar or the symbol in the top line goes out e Press function key OK the set sensitivity is saved the symbol in the upper line appears The called up menu is closed by pressing function key ESC e Pressing the function key ESC and holding it down brings up the basic screen Note If an even filling is reached all signals expire cO KRONE 8 7 4 KRONE ISOBUS Terminal Menu 1 2 5 Pre signalling Fig 93 Displaying the menu Menu 1 2 Baler setting is called rod You can select menu 1 2 5 i by pressing function key Tord The symbol is highlighted in grey e Press function key OK The display shows menu 1 2 5 Pre signalling The symbol Hain the upper line indicates that the displayed value is saved Note Pre signalling indicates how far in advance it is signalised that the bale has reached the final diameter wes on key a e Set the desired time delay with the function key or m the symbol UIL goes out in the top line e Press the function key OK the adjusted time delay is saved the symbol UOL line appears e Pressing the function key ESCcloses
183. highlighted in grey Press function key OK The display shows menu 1 3 5 Sheet width The current status is displayed as an icon U sm Sheet width 500 mm U en Sheet width 750 mm Change and save status Set the desired number of layers via function ke or The symbol in the upper line goes out Press function key OK The symbol WAU in the upper line indicates that the displayed value is saved Use softkey DEF to reset the sheet width to the factory setting e Pressing the function key ESC closes the called up menu e Pressing the function key longer ESC and holding it down brings up the basic screen 139 KRONE ISOBUS Terminal KRONE 8 8 6 140 Menu 1 3 6 Torn sheet control CC000277 Fig 102 Displaying the menu Menu 1 3 Wrapper setting is called You can select menu 1 3 6 g by pressing function key T or A The symbol is highlighted in grey Press function key OK The display shows menu 1 3 6 Sheet tear monitoring The current status is displayed as an icon RI No sheet tear monitoring U Stop for sheet tear U 1 2 allow one sided sheet tear Note Allow one sided sheet tear means that the wrapping process is continued after a one sided sheet tear with accordingly changed values The nominal speed has to be observed when a one sided sheet tear is existent 540 U min The one sided sheet tear message appears after the wrapping process is complete
184. htening torque Ma in Nm unless otherwise indicated RO UYKU M A N Mim TEREE us F ass ar o me lielas taa ma oi 198 200 235 maas 145 215 255 160 210 310 365 meas 225 990 300 wa 45 610 710 wa 730 1050 1220 maas 30 maae 800 1150 1350 ve ioo 1550 1800 mare 1150 1650 1950 mso aso 2100 2450 NOTE The table above does not apply to countersunk screws with hexagonal socket in case the countersunk screw is tightened via hexagonal socket Note Regularly check that nuts and bolts are tightly in place approx every 50 hours and tighten them if necessary C A KRONE Maintenance 13 6 Tightening torques countersunk screws A thread size the stability class can be seen on the head of the screw Tightening torque Ma in Nm unless otherwise indicated a pee M Ma Nm Nm wu 25 35 41 Tus v re ome 8 2 15 oma 20 29 35 jm OG we 24 e 100 16 wn Ill C we ll wa 240 400 ses BM 400 0234 NOTE The table above does not apply to countersunk screws with hexagonal socket and metric thread which are tightened via hexagonal socket Note Regularly check that nuts and bolts are tightly in place approx every 50 hours and tighten them if necessary 287 C Am Maintenance KRONE 13 7 Tandem Axle Shut down and safeguard the machine see chapter Safety gt Safety routi
185. iated with the operational environment 21 4 3 17 Sources of danger on the machine a a a 22 4 3 18 Dangers associated with certain activities Climbing up ANd down snannnnannnnennnnnanenoennnnnna 23 4 3 19 Dangers associated with certain activities Work on the machine 23 4 3 20 Dangers associated with certain activities Working on wheels and tyres 24 4 3 21 Behaviour in hazardous situations and when accidents occulr 24 4 4 Safety FOULINGS ccccccccceseseecceceeeecaeeeeeeeeeeeeseaesseeeeeeseaeseueeeeeeeseeaeaseceeeessseeaseeeeeeessueeseeeseeeeeesssaagaeses 25 4 4 1 Stopping and securing the mache 25 4 4 2 Supporting lifted machine and machine parts securely 25 4 4 3 Coupling the Machine Safely ccccccseeeceeccceeeeeaesseecceeeeeseaeeeeeeeeeeeseeseeeeeeeessseaeaeeeeeeeesssaaaeeeess 26 4 4 4 Uncoupling the machine safely a ar asss 26 4 4 5 Preparing the machine for repair maintenance and adjustment work 27 4 4 6 Staring the Een le UE 27 4 5 Position of the Adhesive Safety Stickers on the Machine
186. ima CF 155 XC Comprima CV 150 XC Changing the ventilation filter The ventilation filter is permanently installed in the cap 1 of the filler neck 2 To change the ventilation filter the complete cap must be replaced Filter Replacement interval e Change the cap including ventilation filter once a year Filter change e To change the ventilation filter Unscrew the old cap Screw in the new cap Note The cap including ventilation filter must be ordered from the KRONE spare parts warehouse quoting part number 00 219 169 0 cO KRONE Maintenance Comprima CV 210 XC Changing the ventilation filter COM00347 Fig 252 The ventilation filter is permanently installed in the cap 1 To change the ventilation filter the complete cap must be replaced Filter Replacement interval e Change the cap including ventilation filter once a year Filter change e To change the ventilation filter Unscrew the old cap e Screw in the new cap Note The cap including ventilation filter must be ordered from the KRONE spare parts warehouse quoting part number 27 011 473 0 319 Am Maintenance KRONE 320 Changing the return line filter Fig 253 Filter Replacement interval Change the filter element in the return line filter once a year Filter change e Loosen the cover 1 with a spanner e Take out the filter housing 2 by the handle 3 e Take the old filter element 4
187. ima CF155XC Direction of travel window Arrows 1 left right from the display The arrows 1 have three different sizes numbered with 1 3 They show the driver to which side he must correct the direction and how far when driving over a swath to ensure the bale chamber is filled evenly Note If an even filling is reached all signals expire 117 8 3 1 118 KRONE ISOBUS Terminal KRONE Adjustment of bale firmness display for Comprima CF 155 XC p S 0 12 Mt CG000251 Fig 84 The value under the bar display and the height of the bar show the current actual bale firmness as a The value above the bar display and the arrows in the bar display show the set target bale firmness as a The bale diameter is given by the user in basic screen You can use the scroll wheel to select the desired value the selection box is highlighted in colour e Pressing the scroll wheel allows you to jump to the selection box the selection box is highlighted in colour e Turning the scroll wheel increases or reduces the value Pressing the scroll wheel causes the setting to be applied and returns you from the selection box b KRONE 8 3 2 ee KRONE ISOBUS Terminal Adjustment of target bale diameter display for Comprima CV150XC SS J Wa W I 11 Fig 85 Display bale diameter The value under the bar display and the height of the bar show the current ac
188. ime problem bale on swivel table is not OX OX reached Time problem lifter forward is not reached Sensors swivel table adjusted wrong if necessary stop transfer or stowage Net length sensor adjusted incorrectly Filling problem left too small Filling problem right too small Time problem Parking position of wrapper is not reached Comprima CV210 XC Blade up Blade down CA CA OQ Mi N GN NO oO a C KRONE KRONE ISOBUS Terminal 8 18 7 Prompts No Figure Description Should the transfer really be started even though the tying system has not been actuated Should manual operation really be selected even though automatic functions transfer wrapping putting down are running Automatic functions will stop as soon as manual operation is selected Should the bale really be wrapped again Caution The film must be cut off before the second wrapping Should the bale really be put down even though it has not been completely wrapped 193 KRONE ISOBUS Terminal KRONE 8 18 8 Physical messages No Symbol Acoustic Signal Description Sensor net length defective Sensor net runs defective axial play of the net brake is too large for the setting of the play refer to chapter Maintenance Sensor position of net engine defective Sensor slip defective Sensor ground monitoring control defective 109
189. ine and tying mechanism by oil and grease A Effect Machine damage and problems when unrolling twine e The twine twine tensioner and eyes must not be contaminated by oil or grease e The parts of the tying unit through which twine or net run must not be contaminated by oil or grease WARNING A Risk of injury due to unexpected movement of a machine component The net may only be inserted by one person e Make sure that there is no other person in the range of movement of the machine Note The starting end of the net roll must point towards the machine and be pulled out from the top RBV05360_1 Fig 181 The preparations and insertion of the twine roll must be accomplished with machine at standstill Switch off tractor P T O shaft Switch off tractor engine e Raise the lever 2 Swing the brake disc 1 with the net roll mounting shaft 3 forwards e Detach the brake disc 1 e Slide the net roll onto the net roll mounting shaft 3 and the support 4 e Slide the brake disc 1 and cardboard tube clamp 5 counterclockwise into the cardboard tube and then onto the net roll mounting shaft as far as possible 240 zz KRONE 11 15 1 gt P Operation DA RBV00111 Fig 182 Once installed the net roll can be aligned to the right and left in the centre to the machine using the mounting lever 2 e To pull the net release the brake To do this press the lever 1 downwards e Place the net
190. ing blade bar 73 Start up 74 EE KRONE Note Connect hydraulic hoses correctly The hydraulic hoses are marked with numbers and coloured dust caps Set the single action control units of the tractor to float position Turn off the tractor and secure it against the possibility of rolling back Connect the hydraulic coupling blue T of the machine to a single action control unit of the tractor Connect the hydraulic coupling red 1 of the machine to a single action control unit of the tractor Connect the hydraulic coupling yellow 3 on the machine to a single acting control unit on the tractor Connect the hydraulic couplings green 7 green 7 on the machine to a double acting control unit on the tractor Note For further information about connecting the hydraulic lines refer to the tractor operating instructions b KRONE Start up Comprima CV 210 XC To perform the following hydraulic functions the tractor requires 1 single action control unit 2 double action control units SSES Function O Single acting control unit Raising lowering the pick up or blade base yellow 3 depending on preselected setting on control unit e Pressure yellow 3 Raise the pick up or blade base e Float position yellow 3 Lower the pick up or blade base Double acting control unit Raising lowering support jack green 5 green 5 e Pressure green 5 Raising support jac
191. ing in front of the ratchet mechanism 3 If this is not the case check the settings of the cut off position and the feed position and adjust if necessary 11 15 4 Selecting the Number of Net Winds The number of net winds is set at the control KRONE ISOBUS Terminal comfort controls In Comfort electronics the default bale size and the number of net winds are used to automatically determine the net length 244 b KRONE 11 15 5 lt Operation Setting Cut off Position RPN00044 Fig 187 The cut off position has been reached when the ratchet mechanism 1 is raised and dimension A between the ratchet mechanism 1 and the adjusting lever 2 is A 410 mm If this is not the case please proceed as follows e Call menu Manual sensor test in the operation terminal e Move the engine in over the control unit until dimension A between the pivot point of the ratchet mechanism 1 and the adjusting lever 2 is A 2 mm If the dimension A 410 mm is reached save the cut off position e Adjust the cable 3 to dimension B 365 mm Note If the net is not cut off by practical use the dimension must be set to 360 mm 245 Operation KRONE 11 16 Adjusting Soft Core Comprima CV 150 CV 210 XC Fig 188 To adjust the soft core move the baling path of the front feeder rake 4 to the right and left e Remove the screw 5 e Move the stop 6 one borehole to the right or left see
192. ion roller of the belt 61 Commissioning KRONE 5 3 62 A d h Changing the Drawbar Height and Adjusting the Hitch DANGER Unexpected movements of the machine Effect Danger to life injuries or damage to the machine Secure the machine against rolling away with wheel chocks and by applying the parking brake Use suitable supporting blocks for supporting the machine e There is a risk of crushing one s feet when cranking down the parking support Note Before aligning the machine and adapting the height of the drawbar the tyre pressure must be checked and adapted to the value for the existing tyre type which is recommended in the tyre air pressure table refer to chapter entitled Maintenance if necessary Comprima CF 155 XC Comprima CV 150 XC RPNOO068 Fig 31 Note To guarantee optimum working the machine must be hitched in a way that the dimension X is approx 700 750 mm up to 800 mm in straw use When hitched up the dimension X must be measured between the centre of the cutting roller and the ground b KRONE Commissioning Comprima CV 210 XC RPN00068 Fig 32 Note To guarantee optimum working the machine must be hitched in a way that the dimension X is approx 800 850 mm the dimension may change depending on the tyre size When hitched up the dimension X between the centre of the cutting roller and the ground must be measured 63 Commissioni
