Home

Zaxcom Digital Wireless System User's Manual

Contents

1. 9 PMV COUN u x u m u n 19 PIDE FUN ecco tess cune HEEL 19 Headphone i r ite Ten ter vere errr ere ee ee ee 19 Power 19 D M 19 Phantom Power Switch Mic Line SWIECI sscccsecacsccascasecsnczsosescscancscassvednesaucesvapsvsenoneusavs sens vcasedaviiessessoavdeuoscavaueetavaiaaasia was ETERNI HUN SERE VER UIN UNA EUR 19 922 20 GETTING TO KNOW YOUR TRX700 PLUG ON TRANSMITTER cssccssscscssscsssscssscscsssccssssssssscssscsssssssssescsssscssssesssscssscecsssssssssesssscessseees 21 Connectors Switches and LEDS uy uuu Km 2 21 TASK ZOO Configuration RR 9 22 GETTING TO KNOW YOUR TRX800 HANDHELD WIRELESS TRANSMITTER 23 2 Zaxcom Digital Wireless System User s Manual IIS 900 Configuration MENUS T 24 COMMON TRANSMIT TIER STANDARD PIPN Ju
2. 79 Figure 10 7 Standard XLR 3F to TA 5F Line level input 80 Figure 10 8 LEMO 5M to 1 8 male timecode input cable esee eee esee seees 80 Figure 10 9 LEMO 5M to XLR 3M timecode input cable 80 Table of Tables Table bel Approved ys Unapproved mec G Table 1 2 Compatible Lavalier Microphones 12 Table 1 3 Compatible Stick Microphone u csccsssssecssscersscsesscscsssecssessensssssssesscsssecsssscenssssasessacsssscsssscenssseasesacesscesscenss 12 Table 1 4 Compatible Audio 13 Table l 3 C ompailibla IPB Settings 13 Table 1 6 Audio Frequency Block
3. 30 Entering the Extended Men uuu u ederent 3l ne Extended Mel MT 3l lan pass pap 3l uu a 3l Audio Transmitter Format n Hiat Rete uti 3l DO E S PNE E 32 FO sies C 32 FO forle E m P ei RETE 32 IED Rr q Ec RED E 32 Powerup Mode DUEB 33 IVIEGIG Erase amp Format 33 TO Formata D E 33 To Recreate the wrapper files will not destroy existing audio takes u 33 Timecode Jam Mode ll ll TT 34 Timecode Source Bage RE aas 34 Timecode Output Enable Page RINT IE ni 34 Remote Control KERVTDPNIBRDT RR 34 Remote Control Unit ID n 34 Expander eese E ISIDORO MIN IUUD IMEEM ta cca HUIUS nnn eases ees 35 B s Y OYO m 35 OGIO rear aE E EEEE A 4 e m 36
4. 52 Table 5 5 RX4900 Receiver Standard Extended 8 Test Menus 53 Table 6 1 IFBIOO Standard amp Extended tha reve E aU uUE 6 Chapter Zaxcom Digital Wireless System User s Manual Chapter Topics that apply to most units in the system Transceivers TXs with IFB timecode and remote control capable receivers What s included with the TRX900 e SSMA Whip Antenna e media slot dust plug e belt clip e blue Zaxcom storage carrying case User manual on CD ROM RXIO Internal IFB receiver requires EAI00 or STAI0O for monitoring IFB audio Options o TRX90I Internal recording option 00 Timecode adapter o STAIOO Stereo adapter o EAIOO adapter What s included with the TRX992 e SSMA Whip Antenna e media slot dust plug e belt clip e VPX battery e VPX battery charger single e blue Zaxcom storage carrying case User manual on CD ROM Options o Additional VPX batteries Transmitters only What s included with the TRX700 e SMA Whip Antenna e blue Zaxcom storage carrying case User manual on CD ROM Options o TRX90I Internal recording option What s included with the TRX800 e SMA Whip Antenna e
5. SIZELBA 1 SEG 4 Optional screen occurs if the recording was not correctly closed FOUND SEGS indicates how many previous recording s were found MODE 7 7 7 indicates which Transmission Format was set in the Extended Menu FOUND SEGS AUDIO Xv ZAXCOM V TRX900 SN LOW BATTERY 1 60V This screen appears when the battery has to be changed Be aware if you get either alert the unit may not go into Record mode 581 6 STOP s 581 6 REC As soon as the initialization sequence has completed assuming no errors the LR mmm unit immediately goes into Record mode GREC or REC 41 Chapter 3 Zaxcom Digital Wireless System User s Manual Chapter 3 Recording Audio using the Digital Wireless System Transmitters The ability to record audio at the transmitter is an optional feature which must be configured by Zaxcom when purchased If the necessary configuration steps have not been performed none of the recording features will be available Recording Format The MiniSD card is formatted using the FAT32 file system While recording the transmitter places all recorded audio in a single file on the media The FAT32 file system can be read on both Windows and Mac OS computers However the single file generated by the recorder can only be understood by the Zaxcom Transfer and Conversion utility t converts the file into a format Broadcast Wave Format BWF
6. 13 RE 14 Upgrading the firmware in each m 14 OPERATING FREQUENCIE 15 15 Remote Control Timecode and FB Feed nn nsn 5 ANTENNA CABLE SELECTION MR 15 KNOW FIRMWARE PROBLEMS ssiscsscosciscoctssstcvessvcrwsscccwsbeatsesonscenesenccundebscuanidpeetebedoepassucenovebeutd edesevsbosavsbeueaaweleyedbdassueuebsdusobopaueuoesbanbedesenesamacets 15 CHAPTER 2 DIGITAL WIRELESS SYSTEM TRANSMITTERS 16 GETTING TO KNOW YOUR TRX900 AA BODYPACK TRANSMITTER sscsssscssseccececescescecersecessscescesescseescensacesseeesceesceeesceeseneaseneees 16 Connectors Switches and EBD uuu l u u au ana aa anima l PVM eee uu n o ss 16 On Off Switch Internal External Power Switch 16 TRX900 IAA Configuration M nu5 ssscsscsssssssssssssssssssssssssesssssesssssecsessassasssssnsssssasssssnssssssussussuccussuccussuscuscaccussasenessesussecsucsuccucsecceccessaseaseaseass 17 GETTING TO KNOW YOUR TRX992 WIRELESS BOOM TRANSMITTER 18 Connectors Switches and
7. 15 Table 2s Power POSIEIORS EA a TE 16 Table 2 2 TRX900 AA Standard amp Extended Menus 17 Table 2 3 TRX992 Standard 8 Extended 20 Table 2 4 TRX700 Standard amp Extended Menus rrr tho erret ta toss Hope apu as S DEREN UE 22 Table 2 5 TRX800 Standard amp Extended Menus eee ee eee eee eeeee essen ene tn 24 Table 296 Format Error CodeS conie D f EDEN abd nM eI EM MEM e UE 33 Table 3 Available Recording Time u Seu niian eter eva EORUM 42 Table 3 2 Recorder LED Indications ce es torpe Fri UIN DU EIOS br miae ceo trito oor ioats iter ira SEET cioe edv Loo d Ue 43 Table 5 l RX900 FVS Audio PIN OUtS EDT 50 Table 5 2 RX900 M S Receiver Standard Extended 8 Test Menus 50 Table 5 3 RX4900 Receiver Audio Pin outs u 52 Table 5 4 RX4900 RS 485 Pin outs RJ 45 u
8. TSS COMO Ua anken COS IID a emer menc SYR Shure PWS Sony ECM Tram TRO Voice Tech VT40IHS o O Voice Tech VT506 VoiceTech VT9I1O J o o o Table 1 2 Compatible Lavalier Microphones Additional microphones will be added to this list after a review of their 3 3v power performance and RF interference susceptibility has been completed Compatible Stick Mics Use one of the following CE models Voltage Notes LC M e MKH 40 BEEN Older models may pickup some MKH5O I k a Table 1 3 Compatible Stick Microphones Additional microphones will be added to this list after a review of their RF interference susceptibility has been completed General The TRX900 AA has an unbalanced microphone input accessed through a 3 pin micro LEMO connector You can use an unbalanced dynamic microphone or a powered lavaliere It is recommended that you use 3 wire lavalieres with separate pins for ground audio and power When using a line level input an inline pad is required on the standard dynamic microphone input cable XLR 3 to 3 pin micro LEMO When using a phantom powered microphone with the TRX900 AA you must use an external 48 VDC power supply The TRX700 and TRX992 are the only Zaxcom transmitters that include a 48 VDC phantom power supply Zaxcom Digital Wireless System User s Manual Chapter Battery Installation Each unit may require one
9. aeei 25 Normal Startup Sequence without any card inserted u u u u u 25 Normal Startup Sequence with a formatted card inserted u 26 UCI DO uuu nunus 27 ADIECIT 28 Audio Transmitter Frequency pbage 28 CONTO DUBB u sonia E Sees Deu nhi tem CS CEN mM aan NEA P EE 28 Timecode Frame rate Dage NR T 29 Earpiece Source page TRX9xx Ony c cssscssscssscssssssscsssssssssssssnsssnsssnsssssssssssnsssnsssnssssscsssssnscsnsessuessuesssessuessuessuecsuesssessuessscsuecsuecsnecsuecsuecsuecsseessessseesse 29 E X 0 29 Unlockma tne transmite esneari E E 29 COMMON TRANSMITTER EXTENDED MENU uuu ul u aun asa aaasapkipa apnapapiqas aqwkaskuskasqhahaykqsiqa iaqaqkuaqhapqikkawaqaqaqasqssiakta 30 Extended Startup Sequence without any card inserted u u u u u 30 Extended Startup Sequence with a formatted card inserted u
10. Susan 36 Recording Mode a 36 Audio Transmitter Power 37 Boot Ub M de D Espiniera RR E 37 Mute Switch Enable RR 37 Left Right Switch Mode pbage ausatents 37 Transmitter Name DOB nii eaae ei i E OTU EESE E rate dee E EERS EENE EAEE RE i EE EaR 39 secin Code E 39 COMMON TRANSMITTER INDEPENDENT OPERATIONS LIL S ve Per ox e tU eure adai iiia 40 Disable the IFB Receiver during Power ub 40 Display a Detailed Startup Sequence u u u u u u 40 Detailed Startup Sequence without any card inserted u 40 Detailed Startup Sequence with a formatted card inserted e u 4 CHAPTER 3 RECORDING AUDIO USING THE DIGITAL WIRELESS SYSTEM TRANSMITTERS 42 ueer tile IAT 42 RECORDING RIO pm M m 42 PATTER T EIE e 42 xis we APACH Yu Sasa
11. 17777777708 W EX X EE IFB Tx Power page cet ni ase 7777708 Table 6 1 100 Standard amp Extended Menus Each time the MENU key is pressed the menu advances to the next page in sequence 61 Chapter 6 Zaxcom Digital Wireless System User s Manual IFB100 Standard Menu Pacifier page 2 403 2 403 STOP When you power up the unit this page appears and displays the following information e Transmitter frequency Audio level meter e Status of the IFBIOO transport remote control NOTE For diagnostic purposes you can press the INC or DEC key to read the Motherboard supply voltage Remotely Starting and Stopping the Transmitter Recorder While in this page pressing the INC or DEC key sends a Record or Stop command to all TRX9xx ZFRI xx units in the same group as the 100 When setting the IFB input audio level normal conversation should be around 20 dB Remote Audio Gain Change page REMOTE GAIN GROUP01 UNIT ALL his page allows you to adjust the audio gain on the specified remote transmitter s Pressing INC displays and transmits a command to increase the gain setting pressing DEC displays and transmits a command to decrease the gain setting Monitor the audio coming from the TRX9xx unit being adjusted to verify the gain setting change The Remote Unit ID page can be set to ALL or a specific unit Remote Unit ID page CONTROL UNIT ID ALL his pa
12. 8 What s included with the RRRRRERR EE 8 DBAS IS PE C S 8 RECEIVER T E 8 Whats included with the RX900 aaah aqa e op EE 8 o PT 8 Whats included with the 900 9 B S E 9 IPB REMOTE CONTROL E 9 What s included WI ANE IFD 00 uu uuu u aaa aan aqa un kae ronda Roco RR Rev e HU YO tene ER Rr 9 Poo A 9 FE WIR ec eee este E uu u 10 ue A E ML E MU ee ee eer 55 Mid f else NN 12 Com Dalbe LOVS T 12 CombatibIe SUK IVS 12 12 BATTER INSTALLATION Em 13 DATTERY DIEE S E IE EE E EM E 13 sc Aic RR nu mau ua 13 COMMON SETTINGS FOR ASSOCIATED TRANSMITTERS AND RECEIVERS
13. ETE SEENE E SNNN EE EEE DS PENARE EEE 42 PUVA CHORE D A A A A A E T A E A A 43 TRANSMITTER RECORDING OPERATION uuu 43 F ormaliin the MiniSD Card u uuu u u u aa aaa 43 Current Timecode and Frame rate Display ll a 43 Zaxcom Digital Wireless System User s Manual Jamming Timecode into the Transmitter 43 Manually ammine TC witha Bc uuu 44 Continuously Jamming TC using the IFB e 44 Automatically Starting and Stopping the Recording using Timecode from the IFB100 44 CHAPTER 4 TRAI00 IAA ADAPTERS coissis irea rE aaee rarae raara 45 TATOO STEREO ADAPTER A 45 OE Osa E E E A E E 45 AU Te POE LOV u rr ter ore 45 Lowe IS TATOO X 46 ksing an External le WV u de ome preda i E E E E E E E ae OE 46 Using the STA100 STA 50 to Power the Transmitter u 4
14. Chapter 10 Zaxcom Digital Wireless System User s Manual STAIOO STAI50 and IFBIOO Cables Ground Left Channel 1 Right Channel 2 Figure 10 7 Standard XLR 3F to TA 5F Line level input cable Ground Sleeve Ring Tip LTC Out LEMO 5M 1 8 Stereo Figure 10 8 LEMO 5M to 1 8 male timecode input cable TRX700 Jam Sync Cable Ground LEMO 5M XLR 3M Figure 10 9 LEMO 5M to XLR 3M timecode input cable 80 Zaxcom Digital Wireless System User s Manual Chapter I Chapter Software History ZFR IFB Software History Version 5 98 2009 03 03 Fixed formatting cards larger than 4GB Version 5 97 2009 02 19 Changed Changed Transmitter stops transmitting for second while changing frequency to prevent stomping on intermediate frequencies PACIFIER Page display of remaining recording time Version 5 96 2009 02 12 Added FORMAT CANCELED text when just writing wrapper files to card using 9 DEC key presses Version 5 95 2009 02 12 Fixed Remaining Recording Time display area in the PACIFIER screen Version 5 94 2009 02 11 Removed GROUP ID and UNIT ID screens if IFBMODE not installed Removed TRX800 MUTE SWITCH ENABLE screen Removed All four of the AUDIO TRANSMITTER POWER CALIBRATION screens Added Tx power display value to Tx Power Calibration screens Changed Display of Remaining Recording time while IFBMODE not installed Fixed Size Display during bootu