193. ional safety As a result accidents may occur and people may be seriously injured or killed e Only perform work which is described in these operating instructions Before performing any work shut down and safeguard the machine see chapter Safety Shutting down and safeguarding the machine e All other maintenance and repair work may be performed by a qualified service centre only Raised machine and machine parts The raised machine may accidentally drop roll away or overturn and crush or kill people e Do not stand under the raised machine First put the machine down e Before performing any work under the machine securely support the machine see chapter Safety Securely supporting the raised machine and machine parts e Before performing any work on or under raised machine parts lower the machine parts or secure them mechanically with rigid safety supports or with a hydraulic shut off device to prevent them from dropping 23 Safety 4 3 20 4 3 21 24 b KRONE Danger associated with welding work Improper welding work will endanger the operational safety of the machine As a result accidents may occur and people may be seriously injured or killed e Before performing welding work on the machine obtain the consent of KRONE customer service and if required identify alternatives e Have welding work performed by experienced technicians only Dangers associated with certain activities Working on wheels an
194. ions truct ing Ins pi E O O igina Or CO KRONE Round baler Comprima CF 155 XC Comprima CV 150 XC Comprima CV 210 XC from serial no 911 106 Order no 150 000 046 11 en 13 01 2015 EE Foreword KRONE CT EC Declaration of Conformity y SEN We Maschinenfabrik Bernard Krone GmbH Heinrich Krone Str 10 D 48480 Spelle hereby declare as manufacturer of the product named below on our sole responsibility that the Machine Krone Round Baler Type types Comprima CF 155 XC Comprima CV 150 XC Comprima CV 210 XC to which this declaration refers is in compliance with the relevant provisions of EG directive 2006 42 EG machines and EG directive 2004 108 EG EMV The signing Managing Director is authorised to compile the technical documents Spelle 01 10 2013 Ing Josef Horstmann Managing Director Design and Development Year of manufacture Machine No b KRONE Foreword Foreword Dear Customer By purchasing the round baler you have acquired a quality product from KRONE We are grateful for the confidence you have invested in us in buying this machine lt is important to read the operating instructions very carefully before you start operating the machine to allow you to use the round baler to its full capacity The contents of this manual are laid out in such a way that you should be able to perform any task by following the instruction
195. its support Note After threading in the net must be removed on a width of approx 500 mm Thus the tappets of the feed roller can pick up the net cleanly b KRONE 11 15 2 Operation Setting of the Feed Position P P OP ae KI OI ee tf RPM00014 1 Fig 185 An optimum adjustment of the feed position has been reached when the feeder plate 3 of the net has moved out just far enough that there is still a small gap between the feeder plate 3 and the conveyor roller 4 The dimension between the pivot point of the ratchet 1 and the operating lever 2 must be A 285 mm In Case of Deviations Set the Dimension A As Follows e Call menu Manual sensor test in the operation terminal e Move the engine out over the control unit dimension A between the pivot point of the ratchet mechanism 1 and the adjusting lever 2 A 285 mm Only a little gap is allowed to be existent between feeder plate 3 and conveyor roller 4 Save these feed position via a control unit 243 Operation KRONE 11 15 3 Setting of the Tying Position RPNO0045 Fig 186 e Call menu Manual Sensor Test in the operation terminal e Initiate tying position by pressing the corresponding key e The engine automatically approaches the tying position Note Once the engine has reached the tying position the cable 1 must not be tight and the roller 2 must be rest
196. ive chains are supplied with oil by a central chain lubrication system As the lubricating oil lines are not highly pressurised it may occur that they jam For this reason the lubricating oil lines must be checked for proper functionality daily before using The mode of operation of the central chain lubrication system is explained in the Chapter entitled Settings Shut down and safeguard the machine see chapter Safety gt Safety routines Shutting down and safeguarding the machine Tensioning the Drive Chains Front Floor Conveyor Drive fei ie h P A 4 7 L WAWA Fig 238 The front floor conveyor drive 1 is located on the left side of the machine Check the Chain Tension e The chain is tightened by the tension spring 2 The length of the spring when tightened must be a 220 mm Correct the Chain Tension e Turn the nut 4 on the threaded rod to adjust the stop pad 3 used only as a stop toa dimension b between 105 110 mm Select dimension B in that way that a play between support 5 and stop pad 3 is available Note In case the spring tension is insufficient the flat bar 6 can be turned and the other eye can be used b KRONE 13 16 1 2 Maintenance Rear Floor Conveyor Drive Comprima CV 150 CV 210 XC TE ee ve RPNOOO71_ 1 Fig 239 du rear floor conveyor drive is located on the right side of the machine Check the Chain Tension The l
197. jo x LLA N A E qZLAX 59 LIA PE qex Zei I y ve X luono uuoo vi O I FOE OWN npoui asojo wie Dumuoddne ZLA si q v Joen DO GO aen p le io eu OND IA P CV YI oe OND BIA P CV YI SW9IA SN e UOL X u do we Bunioddns 9LA A m SIDD q9LAX L qex Zei CV LS X uono uuoo WIWMd O I COP JIM ainpow u do wie Bunuioddns 91 A N A 39 614 asss gt gt lt on OQ a E SS lt S c z IGLAX Gy aseajal wue Bunioddns GLA qSLAX 9 qex I CV OC CN uono uuoo v vi O I FOR NWy mpou se j wie Duuioddne GLA SM 8bA st SM IEN Xx 39 814 q0ex e0 X z 9814X 490 we Bunioddns 8LA l qg LAX e0 X q0 X 9 qex CV 8 X uono uuoo S VIN O I COP OWN ainpow yoo wie Bunioddns g L A D A01d aweu SEU E ainssaud Buljeq ZZA 2o aunsseid Bul eq q dau si qlv Jasy saqly LO 20 80 EN as JOJJuo5 pejq suondo CU 69800 LOSL asp uoneoo ee OU JUSLNDJOP Gogo ed X OSL AD 9X SS L AD ved LLOZ ounjyoejnuew Jo I a lt
198. k e Pressure green 5 Lowering support jack Double acting control unit Raising lowering the blade bar green 7 green 7 Nf e Pressure green 7 Raise blade bar Z D e Pressure green 7 Lower blade bar Note Connect hydraulic hoses correctly The hydraulic hoses are marked with numbers and coloured dust caps e Set the single action control units of the tractor to float position e Turn off the tractor and secure it against the possibility of rolling back Connect the hydraulic coupling yellow 3 on the machine to a single acting control unit on the tractor For design with hydraulic support jack Connect the hydraulic couplings green 5 green 5 on the machine to a double acting control unit on the tractor For design with hydraulic knife selection Connect the hydraulic couplings green 7 green 7 on the machine to a double acting control unit on the tractor Note For further information about connecting the hydraulic lines refer to the tractor operating instructions 19 Start up KRONE 6 3 Hydraulic brake Export RES N SSES A KR200032 A hydraulic brake is provided for certain export versions In this version the corresponding hydraulic hose is connected with the control valve on the tractor side The brake is activated by actuating the tractor brake pedal 76 b KRONE 6 4 A A Start up Install the PTO shaft Shut dow
199. l table which is fitted behind The wrapping table does not move and the tailgate closes again The wrapping process is started in the wrapping device while a new bale is compacted in the bale chamber The bale rolls onto the driven swivel table while the wrapping arm circles at the same time around the bale and wraps it witch stretch sheet After a pre set number of wraps this working process stops automatically As soon as the driver stops because the next bale has been compacted completely and imbedded the net the swivel table inclines to the rear The bale is set down on a rubber cover behind the machine Comprima CV 210 XC When the bale chamber is full an audio signal will be heard and the driver must stop the machine The two net guide rollers transfer the net into the bale chamber and the bale is tied there The tailgate opens if the net tying process is completed The bale is transferred from the bale chamber to the wrapping table via gravity If necessary the lifter activated by a sensor supports the bale transfer on slopes Note The bales should not be placed down while the machine is moving as this could lead to damages of the sheet Note Wrap the bale all round with at least six layers of sheet The overlapping of each two layers of sheet must be 50 255 C a Operation KRONE 11 18 4 Store Bale lt 256 Pile the bales up in that way that the face sides of the bales are located horizontally to
200. machine e There must be no driving with blades and lowered blade base since the blades then have no guidance to the cutting system and the tine will be incised by the cutter b KRONE 11 3 Operation Filling the bale chamber L o KE z 20 m KR 1 017 Fig 153 To attain a consistent bale density inside a round bale the bale chamber should be filled evenly The swath width is an important factor here The swath width is optimal if the swath has exactly the same width as the bale chamber If the swath is wider than this distortion of the round bales may result The round bale will be frayed on the sides and difficult to eject from the bale chamber If the swath is narrow the bale chamber can be filled evenly only by driving onto the swath from alternate sides left right Do not zigzag drive long distances on the left and right side of the swath as shown in the illustration Too frequent changes and uneven filling of the bale chamber will produce barrel shaped round bales and uneven bale density The reached diameter can be read off the monitor of the operation terminal The baling pressure that is reached can be read on the baling pressure indicator on the left side of the machine Note Overloading the machine with bales that are too tight or too large can result in serious damage to the machine The machine has a mechanism that triggers forced tying automatically in case of overload Each forced tying is automatically
201. mation prompt Note All menu items listed in main menu 3 Manual operation can be called Possible status messages for manual operation without confirmation prompt see chapter Status messages 177 C KRONE ISOBUS Terminal KRONE A d 178 Caution When menus 4 9 1 and 4 9 2 are activated they are executed immediately without program controlled confirmation prompt Note If manual operation without confirmation prompt is executed despite display of an error message in the display damages to the machine may arise Possible error messages manual operation without confirmation prompt No defined state no error message The bale chamber is not closed The lever is not down al pad any The wrapper is not in zero position S ST Quick stop is not active STOP D f The bale chamber is not opened e D o The swivel table is not in position 8 E e You can use the function key ESCto close the menu that is displayed The display shows the menu level 4 Service e Pressing the function key ESCand holding it down brings up the basic screen e Pressing the function keyESC closes the called up menu The display shows menu level 4 Service e Pressing the function keyESC and holding it down brings up the basic screen b KRONE 8 14 8 15 KRONE ISOBUS Terminal Main Menu 5 Information D x LL _ Cer au 20083040 a 5 1 OK fot 1 150200174 13 ISO 2
202. med by trained professionals The wear limit of the socket in the towing ring 1 is a 43 mm If this value is exceeded the socket must be replaced To minimise wear clean the socket and towing ring daily and lubricate them with grease Note The towing ring should be coupled always horizontally in the towing hitch Observe the correct combination of towing ring and towing hitch observe the specifications on the type plate b KRONE 13 10 lt 13 10 1 gt 13 10 2 Maintenance Oil Level Check and Oil Change on the Gearboxes Note Do not mix different types of oil Effect Damage to the machine e Never mix different types of oil e Before changing the type of oil consult customer service Never use engine oil ENVIRONMENT Disposal and storage of used lubricants and oil filters Effect Environmental damage Store or dispose used oil and oil filters according to statutory provisions Oil Level Check and Oil Change Intervals Gearboxes Note oil level check and oil change gearboxes and lubricating the machine Effect Long expected service life of machine Oil change on all gearboxes after 30 to 50 operating hours and then after every season e Oil level check each time before using and no later than after about 500 pressed round bales e Compliance with the changing intervals is absolutely essential for bio degradable oils because of ageing of the oils Filling Quantities and Lubrication