15. IFB MODE OFF Press and hold the INC and MENU keys during power up To re enable the appropriate Display a Detailed Startup Sequence Press and hold the DEC key during power up Detailed Startup Sequence without any card inserted LCD SYNTH LOW POWER MODE IFB Io OFF 0 0150 VER 4 44 03 NO CARD NAME 06060600660 AUDIO CC ZAXCOM V TRX900 SN LOW BATTERY L Du 581 6 STOP umm Optional screen only occurs if Low Power mode has been fully enabled PCB REV B indicates the printed circuit board is revision indicates the version of the firmware loaded CCCCCCCC indicates the entered in the Extended Menu The default is SN followed by the unit serial number indicates the transmitter s serial number hardcoded into the printed circuit board This screen appears when the battery has to be changed Be aware if you get either alert the unit may not go into Record mode 40 Zaxcom Digital Wireless System User s Manual Chapter 2 Detailed Startup Sequence with a formatted card inserted BED SYNTH LOW POWER MODE TEE T IFE OFF 0 Optional screen only occurs if Low Power mode has been fully enabled PCB REV B 0150 VER 4 44 03 FOUND SD CARD Indicates the size of the card i e 2 GBYTES 512 CCCCCC MBYTES NAME
16. Solid Red Recording connection lost The card may have been ejected is full or was not formatted correctly Table 3 2 Recorder LED Indications Transmitter Recording Operation This section describes the steps necessary to record on the transmitter Formatting the MiniSD Card Many MiniSD cards are sold preformatted however you must reformat it in the recorder prior to recording on it Only cards formatted in the transmitter will work correctly To prepare a MiniSD for use or to erase the contents before reuse perform the format procedure on the Media Erase amp Format page Upon completion of the formatting process the following files remain on the card example based on a 2GB card SN01752 folder name defaults to the transmitter s serial or the Name entered in the Extended Menu ZBLKO000 ZAX size 1 048 576 ZBLK0001 ZAX size 932 684 KB ZDIR ZZZ size 538 KB DELETE ME size 512 KB The ZBLK ZAX files store the recording segments and the ZDIR ZZZ file stores metadata about each segment i e pointer into the ZAX file associated start timecode transmitter name etc The DELETE ME file can in fact be deleted Doing this frees up enough room for a copy of the firmware If it is important to you that the Name folder is correct prepare a card for each actor character and have it follow each actor This does not eliminate the need to change the transmitter s name so the correct name appears in
17. that is useable in Post This utility is available to anyone for free from the Zaxcom website Recording Mode The audio can be recorded in Loop Recording mode or Non Loop Recording mode In Loop Recording mode indicated by LREC in the Pacifier page as the card fills up it eventually loops back to the beginning of the card and records over the oldest material To prevent audio from being erased do not exceed the recording length of the media see Table 3 1 Available Recording Time In Non Loop Recording mode indicated by REC in the Pacifier page as soon as the card is full recording ceases and the screen displays FULL Battery Life While recording audio a slight decrease in battery life occurs The battery drains about 576 faster while recording than a non recording transmitter Under typical situations the unit s battery life will be reduced from approximately 5 hours to 4 hours amp 45 minutes Media Capacity You can use MiniSD cards ranging in size from 128 MB to 96 GB The 16 GB MiniSD card records a single track of audio for 96 hours without erasing any recorded audio on the card Available recording times are as follows i Recording Time Table 3 1 Available Recording Time 42 Zaxcom Digital Wireless System User s Manual Chapter 3 Dual Color LED The dual color LED on top of the unit indicates the recorder s transport status Solid Green Stop or Playback mode displays when no card was inserted
18. 125 mA N A Graphics LCD 77 Chapter 10 Zaxcom Digital Wireless System User s Manual Chapter 10 Wiring Diagrams TRX900 IAA Microphone Cables before serial 1315 The following 3 pin micro LEMO connectors mate with the microphone connector e FGB 00 303 CLAD 22 has a latch with pull release FVB 00 303 NLA has a latch with a twist release Ground lt Shield 3 3V Mic Audio Power 3 pin micro LEMO From Mic Figure 10 1 Two wire microphone configuration previous transmitters 8 2K Ground 3 3 V lt Mic Power 3 pin micro LEMO From Mic Figure 10 2 Three wire microphone configuration previous transmitters 3 3V 1 0K Ohm 3 Pin micro LEMO XLR 3F Figure 10 3 Balanced Line to TRX900 78 Zaxcom Digital Wireless System User s Manual Chapter 10 TRX900 IAA Microphone Cables after serial 1314 The following 3 pin micro LEMO connectors mate with the microphone connector e FGB 00 303 CLAD 22 has a latch with pull release e FVB 00 303 NLA has a latch with a twist release Ground lt Shield Audi 3 3V udio Mic Audio Power 3 pin micro LEMO From Mic Figure 10 4 Two wire microphone configuration current transmitters Contact your mic s Manutacturer Figure 10 5 Three wire microphone configuration current transmitters Ground 3 3V 1 0K Ohm 3 Pin micro LEMO XLR 3F Figure 10 6 Balanced Line to TRX900 79
19. 30NDF 30DF SMPTE 6 6 oz 187 grams without battery 1 75 x 3 75 x 1 75 44mm x 95mm x 44mm NA up to 4 hours two AA Graphics LCD 74 Zaxcom Digital Wireless System User s Manual Chapter 9 TRX800 Specifications Transmitter RF Power Output RF Modulation RF Frequency Range RF Frequency Step RF Bandwidth Channel Separation Antenna Connector Emission Designator FCC Part Transmitter Audio Dynamic Range Distortion Frequency Response Highpass Filter System Group Delay Mic Power Mic Connector Input Range Impedance ADC Bit depth ADC Sampling Rate Recording Media File Format Recording Time Timecode Frame rates Timecode Type Physical Weight Dimensions L x Dia External Power Internal Power Battery Display 10 25 50 mW Software selectable proprietary method 518 0 to 872 0 MHz blocks are 24 to 36 MHz 100 KHz US Setting 200 KHz Euro Setting 125 KHz 500 KHz 700 KHz recommended 50 ohm SMA female 180 KV2E 74 86 106 dB 0 001 Mode 0 20 Hz to 16 kHz T amp M Model 0 2 Hz to 16 kHz Off or 30 to 220 Hz step 10 6 dB per octave US Mono mode 3 6 ms Euro mode 6 ms Stereo mode 6 ms 9 VDC Compatible with Shure screw on microphone capsules 60 to 30 dBu 10 k ohms 24 bits 48 kHz MiniSD card Flash memory LAX 24 hours with a 4 GB card 23 98 24 25 29 97NDF 29 97DF 30NDF 30DF SMPTE 8 2 oz 232 grams without a battery 6
20. ORE This page enables disables the limiter function OFF ON When the input signal is too high for the gain setting it is clipped and results in distortion and popping The limiter is used to prevent clipping by beginning to engage around 10 dBFS When using a microphone normally you would enable the limiter However if the input signal is coming from a mixer that 1s using a limiter you should disable this limiter Since it is implemented in the digital domain the automatic limiter may engage even when you don t hear any substantial audio The purpose of the limiter is to prevent the mic preamp from over driving the A D converter so the limiter operates on audio before it has been processed by the highpass filter If there is a massive amount of low frequency audio content being filtered out such as wind noise you may hear the effects of the limiter without hearing the audio that caused the limiter to engage If this occurs the gain is set too high and you must reduce it to below the level that triggers the limiter Audio Transmitter Format page IX FORMAT US MONO his page maintains the audio transmission format Parameters e US MONO R similar to US MONO This is used with the STAI00 to force the audio to the right channel matches up with O US on the receiver STEREO This is the setting to use when the stereo adapter is connected to the transmitter and you are recording in stereo ma
21. US NOTE no timecode IFB or recording is available in this mode Changed battery meter table Version 5 00a 2007 11 03 Added LED OFF mode in the LEDREVERSE screen Version 5 00 2007 10 29 Fixed TRX900 swapped LOW I LOW2 display in the PACIFIER screen s remote power display Version 4 993 UNKNOWN Fixed IFB side autoload would not go into STOP because it never really went into RECORD Version 4 99 2007 10 04 Added support for dual mic side adapter Changed stereo to always be ISO Changed FORMAT EUNB to FORMAT R Version 4 98 2007 09 25 Fixed IFB Autoload function remote transport commands TXifb NS RemoteTPmode not being set 84 Zaxcom Digital Wireless System User s Manual Chapter I Version 4 97a 2007 09 25 Changed sector size from 32k to 6k or less for Digital Foci PhotoSafe FAT 16 vs FAT32 problem Version 4 97 2007 08 3 Fixed serious bug regarding the RecoverOpenSegment feature If the unit is powered down while in record the next recorded segment could begin at the start of the card which would overwrite previous audio and make only that last recorded segment available The new ZaxConvert software v5 97 fixes a minor problem with the RecoverOpenSegment feature and now appends the segment number in decimal to the end of each generated WAV or MP3 file Version 4 95 2007 08 10 Added IFB VOTING screen Turn ON voting only if you have two IFB transmitters transmitti
22. When using the line level input connector STAI0O or TCAI00 with a line level source a non attenuating cable should be used In the transmitter TRXxxx or recorder ZFRI xx in the Extended Menu a Set the Timecode Jam Mode page to Manual b Set the Timecode Source page to SIDE CONNECTOR or AUDIO INPUT as appropriate Continuously Jamming TC using the IFBI00 In the transmitter TRX900 AA TRX992 or recorder ZFRI xx in the Extended Menu a Set the Timecode Jam Mode page to AUTO JAM b Set the Timecode Source page to 2 In the IFBIOO a Connect the TC source to the TC IN connector b Set the Timecode Jam Mode page to AUTO LOAD or AUTO JAM c Set the Timecode Source page to SIDE CONNECTOR Automatically Starting and Stopping the Recording using Timecode from the 100 In the transmitter TRX900 AA or TRX992 or recorder ZFRI xx the Extended Menu a Set the Timecode Jam Mode page to AUTO LOAD b Set the Timecode Source page to 2 Inthe IFBIOO a Connect the TC source to the TC IN connector b Set the Timecode Jam Mode page to AUTO LOAD c Set the Timecode Source page to SIDE CONNECTOR 44 Zaxcom Wireless System User s Manual Chapter 4 Chapter 4 TRX900 Adapters STAIOO Stereo Adapter The STAI00 allows the unit to transmit and or record in stereo from a line level source Ideally it is used to create a stereo hop to a video
23. where indicates the space on the card available for recording and is one of the following error codes SD card found Hp d FAT32 format found Invalid SD card sector size Table 2 6 Format Error Codes Be sure the transmitter displayed SUCCESS MBYTES before using it to record If the transmitter displayed FORMAT FAILED ERROR do not use the card for recording in the transmitter 8 Once the Success message see above appears you will need to reboot so the unit can mount the card To Recreate the wrapper files will not destroy existing audio takes Repeat each of the steps above but substitute the following for step 5 5 Press the DEC key 9 times displays FORMATTING FAT32 Chapter 2 Zaxcom Digital Wireless System User s Manual Timecode Jam Mode page IC JAM MODE MANUAL OFF his page maintains how received timecode will be used Parameters AUTO LOAD start and stop the transmitter s recorder based on the Timecode Source page selection o If an IFBIOO is being used when the IFBIOO timecode starts and stops o If an STAIOO STAI50 TCAI00 is being used and the timecode source is connected to it when the timecode source starts and stops AUTO JAM continuously jams timecode based on the Timecode Source page selection e MANUAL OFF jam timecode once based the Timecode Source page selection Timecode Source page TG OU r n IFB RF
24. 0 ON Os LCD screen INC key DEC key MENU key IFB antennas and receiver SSMA antenna connector MiniSD media slot Power Record LED Power switch Three pin micro LEMO connector mic side FGB 00 303 CLAD 22 Battery door amp compartment Figure 2 1 TRX900 Front and Top Views Connectors Switches and LEDs Antenna The transmitter uses a gold plated SSMA connector Included is an antenna cut to the correct length for your transmitter s specific frequency block You should periodically check that the connector is still securely tightened On Off Switch Internal External Power Switch The Power switch is intentionally set below the frame of the transmitter to prevent accidentally turning it OFF during use When the Zaxcom Stereo Adapter is connected the On Off switch becomes an internal or external power select Switch Position No Stereo Adapter Stereo Adapter Installed Installed switch Table 2 1 Power Switch Positions Zaxcom Digital Wireless System User s Manual Chapter 2 TRX900 IAA Configuration Menus There are seven Standard and twenty five Extended menu pages as follows Standard Menu Extended Menu Pacifier page Highpass Filter page Audio Gain page Limiter page Audio Tx Frequency page page Transport Control page IFB Format page Timecode Frame rate page IFB Enable page Earpiece Source page IFB Voting Enable page Lock page IFB Frequency page Power up