203. mend leaving the parking jacks in this position Making the adjustment e Loosen the screw connection on the parking jack 14 e Move the parking jack 14 to the required position and secure with bolt washer and nut b KRONE 6 17 Start up Moving the Bale Turner into Transport Position Danger Transport road travel Effect Danger to life serious injuries or serious damage to the machine e The bale turner must be swivelled up into transport position for transport road travel Make certain that the locking bar 12 is in pos I in transport position and secured with bolt and cotter pin COBW0011_2 Fig 59 Swivel the locking bar 12 out of position I by removing the bolt 11 e Fold in bale turner 1 Swing locking bar 12 into position 1 and secure with bolt washer and cotter pin 11 Note During road travel the baffle plate 13 must always be folded out otherwise the left rear light would be covered 93 Start up 6 18 6 19 94 AZ KRONE Mounting the bale cloth on the bale turner COBW0022 Fig 60 Mount the bale cloth 1 on the marked bore holes of the bale turner as follows 1 Guide the hexagonal head screws 2 on the right and left through the bore holes and place a washer 3 on the screw stem COBW0023 Fig 61 2 Attach the bale cloth 1 to the hexagonal head screws 2 right left fit the washers 3 and nuts 4 and tighten Removing
204. menu 7 1 1 Select day night display lighting b KRONE 8 16 3 KRONE ISOBUS Terminal Menu 7 1 3 Softkeys ISO Terminal Note This menu only appears on ISO terminals with less than 10 keys In the menu the basic screen for ISO terminal with less than 10 keys is set to 5 or 10 softkeys During the change over to 10 softkey buttons additional softkeys will be virtually included and can be reached by scrolling Note An additional ISO joystick is recommended for ISO terminals with less than 10 keys so that the hitched machine can be operated more comfortably For the assignment of the joystick please refer to chapter Example of Joystick Assignment CC000760 Fig 139 Menu 7 1 Virtual Terminal VT is called Select menu 7 1 3 e by pressing function key or JL e Press function key OK The display shows menu 7 1 3 Softkeys ISO Terminal 183 KRONE ISOBUS Terminal KRONE 184 Fig 140 The current status is displayed as a symbol Change of the basic screen to 5 softkey buttons Change of the basic screen to 10 softkey buttons The symbol rg in the upper line indicates that the displayed status is saved Changing and saving status e Set the desired status with key Tt or 4 the symbol in the upper line goes out e Press key OK the set status is saved the symbol in the upper line appears Use the ESC key to close the menu currently displayed e Pressing function
205. mer counter is displayed when actuating the function key for settings see menu 2 1 Customer counter The current status is displayed Setting the customer counter The holding arms are released when the Release holding arms function key is activated only for recognized torn sheet When the function key is pressed the Close holding arms holding arms are closed only for recognized torn sheet 114 KRONE KRONE ISOBUS Terminal 100 80 I cn C CG000250 Fig 82 Displays in the main window III depending on how the machine is equipped Tying analysis display Net has not been cut off Net tying process has finished 115 KRONE ISOBUS Terminal KRONE 1 0711 160 140 120 400 80 a Ocm Fig 83 Wrapper analysis display Swivel table centre without bale gt AEYN Swivel table forward without bale Swivel table rear without bale O Swivel table forward with bale Swivel table centre with bale m Swivel table rear with bale H Wrapping process active e 5 Wrapping process running at half speed in case of an one TI O uh up 1 2 V sided sheet tear monitoring see Chapter entitled Sheet Tear Monitoring 116 b KRONE KRONE ISOBUS Terminal Note If the indications for the direction of motion are too strong or too weak they can still be adjusted see menu Sensitivity of direction display Only for Compr
206. mo uuooS 0 de 39 119 N l 4 L I SW 118 SV E x a v qzx iT ole Buims dn jeq Lg ek gx Ye 91qe Bums dn jeq 91g OO L OW lnpouu L old O I 8 Zx Uuolo9 uuoo oo 39 919 N SM 919 WW t XT O18 v qzx eo L gX Yo qe Buims dn ajeq 9Ld L e9 gX q e uiuo p A01d Bueuo si qlv Joen uo e0ys Z 1 M9IAA9 Siosu s LO LZ900L0SL Yee aer uoleoo uejd OX 0 L AOD vca OU JUSWINIOP payealg wje Bulddeim jubiey gzg Je9 10 pzg uonisod wie Buiddeum Leg uoljisod o18z wie Bulddeum ozg Jay dn eq zg NO 8Q JE 9Zg Za S L OWY npou 9q e L OWY npou oO EI L OW ampow oO EI L OW npou ZOpI L OW SImpou ZO bi LOW 2inpow k ILINW O I t OYSHOIC O I ZL DYADIC O I vl DYADIC O I EL DYsADIG O I oz SIG O I 6 ZX uo o uuoo Ge ZX uono uuoo GL ZX luo mo uuoo 9 Zx luomo uuoo Ov X luo no uuoo 6L x uomo uuoo i EM i EM i EM i EM i EM i V Nw K iw No VE Bloc at qaya DI qzx 3 axe Gee gek Ge E S Ge o Ge A S 2 A 2 e q8zgX a DG d HZY d e cqx d eozgx zi ezzgx d egzgx AS NWAO 1A z z uonisod uonisod oe
207. n and safeguard the machine see chapter Safety gt Safety routines Shutting down and safeguarding the machine Caution Changing the tractor Effect Damage to the machine When using the machine for the first time and whenever changing the tractor Check PTO shaft for the correct length If the length of the PTO shaft does not match the tractor always observe the chapter entitled Adjusting the length of the PTO shaft Caution Swivel range of the PTO shaft Effect Damage to the tractor or the machine e Check the swivel range and clearance of the PTO shaft Q RBV02240 Fig 43 Remove the universal shaft 1 from the PTO shaft support 2 11 78 Start up as KRONE Fig 44 CAUTION Contact with parts of the tractor or the machine may result in damages to the machine or to the universal shaft Make certain there is sufficient free space in the swivel range of the PTO shaft in all operating states Tractor Side e Slide universal shaft 1 on the tractor PTO shaft and secure it To prevent the PTO shaft from turning guide the safety chain 2 under the universal shaft guard and insert it onto the tractor ATTENTION Universal shaft not correctly attached Effect Damage to the universal shaft or to the machine e Ensure that the safety device of the universal shaft is locked into place after installation Use only the universal shaft supplied by the factory b KRONE 6 5 Start up C
208. nal Moving Engine in Use the B4 softkey to move the engine in as long as the softkey is activated or until the feed position is reached see menu 3 1 Manual Operation Baler Saving Value ei e Press function key OK until the BE appears briefly in the upper line Note The value is stored when the left bar has accepted the value of the centre bar Approaching Tying Position Engine Use softkey DEF to move the engine to the engine tying position as long as the softkey is activated or until the position is reached e Adjust the engine tying position mechanically 165 KRONE ISOBUS Terminal CC000302 Caution The bale chamber must be closed and empty If the bar 1 is not inside the rectangle 2 when the bale chamber is closed and emptied the corresponding sensor 7 must be adjusted mechanically To do this Loosen the sensor 7 and turn it in the oblong hole until the bar 1 is positioned inside the rectangle 2 of the bar display Note An audio signal sounds if the bar 1 is inside the rectangle 2 Saving Value Press function key OK until the symbol appears briefly in the upper line Note lt The value is saved when the left bar has accepted the value of the right bar 166 h KRONE KRONE KRONE ISOBUS Terminal Adjust sensor B9 B10 bale diameter Comprima CV150XC VPNO0012_4 _ COMO00011_ 1 Fig 125 Before you readjust or correct the setting of the sensor 7 B9 B10
209. nd will be evaluated by your connected ISOBUS machine in order to initiate the accordant automatic actions in hazardous situations if necessary If the ISOBUS short cut button is actuated the accordant alarm mask will be shown in the display Ce CO KRONE CC000070 Fig 72 The functions listed in the following are blocked by the job computer on the machine side e All functions of the machine are stopped C KRONE KRONE ISOBUS Terminal If the ISOBUS short cut button is deactivated again the following message will appear in the display CC000071 The alarm mask is exited by actuating the function key b It is only now that all functions of the machine are available again 105 b KRONE KRONE ISOBUS Terminal Connecting the Multi Function Lever to the CCI Terminal on Tractors with an Integrated ISOBUS System 8 2 1 Fig 74 Note The connection of terminal to tractor is made via a special cable set 5 which can be ordered by stating the KRONE article no 20 081 223 0 Connect plug 2 of cable set 5 with socket 1 CAN1 IN of the terminal e Connect plug 4 of cable set 5 with socket 3 CAN1 OUT of the terminal Connect ISO plug 6 9 pole of cable set 5 with the ISO socket 6 9 pole of the multi function lever Connect ISO plug 7 9 pole of multi function lever with ISO socket 7 9 pole located in the tractor cabin 106 KRONE KRONE ISOBUS Terminal KRO
210. nes Shutting down and safeguarding the machine Comprima CF 155 XC Comprima CV 150 XC VP100101_1 Fig 226 Note The brake activation has been adjusted in the factory The brake must be readjusted e if the braking effect diminishes for example due to wear on the brake shoes e if the activation path of the brake cylinder X is greater than 50 mm 288 b KRONE Maintenance Readjusting Brake Linkage Note Each time before the brake linkage 2a 2b is readjusted the thickness of the lining on the brake shoes must be checked The thickness of the lining must still be at least 2 mm 1 Disconnect the brake linkage 2b from the brake lever 4 2 Loosen the counter nuts 1 on the brake linkage 2a 3 Turn the brake linkage 2a until the brake lever path a1 is about 30 mm on activation Note The compensation lever 11 must be flush both in the oblong hole 1 and in the upper part Il of the support 12 for all settings 4 Disconnect the brake linkage 2a from the brake lever 5 5 Then mount the brake linkage 2b on the brake lever 4 again note the length of the brake lever RL 6 Loosen the counter nuts 3 on the brake linkage 2b Turn the brake linkage 2b until the brake lever path a2 is about 30 mm on activation 8 Then mount the brake linkage 2a on the brake lever 5 again Observe the brake lever l
211. ng KRONE lt lt 64 RPN00063 Fig 33 Note Before starting the adjustment set the machine on the parking support and uncouple the tractor Adjusting the height of the drawbar e Loosen the safety nuts 3 until the drawbar 1 can be turned in the lock washer connection e Adjust the drawbar 1 to the height of the tractor hitch To adjust the height of the hitch to the height of the tractor hitch make setting on both sides e Loosen the screw joint 4 e Align towing ring 2 horizontal parallel with the ground e Tighten the screw connections 3 and 4 to the appropriate torque Note The lock washers 5 must intermesh Retighten the screw connections after 10 operating hours Note Mind the tightening torques refer to chapter Maintenance Tightening torques b KRONE 5 4 5 4 1 Commissioning PTO shaft Length adjustment Warning Rotating universal shaft Effect Danger to life or serious injuries e Before pushing the universal shaft onto the PTO shaft of the tractor switch off PTO shaft turn off the engine and pull out the ignition key Secure tractor and machine against unintentional rolling a er ROA 2 ay A Ma H Ju FOR00015 Fig 34 To adapt the length of the universal shaft hitch the machine onto the tractor The shortest position of the universal shaft is reached in close cornering The length of the PTO shaft 1 must be adjusted e
212. ng length is determined by the number of blades Use the key supplied to make adjustments HDC00012 Fig 167 The multi purpose key 1 can be found on the pick up on the left hand side of the machine The multi purpose key can move suddenly due to the spring force of the pretensioned blades e Particular caution is thus advised when making adjustments to the blade shaft using the multi purpose key N CAUTION Unexpected movement of multi purpose key To remove the key e Remove the spring cotter pin 2 e Pull the multi purpose key 1 off the retaining bolt 3 After use push the multi purpose key 1 back onto the bolt 3 and fix it in place with the spring cotter pin 2 228 C KRONE Operation Table Cutting Length depending on Blade Equipping In case of 17 blades Cutting length Number of Blades Setting A B In case of 26 blades Cutting length Number of Blades Re A B 229 Operation KRONE A 230 CAUTION Blades fold back The blades are pre tensioned via spring force Risk of injury Never press the blades into working position manually e Use a tool for example a hammer e Always wear protective gloves Caution Risk of injury Risk of injury on the blade in the blade bar e Always wear protective gloves VM e S i RPN00020 2 Abb 168 After turning on the blades always check to see whether all the cutters have swivelled up If this is not the case e Move the blade
213. ng the sheet roll holder 3 loosen the locking 4 and pull the sheet roll holder forward until the indentation 5 snaps into place in the locking lever 20 Operation 258 KR001230 Fig 198 Two sheet sizes can be used 750 and 500 mm Sheet rolls with the following dimensions achieve the best results e 750 mm wide e Core 76mm maximum sheet roll diameter 260 mm We recommend using quality brands for example DLG accepted sheets Note The following worksteps must be performed on both sheet holders as the sheet holders must always have the same setting e To release the tension on the section rollers turn the lever 1 to the right until the locking lever 2 falls behind the lower guidance 3 and secures it h KRONE Operation _ o EN D E CP400010_1 Fig 199 Note The sheet roll guide 1 must always run parallel to the upper end of the sheet roll 2 Therefore the roll guide 1 must be assembled on different perforated bars depending on the size of the roll e Use the perforated bar 6 for small rolls e Use the perforated bar 4 for big rolls e When using a different size of the rolls than before assemble the roll guide 1 onto the accordant perforated bar refer to note above e Unlock the sheet roll guide 1 by activating the bolt 3 and fold it upwards e Insert the sheet roll 2 into the lower holder e Insert the roll guide 1 in the she