25. 001 GHz MHz Digital Spread Spectrum 2 MHz 96 dBm 24 bit 48 kHz 20 Hz to 12 kHz 8 ohm minimum 3 2 oz 374 grams with battery 5 5 x 29 x 1 1 140 mm x 74 mm x 28 mm NA up to 6 hours one VPX Graphics LCD 73 Chapter 9 Zaxcom Digital Wireless System User s Manual TRX700 Specifications Transmitter RF Power Output RF Modulation RF Frequency Range RF Frequency Step RF Bandwidth Channel Separation Antenna Connector Emission Designator FCC Part Transmitter Audio Dynamic Range Distortion Frequency Response Highpass Filter System Group Delay Mic Power Mic Connector Input Range Impedance ADC Bit depth ADC Sampling Rate Recording Media File Format Recording Time Timecode Frame rates Timecode Type Physical Weight Dimensions H x W x D External Power Internal Power Display 10 25 50 mW Software selectable proprietary method 518 0 to 872 0 MHz blocks are 24 to 36 MHz 100 KHz US Setting 200 KHz Euro Setting 125 KHz 500 KHz 700 KHz recommended XLR 3F 180 KV2E 74 86 106 dB 0 001 Mode 0 20 Hz to 16 kHz T amp M Model 0 2 Hz to 16 kHz Off or 30 to 220 Hz step 10 6 dB per octave US Mono mode 3 6 ms Euro mode 6 ms Stereo mode 6 ms 48 VDC Phantom balanced max XLR 3F 60 to 30 dBu mic level 5 k ohms 24 bits 48 kHz MiniSD card Flash memory ZAX 24 hours with a 4 GB card 23 98 24 25 29 97NDF 29 97DF
26. 12 x 1 5 155mm x 38mm without a windscreen and mic capsule NA up to 5 hours one CRI 23 Graphics LCD 75 Chapter 9 Zaxcom Digital Wireless System User s Manual RX900 MIS Specifications Receiver Receiver Type RF Modulation RF Frequency Range RF Frequency Step RF Bandwidth Channel Separation Sensitivity Antenna Connector Receiver Audio Dynamic Range Distortion DAC Bit depth DAC Rate Audio Output Connector Audio Output Level Physical Weight Dimensions H x W x D External Power Internal Power Display RX4900 Specifications Receiver Receiver Type RF Modulation RF Frequency Range RF Frequency Step RF Bandwidth Channel Separation Sensitivity Antenna Connector Receiver Audio Dynamic Range Distortion DAC Bit depth DAC Rate Audio Output Connector Audio Output Level Physical Weight Dimensions H x W x D External Power Internal Power Display True diversity single conversion digital demodulator proprietary method 518 0 to 872 0 MHz blocks are 24 to 36 MHz 100 KHz US Setting 200 KHz Euro Setting 125 KHz 500 KHz 700 KHz recommended 10 dBm 50 ohm SMA female 114 dB 0 001 24 bit 48 kHz Stereo XLR 5M Mono XLR 3M Mic 40 dBm Line 6 dBm 4 0 oz 113 grams with battery 1 25 x 3 25 x 5 25 32mm x 83mm x 133mm 9 to 18 VDC 200 mA 150 mA in Power Saver mode up to 4 hours four AA 470 mA 350 mA in Power Saver mode Gr
27. Antenna End amp Barrel 23 Figure 4 1 STATO0 Front amp Back VIEWS tec teti 45 Figure 4 2 STAITOO attached to 9 ccccssssssssssscsseccssscssssesesnsacesessersssnoossocntessasarecsaeauscesesancsusssasauecentaasseaeseenssuesensecsseseatenseseess 46 Figure 4 3 00 8 EAI00 attached to TRX900 J L eee eee eee Wawawayaqaqawaaawawankwnaswwiy awssayasshiyasaaqawaiana ene seen ene ena 47 Figure 4 4 TCAI00 attached to TRX900AA amp TCA1100 47 Figure 4 5 STAI50 amp STAI50 attached to TRX900AA 48 Figure 4 6 LIMS Mute Switch attached to TRX900AA amp LIMS Mute 48 Figure 5 1 RX900 M S Front amp RX900 S Rear Views u 49 Figure 5 2 RX4900 Front Rear Receiver amp Monitor Controls Views 5 Figure 5 3 RX4900 Interior Mic Line output level switches eeseeeseeeee esterne entente 5 Figure Gel IFBUOO Front amp Side Views u u uu aa a ne ottiene EDENDI NEM ush a Mie MET MITAD EN ARMIN NEM 60 Lipure A e
28. Antenna Loop Thru 15 INC key 24 Mono Stereo switch 7 Receiver 4 Left amp Right Audio 16 MENU key 25 Monitor fader 8 Receiver 3 Left amp Right Audio 17 LCD screen 26 4 monitor jack 9 RS 485 Loop Thru 18 Valid signal LED Figure 5 2 RX4900 Front Rear Receiver amp Monitor Controls Views Left Right Figure 5 3 RX4900 Interior Mic Line output level switches 51 Chapter 5 Zaxcom Digital Wireless System User s Manual Powering the Receiver An external 12 VDC source can be used to power the receiver This power source can range from 9 to 18 VDC However if the voltage drops below 10 VDC the audio quality will degrade Receiver Connections This section describes the physical connectors on the receiver Audio Output Connector The XLR 3M connector provides the receiver s output Each receiver has two one for each channel and they output at line level 4 dBm There is 20 dB of system headroom Table 5 3 RX4900 Receiver Audio Pin outs Antenna Connectors The rear of each receiver has two BNC connectors intended to connect to external 50 ohm log periodic Shark fin or whip antennas For best performance keep any transmitters at least 3 feet 1 meter from the antennas This is because strong radio frequency sources reduce the receiver s sensitivity The receiver is optimized for properly tuned external log periodic antennas When whip antennas are used there is a noticeable reduction in the receiv
29. BURNING ROM TRX bin At this point the firmware has been installed and the system is verifying the READ BACK TEST install The install process has completed successfully DONE Zaxcom Digital Wireless System User s Manual Chapter Operating Frequencies Audio All audio transmitters and receivers operate on one of the following frequency blocks Frequency Range Frequency Range uy qu y 5 Blocks q y 5 Blocks 518 000 to 542 000 22 to 25 7 686 000 to 722 000 50 to 55 536 000 to 572 000 25 to 30 8 722 000 to 746 000 56to 59 614 000 to 644 000 38 to 42 3l 794 000 to 818 000 Ez 740000 to 770000 59 to 63 23 30 590 000 to 614 000 34 to 37 638 000 to 668 000 42 to 46 818 000 to 842 000 72 to 75 662 000 to 692 000 46 to 50 838 000 to 854 000 79 to 80 Only the frequencies in one specific block are available to a particular transmitter and its associated receiver Coordinate with your dealer or Zaxcom to determine which block s are the best to use in your area s Remote Control Timecode and IFB Feed If the optional IFB feed and IFB remote control options are included their frequency range is Current model for use Worldwide 2 403 to 2 475 GHz Antenna Cable Selection When selecting a cable to use it should be as short as possible When using standard cable the recommended length should not exceed 10 feet However if greater than 10 feet is needed a very low loss c
30. CARD 1 Format the card 1 With the power off insert the card into the slot 2 Hold the MENU key while powering up 3 Once up release the MENU key 4 Press the MENU key repeatedly until PRESS UP KEY 5X appears 5 Press the UP key 5 times to erase and format the card 6 The display indicates it progress 7 Wait for successful completion before using If fails do not use it to record in TRX900 1i Record to card 1 Turn OFF the transmitter 2 Insert the MiniSD card 3 Turn ON the transmitter The unit will go into Record mode after the initialization process has completed INSTALLING A NEW OPERATING SYSTEM i Copy the program to a MiniSD card ii Insert the card into the media slot iii Simultaneously press the UP amp DOWN keys keys while powering up the unit iv Unit displays BurningROM Process takes 20 seconds v Once Done is displayed cycle the power to run on the new version 94 Zaxcom Digital Wireless System User s Manual Chapter 12 Menu Sheet for RX900 MIS amp RX4900 MENU SETTINGS Standard Menu i Pacifier page Displays antenna being used signal strength audio level transmitter limiter status receiver reception format receiver battery capacity transmitter recorder status and transmitter battery capacity 123 4 g gm Audio Receiver Frequency Select page value range 30 MHz in 518 to 872 MHz step 100 KHz 4 o H Scan1234 Audio Receiver Frequency