214. nge to the driving behaviour e Shut down and safeguard the machine see chapter Safety Shutting down and safeguarding the machine e Immediately eliminate potential causes of damage for example heavy soiling or tighten slack screws e Determine the cause of damage according to these operating instructions see chapter Malfunctions Cause and remedy e f possible repair the damage according to these operating instructions e Inthe case of damage which may affect operational safety and cannot be repaired according to these operating instructions Have damage repaired by a qualified service centre b KRONE 4 3 9 Safety Technical limit values If the technical limit values of the machine are not observed the machine may be damaged As a result accidents may occur and people may be seriously injured or killed Observance of the following technical limit values is particularly important for safety Permitted gross weight Maximum axle loads Maximum payloads Maximum trailer load Maximum bearing load Maximum transport height Maximum speed e Observe limit values see chapter Description of machine Technical data Danger zones Danger zones on the tractor and the machine The area around the tractor and the machine is a danger zone There are the following hazards in this danger zone The tractor and the machine may start moving or rolling away and run over people If t
215. ninzg dn ejd sajsues ZL A jqe Bums LLA si q v Joen LLO SOE aep p le io spiewuo j jqe Bulims OLA lnpouu d v L OINM t WOYLS O I g CN uono uuoo d EM LI aex SW DL N q Tuo qe1 Bus x OLA q0LAX re ms 39 04 Y I ey ze CN uono uuoo Zk YINMd O I d v L OINM mnpow SpsleMIO aide Bums OLA X QA P S V H SM 8A SN q804X z dn JEqueyo jeq X 804 A hay q804X 39 84 f y g L ZX UOlJOSUUOD t VIWMd O I JOE L OINM mnpow dn 1 quueuo eq gA Sexy pa CN P SM PLA N mmm qti et qe Burms x YLA e r qat LAX 5O PLA 9 qex d I ey 9 ex uono uuoo z vi O I POP OW enpow uleyo aide Buims rL A uo LL joys uol e90 jue d ssoyenjoe X Ole AD ved q deu ufug p A01d ueyo LO LZ900LOSL si q v Joen LLO SOE aen OU Ju ulInOoop gt gt gt i ns S w Bo co S lt g t lt wn RB Se y qex ZX AX S S T H ees ZX A
216. nobody is in the danger zone of the PTO shaft or the universal shaft e Ifthe angles are too large switch off the PTO shaft The machine may be damaged Parts may be flung out and cause injury to persons e If the PTO shaft is not required switch off the PTO shaft Danger zone universal shaft People may become caught by the universal shaft pulled in and seriously injured e Ensure that the universal shaft guards are attached and functional e Ensure that nobody is in the danger zone of the PTO shaft or the universal shaft e Provide the section tube and universal shaft guards with adequate cover e Allow the universal shaft locks to engage e Attach the chains to prevent the universal shaft guards from rotating with the shaft Follow the operating instructions for the universal shaft b KRONE 4 3 10 4 3 11 Safety Risk of injury due to machine parts that continue to run After switching off the drives the following machine parts continue to run f Universal shaft Drive chains Pick up Net rolls Floor conveyor Wrapper machine parts continue to run persons may be seriously injured or killed Stop and secure the machine refer to chapter Safety Stopping and Securing the Machine Only touch machine parts when they are at a standstill Keeping safety devices functional If safety devices are missing or damaged people may be seriously injured or killed by moving machine parts Replace damaged safety
217. o prevent the disconnected machine from rolling back lay wheel chocks 1 in front of and behind the same wheel Note On machines with coaster steering axle make sure that a wheel on the front axle is secured Stop Points WARNING Danger from falling loads e Never step or stay under suspended loads e Maintain an adequate safety distance from suspended loads e Before transportation compare load capacity of slings and cranes and choose transportation equipment with a sufficient degree of safety and lifting capacity e Prevent strong impacts and make sure that the machine does not become wedged Lifting Eyes The machine is equipped with four suspension points Two suspension points are located right and left on the top on the frame of the wrapping mechanism Two suspension points are located next to the floor conveyor right and left upper machine side Raise e Use a lifting traverse with a minimum load bearing capacity depending on the permitted gross weight of the machine refer to Chapter entitled Introduction Identification e Close the tailgate Swivel the parking support parking jack into transport position e Lift the pick up e Make sure that all safety devices are locked e Attach the chains of the lifting traverse to the four suspension points of the presse e Make sure that the hooks of the chains are attached correctly to the suspension points b KRONE 4 7 8 4 7 9 Safety
218. oad Liquids under pressure The following liquids are under high pressure Hydraulic oil Liquids under high pressure may penetrate the body through the skin and cause serious injuries e If adamaged pressure system is suspected immediately contact a qualified service centre e Never search for leaks with bare hands Even a pin sized hole may cause serious injuries e Keep body and face away from leaks e f liquids penetrate the body immediately consult a doctor The liquid must be removed from the body as quickly as possible Danger of infection Hot liquids Risk of burns and scalding from hot liquids e When draining hot consumables wear protective gloves e f required leave liquids and machine parts to cool down before performing repair maintenance and cleaning work A damaged compressed air system may damage your health Damaged compressed air hoses in the compressed air system may cause hoses to tear off Flailing hoses may cause serious injuries e lf it is Suspected that the compressed air system is damaged immediately contact a service centre b KRONE 4 3 18 4 3 19 Safety Dangers associated with certain activities Climbing up and down Climbing up and down safely People who behave carelessly when climbing up and down may fall off the ladder People who climb onto the machine without using the designated ladders may slip fall and seriously injure themselves Dirt as well as operating fluids
219. ome screen 153 KRONE ISOBUS Terminal KRONE 8 11 2 Switching on off wrapping arm pica Fig 116 e Pressing the softkey will switch the wrapping arm on When the wrapping arm is turning the display switches to OFF e Pressing the softkey pn will switch the wrapping arm off 8 11 3 Move the wrapping arm to zero position 3 A 0 e Press softkey an and hold it down until the wrapping arm has reached the zero position Move the swivel table voir chapter Swivel table move manually Possible status messages window 1 wrapping arms swivel table refer to chapter Status messages 154 b KRONE 8 12 KRONE ISOBUS Terminal Menu 3 2 Manual Operation Wrapping Arm CV 210 CC000311 Fig 117 Calling the Menu Menu 3 1 Manual Operation Baler is called e Activate the key to change to menu 3 2 Manual Operation Wrapping Arm EB Displays in the Display 1 Wrapping arm display 2 Height wrapping arm display 3 Bale chamber and lifter display 4 Holding arms display For Possible Status Messages Window 3 Bale Chamber See Chapter Status Messages 155 KRONE ISOBUS Terminal KRONE 8 12 1 Move the Height of the Wrapping Arms Fig 118 e Use softkey F to move the wrapping arms to the top as long as the softkey is activated or the desired position is reached e Use the gt softkey to move the wrapping arms downwards as lon
220. ompressed Air Connections for the Compressed Air Brake WARNING Danger to life due to failure of the brake system or unexpected movement of the machine Pneumatic lines that become detached or worn through pneumatic lines will cause the brake system to fail Thus there is a risk of Serious injuries or death e Lay the pneumatic lines so that they do not rub or tension Furthermore they should not be jammed or touch other parts e g tractor tyres The machine may move unintentionally if the order of the pneumatic lines is interchanged when connecting them Thus there is a risk of serious injuries or death e Connect the yellow coupling head first Then connect the red coupling head e After having connected the quick couplings check that they fit perfectly The machine can optionally be equipped with a dual line compressed air braking system The coupling heads are connected to the machine for attachment of the reservoir red and brake line yellow of the tractor WARNING Risk of accident due to insufficient brake force e For road travel driving is permitted in position 2 Full load only e Inthe Half load or Zero load position the braking effect can be adapted reduced e g when working on wet meadows Shut down and safeguard the machine see chapter Safety gt Safety routines Shutting down and safeguarding the machine Fig 45 e Insert the coloured compres
221. ontrol functions to the display of the ISOBUS terminal Operation with an ISOBUS terminal is analogue to the KRONE ISOBUS terminal CCI Prior to start up refer to the operating instructions for the method of operation of the KRONE ISOBUS terminal CCI A fundamental difference to the KRONE ISOBUS terminal CCI is the arrangement of the softkeys which are determined by the selected ISOBUS terminal Only the functions that differ from the KRONE ISOBUS terminal CCI are described in the following Note The values for Bale size Comprima CV150 and Bale density Comprima CF155 which are set by the scroll wheel in the basic screen on the KRONE ISOBUS terminal CCI are set on the ISO terminal with the selection key predetermined by the ISO terminal refer to the operating instructions of the ISO terminal manufacturer Note Menu item 1 4 Contrast of the KRONE control cannot be called up on the ISOBUS terminal A setting is performed directly via the ISOBUS terminal if applicable refer to operating instructions of the ISOBUS terminal manufacturer If necessary acoustic signals must be enabled from the terminal refer to operating instructions of the ISOBUS terminal manufacturer 199 b KRONE ISOBUS operation 9 3 ISOBUS Auxiliary function AUX Note lt There are terminals which support the additional function auxiliary AUX With this function programmable keys of the peripheral equipment e g
222. operation and lack of knowledge of the machine as well as incorrect behaviour in hazardous situations is risking the life of the operator and third parties e Before starting up the machine read and follow the operating instructions and safety instructions Danger if the maximum permitted PTO speed or the maximum permitted operating pressure is exceeded If the maximum permitted PTO speed is exceed parts of the machine may be destroyed or forcibly ejected If the maximum permitted operating pressure is exceeded hydraulic parts may be damaged As a result people may be receive serious or life threatening injuries Observe the permitted PTO speed Observe the permitted operating pressure 3 Order No 942 196 1 8x Danger due to crushing or shearing Risk of injury due to crushing or shearing points on moving machine parts e While parts are moving never reach into areas where there is a risk of being crushed Danger due to rotating pick up There is a danger of being drawn in if you approach the danger zone and if you use your hands or feet to clear clogging e Before working on the pick up switch off the PTO shaft and the engine 29 Safety KRONE Com PO 0 s s e CPNO00007_5 Fig 2 30 C KRONE Safety 5 Order No 939 125 1 3x H 100 mm Danger from sharp blades There is a risk of cuts when reaching into the danger zone of the blades e Wear
223. orward without bale Transfer complete Bale chamber is closed Swivel table moving to centre position Swivel table moving to centre position Lifter moving forward Bale chamber is closed not defined 121 KRONE ISOBUS Terminal 8 5 8 5 1 122 Menu level Short overview Is KRONE Submenu Submenu Designation Settings Baler setting Bale diameter Comprima CF155 XC only Number of net wrappings Sensitivity of direction display Comprima CF155 XC only Advance signalling Filling correction Tying start delay KRONE KRONE ISOBUS Terminal X gt Settings Wrapper setting Number of layers Number of film wrappings Type of operation for wrapper Type of operation for swivel table Film width Film tear control ai e j e Customer counter nOO i otal counter gt all O O 3 123 KRONE ISOBUS Terminal KRONE 124 CO men submenu _ submenu em Manual sensor test Manual actuator test Diagnostics Manual operation without safety prompt ISOBUS Virtual terminal VT Select day night display lighting Softkeys ISO terminal Switch to different terminal ISOBUS diagnostics Auxiliary function AUX diagnostics ISOBUS b KRONE KRONE ISOBUS Terminal mm ESC 8 5 2 Calling up the menu level x H CC000254 Fig 87 By pressing the function key d in the main window yo
224. place the bracket on the bolt 3 and secure with the linch pin 3 e mount the spring 11 Moving the baffle plate 1 from position II to position On the left and right side of the machine Toremove the bracket 2 remove the linch pin 3 e unscrew the round head bolt 4 remove the spring 11 e detach the bracket e Remove the linch pin 5 e Move the baffle plate 1 to the lower bore and secure with the linch pin 5 e To fit the bracket e insert the round head bolt 4 into the rear square hole 10 and secure with a spacer tube 7 washer 8 and locknut 9 place the bracket on the bolt 3 and secure with the linch pin 3 e mount the spring 11 226 b KRONE 11 11 11 11 1 Operation Cutting system Shut down and safeguard the machine see chapter Safety gt Safety routines Shutting down and safeguarding the machine General Aspects The machine has a cutting system with a cutting cylinder and fixed blades Cutting allows for improved further processing of the round bales and makes it possible to increase the density of baled material The blades can be swivelled out of the conveyor channel from the tractor hydraulically if there are blockages The cutter safety mechanism prevents the cutters from being damaged by foreign objects lt is also possible to switch off the cutting system mechanically 22 Operation KRONE 11 11 2 Cutting length Fig 166 The cutti