31. Mode page x Media Erase amp Format page Ww sss Timecode Jam Mode page www Timecode Source page W 3 ES Timecode Output Enable page l remore onis Group ID page 55 Remote Control Unit ID page saa ADC Location page WW css Recording Mode page G s Audio Tx Power page 55 Boot up Mode page MER Left Right Switch Mode page W ws Transmitter Name page ws Security Code page Table 2 2 TRX900 Standard amp Extended Menus Each time the MENU key is pressed the menu advances to the next page in sequence Chapter 2 Zaxcom Digital Wireless System User s Manual Getting to Know Your TRX992 Wireless Boom Transmitter The TRX992 uses a single VPX battery Lithium lon Additional batteries at a very reasonable price can be found where Black amp Decker power tools are sold This section was written based on firmware version 5 98T LCD screen INC key DEC key MENU key IFB receivers amp antennas Mix ratio IFB signal Mic direct MiniSD media slot Power switch 1 8 headphone jack 10 Headphone fader Il Antenna connector SSMA 12 Power Record LED 13 VPX battery 14 VPX battery latch I5 Boom mic connector XLR 3F l6 Belt clip on back 17 VPX battery 16 7 Figure 2 2 TRX992 Front Top Bottom Back amp Battery Views Zaxcom Digital Wireless System User s Manual Chapter 2 Connectors Switches and LEDs Antenna The transmitter has a gold plated SMA connecto
32. Output File Type Qupu BWF Poly 24 bits Defoe Track Enable Man Fie 56 as uH Add Source Folder Seoment Foiter Output Folder Not assigned ee Sen Mac OS X Figure 8 1 ZaxConvert Windows amp Mac Main screens w Dod Load Settings Save Settings When you use ZaxConvert you must first assign an output folder Next add your source folder The following buttons contain additional options that are available when translating ZAX files to broadcast WAV files Output File Type e Timecode Sample Rate Conversation Maximum File Size Output File Name e Track Enable When displayed on the main screen the button shows the current setting Output File Type This menu allows you to select the number of channels bit depth and output file type In addition if the Post facility is using a 40 you can force a 48 kHz stamp to be used on the output files Choose Output File Type Output File Type Bit depth fe BWF Poly 16 bits C BWF Mono 9 24 bits FCP Limit Polyphony f9 No limit 2 2 channels 3 4 channels 6 channels 3 8 channels 1 Force 48K Stamp DV40 Cancel Figure 8 2 Choose Output File Type screen 70 Zaxcom Digital Wireless System User s Manual Chapter 8 Timecode This menu allows you to pull up or pull down timecode or leave the timecode as it was set during audio recording Timecode options TC
33. Pullup f Normal C TC Pulldown Cancel Figure 8 3 Timecode Options screen Sample Rate Conversion This menu allows you to convert the sample rate from the 48 kHz sample rate used while recording Output Sample Rate Conversion 7132000 fs 48000 O48048 7144100 I Cancel Figure 8 4 Output Sample Rate Conversion screen Maximum File Size This menu allows you to set the maximum file size of the audio tracks This is useful when trying to place audio on media or when trying to limit the file size Many audio applications can only handle files that are 2 GB or smaller due to limitations in the file format Maximum output file size 4GB 2 C 1GB 660MB Cancel Figure 8 5 Maximum Output File Size screen Output File Name Reserved for future use Track Enable Reserved for future use 71 Chapter 9 Zaxcom Digital Wireless System User s Manual Chapter 9 Equipment Specifications TRX900 IAA Specifications Transmitter RF Power Output RF Modulation RF Frequency Range RF Frequency Step RF Bandwidth Channel Separation Antenna Connector Emission Designator FCC Part Transmitter Audio Dynamic Range Distortion Frequency Response Highpass Filter System Group Delay Mic Power Mic Connector Input Range Impedance ADC Bit depth ADC Sampling Rate Recording optional Media File Format Recording Time Timecode Fra
34. Voting Enable page IFB VOLING NORMAL OFF CIS lli This page enables disables the IFB Voting function NORMAL OFF 2 TXERS ON To use this function you will need a second 100 that is also connected by audio cable to your cart and placed some distance away in the direction you expect Talent to travel Set the frequency of this second IFB to 2 MHz above 0 002 GHz on the IFB Frequency page the first unit Also be sure to set the IFB Frequency page the Audio Transmitter s i e TRX900 to the lowest frequency assigned to the two IFB 1005 In operation the first IFBIOO will be closer to or on your cart and the second IFBIOO will be some distance away to cover the area you anticipate using While the audio transmitter s i e TRX900 is within range of the first IFB100 it will be receiving IFB audio on that lower IFB frequency Once the TRX900 has gone out of range of the first IFB and gone into range of the second IFB the TRX900 IFB receiver will switch to receiving on the frequency assigned to the second IFB If over time the unit moves out of range of the second IFB and back into range of the first IFB the TRX900 will once again start receiving on the first IFB s assigned frequency IFB Frequency page IFB FREQ 2 403 RX BLOCKS 0000 his page maintains the IFB transmitter s center frequency value range 2 403 to 2 475 GHz step 0 001 32 Zaxcom Digital Wireless System User s Manual Chapter 2 Pow
35. a 50 50 mix of both audio input channels Lock page LOCK 9 1 LOCKED 0020030020 1 his page enables a lock function to prevent accidentally changing settings This page has a five second countdown After the timer expires the display indicates LOCKED Locking the controls prevents accidently changing settings As a safety feature while the unit is locked only the unlock combination is available If you scan past the LOCK display to the next menu page the LOCK will not engage Unlocking the transmitter Simultaneously press the MENU and INC keys Once it is unlocked the screen will return to the Pacifier page Cycling the power will also clear the lock 100 Extended Menu BAT ENDED MENU ERESS UP TO XXII The IFBIOO contains several menu pages that normally do not have to be changed on a regular basis These items are placed in the Extended Menu Entering the Extended Menu Power down the IFBIOO 2 Press and hold the MENU key while powering it up Exiting the Extended Menu Cycle the power or hold down the MENU key to get back to this page and press the INC key 64 Zaxcom Digital Wireless System User s Manual Chapter 6 Highpass Filter page HIGH PASS OFF his page maintains the cutoff frequency for the highpass filter OFF value range 30 to 220Hz step 10 Limiter page LIMITER OFF his page enables disables the limiter function OFF ON Since it i