225. prima CV 210 XC Fig 178 After an extended standstill time prior to start up of the machine only if the baling pressure has dropped below 50 bar HDC00087 Fig 179 e Hook hand lever 4 into the bore hole 5 and hook 6 into the oblong hole of the slip on gear 2 The hand lever can be readjusted in the oblong hole 7 of the hook 6 if necessary e Push the slip on gear 2 into position a by using hand lever 4 and secure with cotter pin 1 e Remove auxiliary device and put it down in the twine box Note A pressure range of 50 180 bar is preset for the baling pressure setting Pressure range bar medium high 238 C KRONE Operation 11 14 Net Wrapping 11 14 1 Net wrapping parts RPN00007_6 Fig 180 1 Blade bar 9 Retaining clip 2 Feed roller 10 Synthetic cloth 3 Net compensation 11 Net 4 Retaining plate 12 Spreading bracket 5 Net brake 13 Spreading roller 6 Net brake spring 14 Plastic guide 7 Net rocker arm 15 Fixed cross tube 8 Deflection shaft 11 14 2 Function of the Net Tying The rocker arm 7 is used to lay the net onto the feed roller 2 and from this roller it is passed through the compression rollers to the bale Then it is trailed by the bale After the wrapping process is complete the blade bar 1 is swung and cuts the net 239 b Operation KRONE 11 15 Inserting Net Roll CAUTION Contamination of the tw
226. pter Safety Securely supporting the raised machine and machine parts Starting the machine safely WARNING Risk of injury when starting up the machine If the machine has not been safely placed in operation the machine or machine parts may move unintentionally As a result people may be seriously injured or killed e Before starting up the machine ensure that the following prerequisites are met The hydraulic lines are connected The compressed air brake is coupled depending on equipment The hydraulic brake is connected depending on equipment The universal shaft is coupled and secured The lighting system is connected The terminal is connected The safety chain is attached not stipulated in all countries All safety equipment is in place is proper condition and in the protective position The PTO speed of 540 rpm is not exceeded The universal shaft prescribed by the manufacturer is used The hoses cables and ropes are laid so that they do not scrape come under tension or become jammed or come in contact with other parts such as the tractor tyres The parking brake is released Machine parts of the tractor do not come into contact with parts of the machine especially when turning There are no persons in the machine danger zone 27 b Safety KRONE 4 5 Position of the Adhesive Safety Stickers on the Machine WARNING A Danger of inju
227. quired for Questions and Orders 52 Insert Net 241 Insert Sheet 257 Inserting Net Roll 240 356 Install the PTO shaft 77 Installing the terminal into the cabin 103 Intended use 13 DOBU eee een eee eee eee eee ee 180 ISOBUS Diagnostics 186 ISOBUS operation 197 ISOBUS Short Cut Button 104 ISOBUS Terminal 102 K Keeping safety devices functional 19 KRONE ISOBUS Terminal 204 L Lifting the Pick up 96 LUDA GINS uu uu 122 s 330 Lubricating the PTO shalft 330 L Dri cation ele E 333 M Viel 296 Maintenance 275 Maintenance Brake System 325 Maintenance lubrication 329 Maintenance table 276 Maintenance work before the beginning of the new season 339 Malfunctions Causes and Remedies
228. r killed e To avoid accidents the basic safety instructions in the chapter Safety must have been read and followed see chapter Safety Basic safety instructions WARNING If the safety routines are not adhered to people may be seriously injured or killed e To avoid accidents the safety routines in the chapter Safety must be read and followed see chapter Safety Safety routines b KRONE 6 1 Start up Mounting onto the Tractor Warning There is a risk of injury when you hitch the machine to the tractor When you hitch the machine to the tractor there is an increased risk of injury For this reason the following points must be observed The failure to observe these instructions may result in persons being seriously injured or killed e Apply the parking brake on the machine Secure the machine with wheel chocks to prevent it from rolling away e During the hitching procedure never stand between the tractor and the machine Switch off the tractor hydraulic and pneumatic system Switch off all electronic systems e Turn off the diesel engine remove the ignition key and take it with you The machine comes standard equipped with a hitch of 40 mm DIN 11 026 Depending on the specific requirement the following hitches are also available e PBallheaq hitch K 80 e Rotating hitch export only e Hitch connection export only Hitch and secure the machine according to regulations on the hit
229. r Conveyor Drive EE 304 Drive Chain Tension Roller Drive 308 Driving ANd Transport 95 E Electrical circuit diagram 354 Electrical connections 80 Electromagnetic Valves 323 Error Messages of KRONE Operation Terminal EE 346 Example of joystick assignment for Fendt default SoN uuu 201 F Filling Correction 132 Filling Quantities and Lubrication Designations for ET ae 295 Filling the bale chamber 213 Function Bale Wrapper 255 G General malfunctions 342 General Messages 196 H Hitches on the Drawbalr 294 How to use this document 11 Hydraulic brake Export 76 Hydraulic System Circuit Diagrams 208 348 Hydraulic Tank 315 Hydraulics 72 311 Identification Plate 52 Identifying Symbols in the Operating Instructions EEN 12 Importance of the operating instructions 14 BT OPIN el BE 179 Information Re
230. r back S4 Y06 Control valve wrapping arm S1 Y014 Sheet tear S12 YO7 Close bale chamber S2 Y015 Release holding arms S13 Y08 Open bale chamber S3 YO16 Open holding arms S8 Y10 Swivel table forward S7 Y017 Close holding arms S9 YO11 Swivel table back S6 314 b KRONE Maintenance 13 18 3 Hydraulic Tank ENVIRONMENT Disposal and storage of used lubricants and oil filters Effect Environmental damage Store or dispose used oil and oil filters according to statutory provisions Note Check the hydraulic oil level when the hydraulic oil is warm When checking the oil level the tailgate must be closed and the bale lifting device must be located in the lower position Filling quantity and oil designation CF155 XC Designation Brand degradable cvisoxc CV210 XC lubricants Hydraulic HLP ISO VG 46 initial anl equipment HVLP ISO VG 32 46 on request HEES 46 bio degradable very quickly Note The types of oil must not be mixed When changing observe the VDMA guidelines 315 S EE Maintenance KRONE 316 Comprima CF 155 XC Comprima CV 150 XC Ts A roi D n dc Wm i D M OH r Wi 64 r Li F P Ki Ze 8 7 d M e NO Filer neck 1 Inspection glass 3 Locking screw To check the oil level Prerequisite The tailgate must be closed e Read the oil level on the inspection glass If the inspection glass shows a level of 3 4 or more the
231. r to life e Make sure that there is no one in the swivel range of the machine e Keep distance to moving machine parts Danger from rotating machine parts Rotating machine parts in the range of movement of the wrapping device represent a risk of injury e Actuate quick stop button in order to interrupt all wrapping device functions 33 Safety KRONE Com PO 0 s s e CPNO00007_5 Fig 4 34 b KRONE Safety 13 Order No 942 271 0 2x Danger from rotating machine parts When getting on the machine while the PTO shaft is running there is a danger of being pulled in due to rotating machine parts Switch off PTO shaft and engine before getting on the machine 14 Order No 27 007 502 0 2x H 70mm Danger from sharp blades There is a risk of cuts when reaching into the danger zone of the blades e Wear cut resistant gloves 35 Safety Comprima CV 210 XC gring evi COM00340_1 Fig 5 COM00342_1 Fig 6 36 b KRONE Safety 1 Order no 939 471 1 1x Danger due to incorrect operation and lack of knowledge Incorrect operation and lack of knowledge of the machine as well as incorrect behaviour in hazardous situations is risking the life of the operator and third parties e Before starting up the machine read and follow the operating instructions and safety instructions
232. rating instructions for the machine The operating instructions for the universal shaft 17 Safety b KRONE Danger zone between tractor and machine People standing between the tractor and machine may be seriously injured or killed if the tractor rolls away or by machine movements e Before starting all work between the tractor and machine Shut down and safeguard the machine see chapter Safety Shutting down and safeguarding the machine This also applies to brief inspection work Many serious accidents occur due to negligence and running machines e If the power lifter has to be actuated keep all people away from the area of movement of the power lifter Danger zone when drive switched on When the drive is switched on there is a danger to life from rotating and swivelling machine parts There must be nobody in the danger zone of the machine e Before starting the machine direct all people out of the danger zone of the machine e ifa hazardous situation arises switch off drives and diesel engine immediately Danger zone of the P T O shaft People may be caught pulled in and seriously injured by the PTO shaft and the driven components Before engaging the PTO shaft e Make sure that all safety devices are fitted and in the protection position e Ensure that the selected speed and direction of rotation of the PTO shaft match the permitted speed and direction of rotation of the machine e Ensure that
233. remove the ignition key e Assemble the PTO shaft bracket 1 and secure the PTO shaft support 2 SSH N KR201144 Fig 36 e Push on universal shaft 1 with overload protection on machine side until the safety mechanism engages or the universal shaft can be screwed see the operating instructions provided by the PTO shaft manufacturer e Hook in the retaining chains of the universal shaft guard on machine side 67 Commissioning KRONE COM00321 Fig 37 Note To achieve greater PTO shaft freedom the towing ring can be mounted in position 1 or 2 on the drawbar 3 e Use a suitable tool to loosen the screw connection 4 e Rotate the towing ring to the desired position and use the screw connection 4 to mount it on the drawbar 3 CHE Sai CG e Place the PTO shaft 1 inside the PTO shaft support 2 KR200084 68 b KRONE 5 5 Commissioning Hose holder assembly RBV01080 Fig 39 e The hose holder 1 is mounted on the drawbar with the fastening materials 2 Fig 40 e Guide the hose holder 5 through the oblong holes on the drawbar 6 e Fasten the hose holder onto the drawbar with clamps 4 screws 1 washers 2 and self locking nuts 3 e Guide the hoses 7 through the eye of the hose holder 5 69 70 Start up A KRONE Start up WARNING If the basic safety instructions are not followed people may be seriously injured o
234. rey Press function key OK The display shows menu 1 2 Baler setting The symbol Rm the upper line indicates that the displayed status is saved Menu 1 2 Baler setting is divided into seven menus depending on how the machine is equipped oDi Menu 1 2 2 Bale diameter Comprima CF 155 XC n Menu 1 2 3 Number net winds aa Menu 1 2 4 Sensitivity of direction display Comprima CF 155 XC lh to Menu 1 2 5 Pre signalling CH Menu 1 2 9 Filling correction N D x Menu 1 2 9 Tying start deceleration 127 KRONE ISOBUS Terminal KRONE 8 7 1 Menu 1 2 2 Bale diameter Only for Comprima CF155XC CC000237 CC000256 Fig 90 Displaying the menu Menu 1 2 Baler setting is called e Select menu 1 2 2 UI by pressing function key Tt or A the symbol is highlighted in grey Press function key OK The display shows menu 1 2 2 Bale diameter The symbol UE in the upper line indicates that the displayed status is saved Setting the bale diameter e You can use function key Fo to adjust the bale diameter mechanically set on the T machine The symbol Uin the top line disappears er e Press the function key OK The bale diameter set is saved and the symbol appears in the upper line e Pressing the function key ESC closes the called up menu e Pressing the function key ESC and holding it down brings up the basic screen 128 b KRONE 8 7 2 KRONE I
235. ricks Hollow blocks or bricks may break under continuous load e Never work under the machine or machine parts which are held up by a car jack 25 Safety 4 4 3 4 4 4 26 b KRONE Coupling the machine safely WARNING Risk of injury when coupling the machine The machine or machine parts may move unintentionally while the machine is coupled to the tractor AS a result people may be seriously injured or killed When coupling the machine perform the following steps Never stand between the tractor and the machine while coupling the machine to the tractor Depressurise the tractor hydraulics Switch off the electronic systems Shut down and safeguard the machine see chapter Safety Shutting down and safeguarding the machine Only couple the hydraulic hoses if the hydraulic systems on the tractor and the machine are depressurised Couple the compressed air braking system depending on the version of the machine Couple the hydraulic brake depending on the version of the machine Couple and secure the universal shaft Connect the lighting cable Connect the power cable Connect the terminal Uncoupling the machine safely WARNING Risk of injury when uncoupling the machine The machine or machine parts may move unintentionally while the machine is being uncoupled As a result people may be seriously injured or killed When uncoupling the machine perform the following steps Shut down and safegu
236. round baler is built exclusively for customary use in agricultural work intended use Unauthorised modifications to the machine may have a negative effect on the machine characteristics or safe and reliable use of the machine or may interfere with proper operation Unauthorised modifications shall therefore release the manufacturer of any liability for consequential damage 13 Safety 4 3 4 3 1 4 3 2 14 b KRONE Basic safety instructions Non compliance with the safety instructions and warnings Non compliance with the safety instructions and warnings may result in injuries and damage to the environment and property Importance of the operating instructions The operating instructions are an important document and a part of the machine They are intended for the user and contain information relevant to safety Only the procedures indicated in the operating instructions are reliable If the operating instructions are not followed people may be seriously injured or killed e Before using the machine for the first time read and follow all the Basic safety instructions in the chapter Safety e Before working also read and observe the respective sections in the operating instructions e Retain the operating instructions and ensure that they are always available e Hand over the operating instructions to subsequent users Personnel qualification If the machine is not used properly people may be seriously injur
237. rtntttrttrsrtnttttrerttntttrttontan ttrt rerentnnntEeeeenn nnn 134 8 8 1 Menu 1 3 1 Number of layers u LLULLU uuu asa EEEE EES 135 8 8 2 Menu 1 3 2 Number slide wrappmgs a a aaa aa r 136 8 8 3 Menu 1 3 3 Type of operation wrapper 137 8 8 4 Menu 1 3 4 Type of operation swivel table 138 8 8 5 Menu 1 3 5 Sheet width 139 8 8 6 Menu 1 3 6 Torn sheet Control 140 8 9 Main men 2 CounierS u ULU eieede eege deeg 142 8 9 1 Menu 2 1 Customer counter aa aaa aaa arrssssrrsssssssrssss asa 143 8 9 2 Menu 2 2 Total bale counter aa aaassarrrsss sa 145 8 10 Main menu 3 Manual operation a 146 8 10 1 Menu 3 1 Manual operation Daler a a 147 65102 Slalus MESSAGES orcarina a n oani ai aroia aaa Sraa seats a aiiai 148 b KRONE Table of Contents 8 10 3 Move manually to tying position 150 8 10 4 Activating the wrapping table manually only for Comprima CV150XC 150 8 10 5 Drive lifter manually uoward downward Comprima CF155XC CV210XC 151 8 10 6 Opening closing the bale chamber 151 8 10 7 Move swivel table Dy hand 152 8 11
238. ry on machine parts if danger zones have not been marked when warning pictograms are missing damaged or illegible Danger of injury due to dangerous parts and other residual risks as users or third parties enter the danger area or reach into it as they are not aware of the danger e Immediately replace damaged or illegible labels e Following repair work always attach appropriate adhesive safety labels to all the replaced modified or repaired components e Never clean areas carrying an adhesive safety label using a high pressure cleaner Familiarise yourself with the statement of the warning pictograms The adjacent text and the selected location on the machine provide information on the special danger spots on the machine 4 6 Introduction The KRONE round baler is equipped with all safety devices protective devices However it is not possible to eliminate all potential hazards on this machine as this would impair its full functional capability Hazard warnings are attached to the machine in the relevant areas to warn against any dangers The safety instructions are provided in the form of so called warning pictograms Important information on the position of these safety signs and what they mean is given below Comprima CF 155 XC Comprima CV 150 XC d Comprima CF 155 XC CPN00006_4 Fig 1 28 b KRONE Safety 1 Order no 939 471 1 1x Danger due to incorrect operation and lack of knowledge Incorrect
239. s Wipe away grease that comes out of lubrication points e Check the oil level in the main drive gearbox and top up if necessary e Check hydraulic hoses and lines for leaks and replace them if necessary e Check all screws to make certain they are tight or retighten them if necessary e Check all electrical connection cables and the lighting Repair or replace if necessary e Check the entire setting of the machine and correct if necessary e Check the operating functions e HRe read the operating instructions thoroughly h KRONE Placing in Storage 15 2 1 Maintenance work before the beginning of the new season CP103360 Fig 265 e Clean the rust off the brake disc 2 on the running surface 1 Fig 266 Remove the grill on the spreading bracket 1 for net tying 339 Placing in Storage KRONE 15 2 2 340 Venting the overload coupling on the PTO shaft Friction clutch only CQM00337 Fig 267 Following extended downtimes overload coupling surfaces 2 may stick to the contact surfaces Vent the overload coupling before use e Loosen the eight screws 1 to release the spring pressure from the outside washers 3 4 e Turn the PTO shaft manually e Tighten the screws until the covering ring 2 is lying directly against the outside washers 3 4 Note Do not tighten the screws 1 too tight The coupling must still be able to slip e Then turn the screws 1 one sixth of a revolution ba
240. s AZ punoi6 ONG N CL EN A ddns AZ punos6 ON To m EN Aiddns AZ punos6 ONG gt m 87 EN Ajddns TNALAZL _ lt _ _ LL LO CV EN Addns TNALAZL v N vl EN A ddns T NALAZL lt es Ajddns lt O CH LLI WO us uol eoo yuejd q dey p A01d L Jajeq siosu s KO X OSL AO 9X SSL AD ved G6G9E00LOGL OU JU uInoop WuDu Hunlinjege 019 49 Dune 69 gq e OWN amnpow gq e OW amnpow L OYSHVNV O I Z OYSHVNV O I O LX uolo uuoo CC LN uomo uuoo I CM U CM oe ee S S q0LgX 06qx J UD dl 9l Buninjoge Bunyinjege n AGGL nvgo 14 N AGGL NWEO1S 0Lg 70 D I ci d ci d K Noy kal ND TH qorgx bagax 14 019 SM 014 LEXI OLE CeILX OLE cV Cla cV Cla 14 69 Sm 69 velLX 68 SE LXL 68 cV Cla cV Cla s i qlv Joen DOUD GU aep paea JOJOW uosod ZO OW ainpow OYSJHVNV O I ZZ ZX uono uuoo JOJOWZIJSN Y JOE OINM empou t YLSNMdgH O I L 2x uol o uuoo l CM IT qzx z S m d gt O O m gt O N S m z q INX T Z JO JOW 3U WW LA L e q NX CO H gt O cO CO H gt O e c Zb qzx T V Z
241. s reached fi e Softkey gt Saves the swivel table back as long as the softkey is activated or until the rear end position is reached 0 e Press softkey Se and hold it down until swivel table has reached the zero position e Pressing the function key ESCcloses the called up menu e Pressing the function key ESCand holding it down brings up the basic screen Possible status messages window 1 wrapping arms swivel table see chapter Status messages Menu 3 2 Manual operation wrapper eles CC000286 Fig 114 Calling the menu Menu 3 1 Manual operation wrapper is called e Activate the key ee change to menu 3 2 Manual operation wrapper Bes Show in the display 1 Display wrapping arm 2 Display net motor 3 Bale chamber and lifter display 4 Holding arms display Possible status messages window 3 bale chamber see chapter Status messages C KRONE KRONE ISOBUS Terminal 8 11 1 Opening closing the holding arms e Softkey E opens the holding arms as long as the softkey is pressed or until the opened end position is reached e Softkey lt closes the holding arms as long as the softkey is pressed or until the closed end position is reached 4 e Softkey 0 releases the holding arms Possible status messages window 4 holding arms see Section Status messages e Pressing the ESC function button closes the open menu e Pressing and holding the ESC function button opens the h
242. s step by step It contains extensive notes and information about maintenance how to use the machine safely secure working methods special precautionary measures and available accessories This information and these instructions are essential important and useful for the operational safety reliability and durability of the round baler Note In the operating instructions which follow the round baler will also be referred to as the machine Please note The operating instructions are part of your machine Only operate this machine after you have been trained to do so and according to these instructions lt is essential to observe the safety instructions It is also necessary to observe the relevant accident prevention regulations and other generally recognised regulations concerning safety occupational health and road traffic All information illustrations and technical data in these operating instructions correspond to the latest state at the time of publication We reserve the right to make design changes at any time and without notification of reasons Should you for any reason not be able to use these operating instructions either wholly or partially you can receive a replacement set of operating instructions for your machine by quoting the number supplied overleaf We hope that you will be satisfied with your KRONE machine Maschinenfabrik Bernard Krone GmbH Spelle 2 N Table of Contents KRONE Table of Conten
243. sed air hose couplings 1 into the correspondingly coloured couplings on the tractor Note Always connect the yellow coupling head first then the red one Detach the couplings in reverse order 19 Start up 6 6 80 b KRONE Electrical connections Shut down and safeguard the machine see chapter Safety gt Safety routines Shutting down and safeguarding the machine KR 1 044 Fig 46 Connect the connection cable 2 for the lighting to the 7 pin plug in connector of the tractor electrical system e Position the connection cable 2 so that it will not come in contact with the wheels e Install the control console so that it is easily visible to the driver e Connect the power supply cable according to DIN 9680 to the 3 pin power supply socket Note Request the 3 pin power supply socket with connection cable from the spare parts service Spare parts no 0303 914 0 if the connection is not available on the tractor Note Extension cables for the terminal can be ordered under the following spare part numbers e 3031740 2500 mm length e 3029590 5000 mm length Start up 6 6 1 Connecting the terminal on tractors without ISOBUS system Ee Xx Fig 47 Connection terminal to machine Note The connection of terminal to machine takes place via a provided cable set 5 article no 20 081 224 0 Connect plug 2 of cable set 5 with socket 1 CAN1 IN of the terminal
244. ssages window 2 net motor see chapter Status messages Activating the wrapping table manually only for Comprima CV150XC CC000282 1 Fig 111 e Using the softkeyO O will make the wrapping table convey rearward for as long as the softkey is activated 1 e Using the softkey will make the wrapping table convey rearward for as long as the softkey is activated b KRONE 8 10 5 8 10 6 KRONE ISOBUS Terminal Drive lifter manually upward downward Comprima CF155XC CV210XC Fig 112 Use the softkey to move the lifter rearward as long as the softkey is activated or the top end position has been reached e Use the softkey ff N to move the lifter forward as long as the softkey is activated or until the bottom end position is reached Possible status messages window 3 bale chamber see chapter Status messages Opening closing the bale chamber CC000282 1 t e Softkey Se opens the bale chamber as long as the softkey is pressed or until the opened end position is reached e Softkey YO doses the bale chamber as long as the softkey is pressed or until the closed end position is reached Possible status messages window 4 bale chamber see Section Status messages 151 KRONE ISOBUS Terminal KRONE 8 10 7 8 11 152 cy Move swivel table by hand seme moves the swivel table forward as long as the softkey is activated or until the forward end position i
245. sult a doctor immediately The liquid must be removed from the body as quickly as possible Danger of infection Physicians who are not familiar with this area must consult appropriate information from a competent medical source e Check hydraulic hoses regularly and replace if there are any signs of damage or ageing The replacement lines must comply with the requirements of the device manufacturer e Ensure that all line connections are tight before the pressure in the system builds up again WARNING Hydraulic hose lines are subject to ageing Effect Danger to life or serious injuries The characteristics of the lines change depending on pressure heat load and the effect of UV rays The date of manufacture appears on the hydraulic hoses This way the age can be ascertained quickly By law the hydraulic lines must be replaced after six years Use original spare parts when replacing hydraulic hoses Note e When working on the hydraulic system absolute cleanliness is essential e Check the hydraulic oil level each time before placing the machine in operation Observe the intervals for replacing the hydraulic oil and hydraulic oil filter The used oil must be disposed of correctly 311 S EE Maintenance KRONE 13 18 1 Shut off valve for tailgate CPK00230_3 Fig 246 Pressure is supplied to the machine hydraulics through hoses from the tractor Along with various parts the shut off valve 1 on the left hydraulic
246. the Start of the New Season 338 Behaviour in hazardous situations and when accidents OCCUM eisereen eet eg 24 Blockage Due to Jammed Crop 249 Index C Calling up the menu level anaannnnnnnn00annnnnnnnaaan 125 Cam type clutch engaging 85 Central chain lubrication system 271 Changing the Drawbar Height and Adjusting the lil luu aa unu Sua u SS 62 Changing the filter on the hydraulic tank 318 Check parking support 97 Checking and maintaining tyres 292 Checking the lighting system 97 Checking the Safety Rollers of Single Blade LOCKING Device 300 Checks and maintenance on rear floor conveyor eet 301 Children in danger 15 COMMIS SION G WEE 56 Components Bale Wrapper 252 Compressed Air Connections for the Compressed Ai Bi uum E E SE 79 CompressSed air reservoir 328 Connect the machine to the tractor 15 Connecting the hydraulic lines 73 Connecting the Multi Function Lever 106 Connecting the Multi Function Lever to the CCI MEGANE a2 aed TE E 107 Connecting the Terminal with ISOBUS 82 Connecting the terminal without ISOBUG