36. attached to the side of a TRX900 or TRX900AA 100 Timecode Adapter Figure 4 4 TCAI00 attached to TRX900AA amp TCAI00 The TCAI00 timecode adaptor provides a dedicated timecode input to the TRX900 TRX900AA and ZFRI 00 This is especially helpful for using the auto load feature manually without the IFB 100 47 Chapter 4 Zaxcom Digital Wireless System User s Manual STAI50 Stereo Adapter gt c 99 ET o Figure 4 5 STAI50 amp STAI50 attached to TRX900AA The STAI50 is based on the STAIOO The difference is the cables exit from the side instead of out of the back LIMS Mute Switch Figure 4 6 LIMS Mute Switch attached to TRX900AA amp LIMS Mute Switch 48 Zaxcom Digital Wireless System User s Manual Chapter 5 Chapter 5 Digital Wireless System Receivers This section is intended to quickly familiarize you with the functions of each of the Digital Wireless System receivers and was written based on firmware version 8 76 Getting to know your RX900 MIS ENG Diversity Receiver I Mads in w 44 CHIL CHIR E LINE 4v De Ld lt x Thi recetvar com J wu PCC 99 2 3 4 5 6 7 8 9 10 Antenna connectors SMA 7 External DC power connector 2 DEC key 8 Line Mic level switches 3 INC key 9 Audio output connector 4 MENU key M XLR 3M S XLR 5M 5 LCD screen 10 Battery compartment door 6 Power LED and selection switch Figure 5 1 R
37. even if Zaxcom cannot or does not repair or replace any defective Product and your exclusive remedy fails of its essential purpose No Consequential or Other Damages Zaxcom has no liability for general consequential incidental or special damages These include loss of recorded data the cost of recovery of lost data lost profits and the cost of the installation or removal of any Product the installation of replacement Product and any inspection testing or redesign caused by any defect or by the repair or replacement of Product arising from a defect in any Product In the United States some states do not allow exclusion or limitation of incidental or consequential damages so the limitations above may not apply to you This warranty gives you specific legal rights and you may also have other rights which vary from state to state Your Use of the Product Zaxcom will have no liability for any Product returned if Zaxcom determines that The Product was stolen asserted defect l 15 not present 2 Cannot reasonably be fixed because of damage occurring when the Product is in the possession of someone other than Zaxcom or 15 attributable to misuse improper installation alteration including removing or obliterating labels and opening or removing external covers unless authorized to do so by Zaxcom or an authorized Service Center accident or mishandling while in the possession of someone other than Zaxcom Product was
38. issues in high ambient temperatures If you encounter an issue with heat dissipation you can use the receiver s Power Saver mode This mode does not affect the receiver s operation however it does reduce power consumption and heat dissipation by 2576 The receiver is 1076 more power efficient when running from 12 VDC external power When possible external power is the best choice Audio Reception Format page Form0 US his page maintains the current Reception Format selection Parameters e 2 ST US Stereo mode matches up with STEREO on the transmitter l EU European mode matches up with EUROPEAN on the transmitter e 0 05 US Mono mode matches up with US MONO and US on the transmitter If the Reception Format here and the Transmission Format on the associated transmitter do not match the receiver will be unable to decode the audio from the associated transmitter 56 Zaxcom Digital Wireless System User s Manual Chapter 5 Security Code Part 0 page ID0 000 This page maintains the right half of the security code value range 000 to step 1 This three digit number and the one entered in the Security Code Part page are formed into a single six digit security code This code is your security key for this receiver An identical code must be entered into the associated transmitter for the audio to be properly decoded Enabling this function is useful when sensitive informatio
39. may sell Product to resellers who then sell Product to end users Please see below for warranty information or obtaining service No warranty service is provided unless the Product is returned to Zaxcom Inc or a Zaxcom dealer in the region where the Product was first shipped by Zaxcom Warranty Policy Zaxcom Product carries a Standard Warranty Period of one 1 year NOTE The warranty period commences from the date of delivery from the Zaxcom dealer or reseller to the end user There are no warranties which extend beyond the face of the Zaxcom limited warranty Zaxcom disclaims all other warranties express or implied regarding the Product including any implied warranties of merchantability fitness for a particular purpose or non infringement In the United States some laws do not allow the exclusion of the implied warranties Return Material Authorization RMA No Product may be returned directly to Zaxcom without first contacting Zaxcom for a Return Material Authorization number If it is determined that the Product may be defective you will be given an RMA number and instructions for Product return An unauthorized return i e one for which an RMA number has not been issued will be returned to you at your expense Authorized returns are to be shipped prepaid and insured to the address on the RMA in an approved shipping container Your original box and packaging materials should be kept for storing or shipping your Product To