247. the bale turner Note Follow the same steps in reverse order to remove the bale turner b KRONE gt P P bP Driving and Transport Driving and Transport WARNING If the basic safety instructions are not followed people may be seriously injured or killed e To avoid accidents the basic safety instructions in the chapter Safety must have been read and followed see chapter Safety Basic safety instructions WARNING If the safety routines are not adhered to people may be seriously injured or killed e To avoid accidents the safety routines in the chapter Safety must be read and followed see chapter Safety Safety routines WARNING There is a risk of accidents if the control valves on the tractor are not locked If the control valves are not locked machine components may be activated unintentionally This can result in serious accidents e To prevent functions being triggered accidentally the control valves on the tractor must be switched to neutral and locked during road transport journeys WARNING Danger when cornering with a machine hitched When cornering the hitched machine swings out further than the tractor This can lead to accidents e Take the greater swivel range into account e When turning take account of people oncoming traffic and obstacles 95 h KRONE Driving and Transport 7 1 Preparations for road travel The following tasks must be performed on the machine and tractor
248. the called up menu e Pressing the function key longerESCand holding it down brings up the basic screen in the upper 131 KRONE ISOBUS Terminal 8 7 5 132 Menu 1 2 6 Filling Correction Fig 94 Note If the bale size is not reached or if it is too high the bale can be corrected in a predefined range via menu 1 2 6 Filling Correction The values can be corrected in the following ranges Comprima CV150 XC CV210 XC Bale size 10cm to 10 cm Calling the menu Main menu 1 2 Setting Baler is called Example for the correction of bale diameter The set target diameter is 108 cm If the actual bale diameter is only 100 cm the set target diameter is 108 cm a correction value of 8cm must be set This means Correction value bale diameter target diameter Select menu 1 2 6 Di by pressing function key T or the symbol is highlighted in grey e Increase or reduce the desired value via function key ar or the symbol in the upper line disappears Press function key OK The display shows menu 1 2 6 Filling Correction E The symbol A in the upper line indicates that the displayed value is saved e Pressing function key ESC closes the called up menu e The basic screen is called by pressing function key ESC longer O KRONE KRONE ISOBUS Terminal 8 7 6 Menu 1 2 9 Tying start delay 1 2 9 ESC CC000268 CC000269 Fig 95 Displaying the menu Main menu 1 2 Baler se
249. the machine How to use this document Table of contents headers The table of contents as well as the headers in these instructions are used for quick navigation in the chapters Index You can use the index to find specific information on the required subject via keywords which are in alphabetical order The index is on the last page of these instructions Cross references Cross references to another place in the operating instructions or to another document are in the text and specify the chapter and subchapter or section The name of the subchapter or section is in quotation marks Example Check that all screws on the machine are tight see chapter Maintenance Tightening torques for hexagonal head screws The subchapter or the section can be found via an entry in the table of contents and in the index Directional information in these operating instructions such as front rear right and left applies in the direction of travel of the machine Orientation information concerning a diagram of a machine detail refers to the diagram itself and is not relative to the direction of travel 11 C To this Document KRONE 3 4 Identifying Symbols in the Operating Instructions 3 5 The safety instructions contained in this manual which could result in personal injury if not followed are identified by the general danger sign Identification of the hazard warnings Danger DANGER Type and source of the hazard
250. the machine has not been shut down the machine or machine parts may move unintentionally As a result people may be seriously injured or killed e Before leaving the machine Shut down and secure the machine To park the machine securely e Park the machine on a stable and even surface e Switch off the drives and wait until coasting parts have come to a standstill e Switch off the tractor engine remove the ignition key and take it with you Use the parking brakes to secure the machine and tractor from rolling away Supporting lifted machine and machine parts securely WARNING Risk of injury due to movement of the machine or machine parts If the machine is not supported securely the machine or machine parts may roll fall or drop As a result people may be seriously injured or killed Before working on or under raised components Securely support machine or machine parts To securely support the machine or machine parts Shut down and safeguard the machine see chapter Safety Shutting down and safeguarding the machine e Before performing any work on or under raised machine parts lower the machine parts or secure them mechanically with rigid safety supports e g Support stand crane or with a hydraulic shut off device e g stop cock to prevent them from dropping e Never support the machine or machine parts with materials which can buckle e Never support the machine or machine parts with hollow blocks or b
251. ts L OI ON ww tee tee ee a eee 3 TIDE ol e E 4 bebe en UL uuu uuu ua ua na 11 SN Elte E 11 3 2 Target group Of this document 11 3 3 How to use this document 11 3 4 Identifying Symbols in the Operating JInstruchons aa a 12 3 5 Identification of the hazard warmimge 12 Odi Vu AE ie ened dere enw tanuen AA E O E E EA A O E O 13 4 1 Bil siet 13 4 2 Ta 2 eE e EE 13 4 3 Se E lg et La uuu l uuu u us E 14 4 3 1 Importance of the Operating msiruchons a a 14 4 3 2 Personnel Oe INC AMOI u uuu u uuu uuu uu 2 u iee a Aada akata qausq kaa sqatasan 14 4 3 3 Children in danger a rrrsssssssssssasa 15 4 3 4 Connect the machine to the tractor a aaa aaaassssass sssa 15 4 3 5 Structural changes to the machine a aa aaaaaa 15 4 3 6 Additional equipment and spare parts r 15 4 3 7 Workstations ANd poassengderg 15 4 3 8 Operational safety Technically perfect condition 16 4 3 9 ANG OF ZOMG E E E E E E A E E E E sss sss 17 4 3 10 Keeping safety devices Tunchonal a a aa r 19 4 3 11 Personal protective equipment EEN 19 4 3 12 Safety signs on the Machine r aa aaaasssrrrrrsssssss 20 ON NANG ay as asas pamusssatawapasakpasyastanaaquspausnhuskonoysusqaq hawtuspuqwamassanskssnaphasaunsusqutis 20 4 3 14 Parking the machine safely a 21 4 NK 7 OH a 21 4 3 16 Dangers assoc
252. tting is called N e You can select menu 1 2 9 CO l by pressing function key T or The symbol is highlighted in grey Press function key OK The display shows menu 1 2 9 Tying start delay Setting the tying start delay The time delay is shown in seconds Note Tying start delay indicates how much time there is between Pressure bale diameter reached and Triggering the tying process in automatic mode Set the desired time delay with the function key or the symbol r goes out Press function key OK in the top line The symbol AU in the upper line indicates that the displayed value is saved e Pressing the function key ESC closes the called up menu e Pressing the function key longer ESC and holding it down brings up the basic screen 133 KRONE ISOBUS Terminal KRONE OK 8 8 134 Menu 1 3 Adjustment wrapper x ESC CC000270 Fig 96 Displaying the menu Main menu 1 Settings is displayed oy e by pressing function key Por A The symbol is Youcan select menu 1 3 highlighted in grey Press function key OK The display shows menu 1 3 Wrapper setting The symbol WAU in the upper line indicates that the displayed status is saved Menu 1 3 Baler setting is divided into six menus depending on how the machine is equipped ain na Menu 1 3 1 Number of layers 5 tN Menu1 3 2 Number of winds SH Menu 1 3 3 Type of oper
253. tual bale diameter in cm The value above the bar display shows the adjusted target bale diameter in cm The bale diameter is given by the user in basic screen You can use the scroll wheel to select the desired value the selection box is highlighted in colour e Pressing the scroll wheel allows you to jump to the selection box the selection box is highlighted in colour e Turning the scroll wheel increases or reduces the value e Pressing the scroll wheel causes the setting to be applied and returns you from the selection box Adjusting the Target Bale Diameter Display for Comprima CV 210 XC Note If the wrapper is deactivated the bale size is shown in an area of 90 cm to 205 cm It can be set in this area Note If the wrapper is activated the bale size is displayed in an area of 90 cm to 175 cm It can be set in this area 119 KRONE ISOBUS Terminal KRONE 8 4 120 CO Messages Information message The information message will appear only if the main operation display has been set The message will disappear automatically when the cause for the information message has been removed Message bale chamber has not been closed CC000285 The softkeys in the lower line continue to be active whilst the information message is displayed b KRONE KRONE ISOBUS Terminal The following information messages are possible Bale chamber opens Bale chamber open Lifter forward without bale Swivel table f
254. ty equipment of the machine Missing safety stickers increase the risk of serious and fatal injuries e Clean dirty safety stickers e After cleaning always check that safety stickers are complete and legible Immediately replace missing damaged and unrecognisable safety stickers e Provide spare parts with the designated safety stickers Description explanation and order numbers of the safety stickers see chapter Safety Safety stickers on the machine Traffic safety Dangers when driving on roads and in fields The attached or coupled work machine changes the handling characteristics of the tractor The handling characteristics are also dependent on the operational state the filling or loading and on the ground condition If the driver does not consider changed handling characteristics he may cause accidents Observe procedures for driving on roads and in fields see chapter Driving and transportation Prepare the machine for road travel If the machine is not prepared properly for road travel serious accidents may occur with traffic e Before travelling on the road always prepare the machine for road travel see chapter Driving and transportation Preparations for road travel Danger of overturning The machine may overturn when driving on slopes As a result accidents may occur and people may be seriously injured or killed The risk of overturning depends on many factors Observe procedures for driving see
255. u get into the menu level of the machine The menu level is shown in the display The menu level is divided into 7 main menus main menu 1 Settings main menu 2 Counters main menu 3 Manual operation main menu 4 Service main menu 5 Info main menu 6 Fitter main menu 7 ISOBUS Select the desired main menu by pressing the function key For T The selected symbol is highlighted in grey e Pressing the function key OK brings up the menu level of the main menu that is selected e Pressing the function key ESC closes the called up menu e Pressing the function key ESC and holding it down brings up the basic screen 125 KRONE ISOBUS Terminal KRONE 8 6 126 Main menu 1 Settings Ee E CC000254 e By pressing the function key d in the basic screen you get into the menu level of the machine e You can select the main menu 1 A by pressing the function key t Lb The symbol is highlighted in grey Press function key OK The display shows menu level 1 Settings Menu level 1 Settings is divided into up to 5 menus depending on how the machine is equipped Menu 1 3 Wrapper setting Menu 1 2 Baler setting b KRONE 8 7 KRONE ISOBUS Terminal Menu 1 2 Adjustment baler D x 8 ESC OK CC000255 Fig 89 Displaying the menu Main menu 1 Settings is displayed I Select menu 1 2 ay by pressing function key Laf the symbol is highlighted in g
256. ue is saved e Use softkey DEF to reset the operating mode to the factory setting e Pressing the function key ESC closes the called up menu e Pressing the function key longer ESC and holding it down brings up the basic screen 137 KRONE ISOBUS Terminal KRONE 8 8 4 138 Menu 1 3 4 Type of operation swivel table CC000763 Fig 100 Displaying the menu Menu 1 3 Wrapper setting is calle oT e You can select menu 1 3 4 d by pressing function key T or CH The symbol is highlighted in grey Press function key OK The display shows menu 1 3 4 Type of operation swivel table The current status is displayed as an icon fO u Manual mode re TE Selection automatic mode with wraps or Ro double depot without wrappings Change and save status L e Set the desired number of layers via function key ar or he symbol in the upper line goes out e Press function key OK The symbol f in the upper line indicates that the displayed value is saved e Use softkey DEF to reset the operating mode to the factory setting e Pressing the function key ESC closes the called up menu e Pressing the function key longer ESC and holding it down brings up the basic screen b KRONE 8 8 5 KRONE ISOBUS Terminal Menu 1 3 5 Sheet width CC000276 Fig 101 Displaying the menu Menu 1 3 Wrapper setting is called mm U e You can select menu 1 3 5 by pressing function key or A The symbol is
257. ues n GND og Ba eee Mosonyi CL ONADIG 6L ZX i Lelexl DCH SM L24 S 2 No S49 dn sequieyo ajeq r g 6 OHd9lQ Z ZX VV OI ag oZ 2x ZL 1osu s ED ZL ONG 91A 2 DCL bed SM v1 _ 8 _ 24 8 Uei wae Bunioddns zzg 8 DYADIC E ZX SV 9 ZI vg SM 229 Se Ge 6 an9 aa N Nig G IUDu uueller9 ezg S OYSHDIG JE ZX DV OI g om ve ZX g 1osu s ED 8 ONG od gt eil o z Sa POL ccd SM 24 2 S o G4 8 Bunuu x3 129 llo yzg v OYAHDIG SE ZX LY 8 toy ezg T lt 8 ZX S 1osu s Dn S ANS og e a e O SV 8 za T OC ZX y 1osu s jepp v ON OIG ol e sindul ai L siosu s e IBip Ajddns a lt a mM SM PLA Z3 0L q L ZX A ddns Az punos6 T ONSE Se LWICXL YLA E _ _ el o Zi EE EN Aiddns ACL puno6 1 ONS Ser gt EE zx Aiddns ACL punos6 T ONG e 3 01 7 30A X IZ ZX A ddns AZ punos6 TC ONS Be GL ZX Aiddns AZ punos6 GND m vl ZX Ajddns Az punos6 CNS GZ ZX Alod v Iddns T NAEAZL 8 2X PEYOUMS ACL MS TAZL O A ddns x EF LX Z IWYSL 6 LX TZ NYO LX TZ NYO LV 6 g pelq OZA dn 39 d LA L vii 9 LX m 8E LX H Z NYO ZV 6 y apelq LZA Juausnipe punosb A 8 VIWMd Z LX ZX H Z NYO V 6 L uon oun POA L YINMd Ov LX 93 NVO oe Z YLSNMdgH Zr LX ga L yx I TNI No T Cu f _ Cm 9 LX TL NVO L YLSNMdgH L LX SE lt l aa G S LN H L NVO Suerg H NYO s nd no L NVO a SE st
258. unctions Causes and Remedies KRONE 16 3 Malfunctions on the Wrapping Mechanism Malfunction Possible cause Remedy Sheet blisters Brake force is too low Check spring pretensioning on the wrapping arm Pre stretch too high Change pre stretch Wrapping process does not Signal wires on the swivel table Adjust signal wires start bent Sheet has been cut off to Blades has been set too Set blades less aggressive early aggressive Blade dull Grind blades Tailgate does not close Shut off valve closed Open the shut off valve Hydraulic oil gets too hot Filter blocked Replace the filter insert Oil quantity too low Check oil level Sheet tears Stretch rollers too rough Smooth stretch rollers with emery cloth Additional brake too tight Adjust brake 16 4 Error Messages of KRONE Operation Terminal The error messages in the display are described in the chapter KRONE ISOBUS Terminal 346 b KRONE 17 17 1 Disposal of the machine Disposal of the machine Disposal of the machine After the service life of the machine has expired the individual components of the machine must be disposed of properly The applicable country specific current waste disposal guidelines and the legal laws must be observed Metal parts All metal parts must be brought to a metal recycling centre The components must be freed from operating fluids and lubricants gear oil oil from hydraulic system before being scrapped The operatin
259. unos6 Tano airs amai a GL LX A ddns Az punos6 1 ONS eet SM GND lt vl LX IWMAL Alddns ACL IWYAL NAAZL w X 6Z LX A ddns Az punos6 ONS o lt GERD eo _ _ pee ene TE X ac LN Aiddns UE AZL Se L e BO L NS 6 LX yndu efeuon Parais AS SS Sr 89 x NI A ddns GER og Laut wee lt m O e LLI location job computer connector X3 D24 CF 155 XC CV 150 XC 03 150100369 jd D E 5 z O OKRONE 2 09 2009 lt O CH LLI v VINMd S X VINMd Z vX L EN siosues ojeue GND L YNY ONS 02 EN siosues ojeue GND Z YNY ONS ZVIWMd E Fw 6l xX Sios ss pojeue ANO YNY ONE IN zu nss Jd Bulleq ZZA VIWAAd SL tX siosu s Bojeue Ajddns d LL EN Ol 4osueas e Bip OL GND OIG ZWOMLS 9 ZF PX ee eth cel SE S CH ainsseid BulleqZZA WOWlS ai tU rs JL EN gdAosu s e Bip g GND SIG dl g _ _ ILINW E EN an N em 9 tx 1osu s e 161p ONG ld SS s Z ILINW FE EN ZZ bX gJosues jey 6IP 9 GND OIG L UIW S bX Z EN g Josuas euDp s GND og GC l l v2 x y josuas If GND og als BE Se emm GZ EN g Josuas Ieu n ONS og N
260. us e When climbing down never jump off the machine T EEES Fig 18 Attached to the right hand side of the machine at the front above the roller crop guide is a step 1 that allows easier access to the linkage and the supply of binding material 49 50 Safety d Aaa KRONE 4 7 12 Rollers on the Wrapping Table WARNING Risk of injury due to moving rollers on the wrapping table There is an increased risk of accident when entering the yellow painted moveable rollers of the wrapping table For repair maintenance and cleaning jobs as well as when remedy malfunctions only step on the areas of the wrapping table painted in green Fig 19 When performing work on the wrapping table do not walk on the yellow painted 1 movable rollers 1 b KRONE 4 7 13 Safety Platform on the Wrapping Table Comprima CV210 XC WARNING Danger of injury when climbing or descending Persons who behave carelessly when getting on and off the machine may fall down from the ladder Persons getting on the machine without using the ladders intended for that purpose may slip or fall or they may get hurt seriously Dirt as well as operating fluids and lubricants may impair surefootedness and stability e Just use ladders intended for this purpose e Always keep ladder steps and platforms clean and in proper condition so that you can step and stay safely e Do not get on and off when the machine is moving
261. v ZX luono uuoo YLSNMdgH O I q e OW lnpou JO OUuZ N 9 r Le v zX 39 24 EH e co n gt d cd a L s N T Ju eg SW 8 ZV Cla ZV Cla LOL tg velexl d qcgx deim jeu uoljisod AG L AVEO eg qegx Buluuns u zg q e OW ainpow L OYSHDIG O I DE LX uono uuoo DL 39 29 SM 8 Wel TT za CV z ezgx Buiuuni jeu cg ezgx ul6u l you Lg cd OW ainpow 9 DOYSHOIG O I Zk LX luono uuoo a 39 19 elg SL CN Heure CV Z amp Lax u 6Bu jeu LO X WO z Aq deu D A01d Joen Se Ioaeg amauge O EOEOOLOSL Gees UOUEOO DOUD GU OU JU uInoop ed X OSL AD 9X SS L AD tza paea dn saqueyo jeq 71g uonisod punou gg dijs sg 46u p sojp Jaquieyd jeq Z1q J p so o Joquieyo eq g OO ONS lnpou OO ONS ampow ZOE ONS mnpou ZOE ONS mnpou ECO EI OWN lnpou 6 DYADIC O I SL od O I Z DJen O I z Old O I old O I Z Zx uol o uuoo ZL ZX luono uuoo oZz LX luono uuoo ZZ LN luono uuoo yZ LN luono uuoo i CV i CV i v i CV i CV iw k Ke Ve K qzx
262. winter storage clean it inside and outside thoroughly To do this use a high pressure cleaner Do not hold the stream of water directly on the bearing points After cleaning is completed lubricate all grease nipples Do not wipe off any grease that comes out of bearing points The hardened grease will provide additional protection against moisture Check chains and sprocket wheels for wear Oil and tighten cleaned chains Check all movable parts such as deflection rolls joints tensioning rolls etc to make certain they move easily If necessary dismount clean grease and remount If necessary replace with new parts Only use original KRONE spare parts Disassemble the universal shaft Lubricate the inner tubes and the guard tubes with grease Grease the lubrication nipples on the universal joint and grease the bearing rings of the protective tubes Park the machine in a dry location but not in the vicinity of artificial fertilisers or livestock buildings Repair places with damaged paint and preserve all bare metal places thoroughly with rust protection agent Caution The machine should only be placed on blocks with a suitable vehicle lifting device Make certain that the machine is stable and safe when it is on blocks To remove load from the tyres set the machine on blocks Protect the tyres against external influences such as oil grease and direct sunlight etc Perform the necessary repair tasks during the time immediately aft
263. witch off the PTO shaft and the engine of the tractor Remove the ignition key Remove the accumulated crop manually b KRONE Operation If the blockage is not removed due to this Start the tractor engine Switch on the PTO shaft Open the bale chamber using the control unit Switch off the PTO shaft and the engine of the tractor Remove the a CPK00230_3 Fig 207 Swivel the shut off valve 1 of the left lifting cylinder from position a to position b Tailgate is locked hydraulically Remove the bale from the bale chamber roll it out to the swath if necessary Remove accumulated crop manually Swivel the stop cock 1 of the left lifting cylinder from position b to position a The tailgate is unlocked hydraulically Start the tractor engine Switch on the PTO shaft Close the bale chamber using the control unit 267 Operation KRONE 11 19 2 Crop blockage at pick up Proceed as follows to remove the accumulated crop a If crop accumulates on the right left edge of the pick up When the PTO shaft is running drive backward In doing so lift lower the pick up several times f the blockage is not removed due to this Switch off the PTO shaft and the engine of the tractor Remove the ignition key Remove the accumulated crop manually b In case of a crop blockage of the pick up e When the PTO shaft is running drive backward In doing so lift lower the pick up several times
264. wnwards as long as the softkey is activated Saving Value When Wrapper is in Parking Position e Press function key OK until the symbol appears briefly in the upper line Note lt The value is saved when the right bar has adopted the value of the centre bar 169 KRONE ISOBUS Terminal KRONE Diagnostics power supply voltage 1240 Ges 12 CM 4120 Term 13 6U 12 Si 13 CM 120 ana 12 0U DL dig 8 84 120 Pou2 13 CH 12U PowS 13 7U CC000239 power supply voltage Nominal voltages 12V Ges 12 14 5V 12V Ter 12 14 5 V SS_5V 4 5 5 5 V 8V ana 8 5 9 1 V 8V dig 8 5 9 1 V 12V P2 12 14 5 V e Pressing the function keyESC closes the called up menu The display shows menu level 4 Service e Pressing the function keyESC and holding it down brings up the basic screen 170 b KRONE 8 13 2 8 13 3 KRONE ISOBUS Terminal Actuator test WARNING The functions are directly executed by energizing the actuators As a result machine parts may start to move unexpectedly persons may be captured and seriously hurt Switch off PTO shaft e Deactivate tractor hydraulics Only persons familiar with the machine are permitted to perform the actuator test e The person performing the test must know the machine parts being actuated by controlling the actuators If necessary secure actuated machine components from unintentional lowering e Only perform the sensor test from a
265. working position WARNING Blades are pretensioned with spring force High risk of injury when attaching or removing the blades e Never press the blades manually into working position Always use a tool for example a hammer Note If the cutting system is not connected for long periods the cutting blades can be replaced with blind blades to prevent soiling of the slots on the blade base and wear to the blades The blind blades can be ordered from the KRONE spare parts department under part number 200654050 A KRONE 11 12 gt Operation Setting the Bale Diameter Comprima CF 155 XC The tailgate must be closed and the bale chamber must be empty Adjust the bale diameter at the rear right and left of the machine CPNO00010_3 Fig 175 Upper hole Smallest bale diameter Lower hole Largest bale diameter e Detach the split pin 2 from the locking bolt 1 on the spring tube 3 e Insert the locking bolt 1 into the desired bore on the spring tube 3 and secure with the Split pin 2 Note The setting must be the same on both sides Note If the bale diameter is changed mechanically the new dimension should be entered in the terminal using the Bale diameter menu 235 Operation KRONE 11 13 Setting Baling Pressure ECKE A VPNOOOO1 2 Fig 176 The setting of the baling pressure is carried out on the machine The following steps have to be taken for baling pressure setting e
266. y in an uncontrolled manner Secure the machine against rolling away with the parking brake and wheel chocks b KRONE 5 1 Commissioning Before initial start up For reasons related to transport the machine is delivered without the PTO shaft and bale ejector Before initial start up the machine must be completely assembled and adjusted to the tractor type The following parts are included loose with delivery in some cases CP100050_3 Fig 22 Pos Desgin Storage location a Canotspray paint Twine box Ugen Wapo 3 Universal shattsuppot reit e Powersupply onthe actor Twnbx 57 58 Commissioning KRONE Fig 23 e Park the machine on firm level ground e Place two wheel chocks 1 under the wheels to prevent the machine from rolling away ANNE E WWW A WAWA WWW W VP80001 6 Fig 24 By Gi gt SAK 9 d Fig 25 e Depressurise the tractor hydraulics Connect the hydraulic hoses 1 2 and 3 to the tractor hydraulics according to colour coding KRONE Commissioning 4 F p d f a Ka A E d 26 Warning Abrupt Movement of the Wrapping Table Effect Crushing hazard of hands between moving machine parts danger of crashing e Instruct persons to leave the danger zone before loosening the cable ties When loosening the cable tie take a position outside of the range of movement of the wrappin
267. z NOS e E e g do Ne v e H 08t x 0r9 ldla VS OOL IOO I8uluui9 snq OSI g y 8 Z 9 H r a L location D24 CV 210 XC 01 job computer connector X1 X2 150100621 wll z o D OKRONE 23 05 2011 lt m O O LLI 9 zx TL NYO gv 0l p so o 1 quieu2 ajeq ZA OL YINMd 9 ZX S EN H L NVO ZW OL dn Jaquieyo ajeq 8A t WIWMd 8b ZX WS JN LU Jamo usiueysew Buiddeim EZA EF NMLSWMddH L ZX GV LL HI uusiueuS uu Hulddeim ZZA YLSNMdgH Zr ZX OCI SE Ly ZX siosu s Bojeue GND YNY ONS ICH OCH awe a S sindino CV S ag mg ea lt FC CN siosu s Doug ONS YNY ONS DV UI e Ov CN vL0O BelloA Bojeue VNVA8 El I OX OCH eg Q re 4 S Jojyow uonisod gg OYAHVNV ZZ ZX cV GI ag EZ ZX VL O BelloA Doug VNVA8 i COOL g a N 24 8 wie Buiddeim 1uBi u RZA L ILINW 6E CN x siosu s Bol jgue Ajddns ey e al Sa Z lqe1 Bums 61g LZ SIG O ZX i SM 619 Z EE N ta 9 uollisod puno16B6 pe 6L SIG ZL ZX YY Z a Deg Le ZX L 1osu s jey61p LZ GND OI

1 - Tulloch Farm Machines

Contents

Download Pdf Manuals

Related Search

Related Contents