40. option Version 5 82 UNKNOWN Chapter 11 Zaxcom Digital Wireless System User s Manual Changed problem with IFB format and TXformat overlap Version 5 81 UNKNOWN Changed IFB channel changing scheme Version 5 80T UNKNOWN Added new format scheme that seperates TX and RX formats for IFB and Txer Added IFB RX FORMAT screen Added high quality IFB format mode no timecode or remote control in this mode Deleted QCAL screen from IFB Version 5 75T UNKNOWN Changed PROBLEM WITH STUFFED DECODE CONDITION Version 5 74T 2009 01 12 Disabled IFB MIX screen if IFBoptioncode Changed LCD opts back on Version 5 73 2009 01 11 Added TRX800 MENU key to enter Extended Menus REC key already does this Changed UNIT CODE to UNIT ID Changed GROUP CODE to GROUP ID Removed IFBIOO ADC SELECT screen BATTERY TYPE screen ICAL screens QCAL screens Removed IFBIOO battery graphic from the PACIFIER screen Deleted IFB FREQUENCY BAND screen since it s always set to the 2GHz band Changed sub channel keys to use Pre Lock key status added gXkeyStatesPreLOCK Added subchannel support for bXKEYS 8PUNCH key press and RECORD key Version 5 72 2008 12 11 Added Support for wireless remote channel changing via 100 Fixed LCD lines were swapped due to wrong page numbers Version 5 71 2008 12 03 Added Support for new LCD module serial 1988 amp above Version 5 7LL 2008 12 03 Changed SPECIAL VERSION hold UP key to
41. request an RMA please contact Zaxcom by telephone There is an RMA form on the Zaxcom website Please fill out the form and return it with the Product for repair Zaxcom will return the warranty repair 2 day UPS or FedEx at their discretion If overnight service is required a FedEx or UPS account number must be provided to Zaxcom to cover the shipping expenses Warranty Limitations Zaxcom s limited warranty provides that subject to the following limitations each Product will be free from defects in material and workmanship and will conform to Zaxcom s specification for the particular Product Limitation of Remedies Your exclusive remedy for any defective Product is limited to the repair or replacement of the defective Product Zaxcom may elect which remedy or combination of remedies to provide in its sole discretion Zaxcom shall have a reasonable time after determining that a defective Product exists to repair or replace a defective Product Zaxcom s replacement Product under its limited warranty will be manufactured from new and serviceable used parts Zaxcom s warranty applies to repaired or replaced Product for the balance of the applicable period of the original warranty or thirty days from the date of shipment of a repaired or replaced Product whichever is longer Limitation of Damages Zaxcom s entire liability for any defective Product shall in no event exceed the purchase price for the defective Product This limitation applies
42. the metadata Current Timecode and Frame rate Display The current timecode generator value and frame rate appear on the Timecode Frame rate page Jamming Timecode into the Transmitter While the transmitter is being jammed it identifies the timecode rate and type and sets itself to that rate Jamming timecode on the transmitter starts a new recording file The Zaxcom conversion utility starts the transfer and conversion process at the point where the transmitter s timecode was jammed 43 Chapter 3 Zaxcom Digital Wireless System User s Manual Manually Jamming TC with a Cable Timecode can be jammed into the transmitter by connecting the timecode source to the microphone input or using the stereo adapter When timecode is connected it takes the transmitter approximately three 3 seconds to recognize the TC input The screen display TIME CODE followed shortly by JAMMED when it is recognized When the word JAMMED disappears the timecode input source can be disconnected and normal operation can be resumed When using the mic input connector with a mic level source the audio level of the timecode needs to be between 30 and 10 dBFS the transmitter s meter Any level above 10 may cause clipping which will prevent proper reading of timecode When using the mic input connector with a line level source a line level to mic level cable should be used to attenuate the timecode signal out of a generator to the correct audio level
43. without any card inserted LCD SYNTH AB LOWER POWER MODE Optional entry only occurs if Low Power mode is fully enabled IFB IS OFF 0 KE PCB REV indicates the printed circuit board is revision PCE 0150 indicates the currently installed firmware version VER 03 0150 Programmable logic device revision code 0000 means NO CARD timecode input available NAME CCCCCCCC displays the Name entered in the Extended Menu The default is SN followed by the unit serial number ZAXCOM V TRX900 SN indicates the transmitter s serial number hardwired into the printed circuit board LOW BATTERY This screen appears when the battery has to be changed 1 60V Be aware if you get either alert the unit may not go into Record mode 581 67 STOP The outline of the battery symbol starts blinking when the voltage reaches Eh m a low level 25 Chapter 2 Zaxcom Digital Wireless System User s Manual Normal Startup Sequence with a formatted card inserted LCD SYNTH AB LOWER POWER MODE T Diss de is full led IFB IS OFF 0 Optional entry only occurs if Low Power mode is fully enabled PCB REVB 0150 103 indicates options available 00 none 01 02 IFB 03 IFB 8 VER 03 record FOUND SD CARD CCCCCC Indicates the size of the card i e 2 GBYTES 512
44. 0 MAX 33 0 his page maintains the frequency scan s ending channel value range 16 to 99 step 1 It should be the same as the end of the unit s block 00 Independent Operations Disable the IFB Transmitter during Power up IFB MODE OFF Press and hold the INC and MENU keys during power up 67 Chapter 6 Zaxcom Digital Wireless System User s Manual Display a Detailed Startup Sequence Press and hold the DEC key during power up Detailed Startup Sequence without any card inserted L CD SYNTH AB 150 PCB REV B indicates the printed circuit board is revision B VER 03 indicates the version of the firmware loaded NO CARD NAME CC UE UE AUDIO ZAXCOM Vir indicates the transmitter s serial number hardcoded into the SN ttt tt printed circuit board 2 403 Detailed Startup Sequence with a formatted card inserted LCD SYNTH PCB REVB 0150 VER 00 FOUND SD CARD PCB RISE VB 0150 NAME OGCUUC UC FOUND SEGS MODE IFB LOW Q indicates how many previous recording s were found FOUND SEGS AUDIO IFB LOW 0 ZAXCOM V IFB100 SN 2 403 mm 68 Zaxcom Digital Wireless System Owner s Manual Chapter7 Chapter 7 ZedAlpha Digital Wireless Monitoring Software ZedAlpha was created by and is maintained and sold through Orbital Sound h
45. 3 his page sets the IFB transmitter s center frequency value range 2 403 2 475 GHz step 001 The IFBIOO should be adjusted with a minimum 2 MHz separation between channels However 8 MHz separation between channels is necessary when using the Zaxcom Voting System ZVS If the ZVS is enabled you need to allocate four adjacent channels 2 MHz apart for the IFBIOOs For example the ZNS would use 2 403 GHz 2 405 GHz 2 407 GHz and 2 409 GHz This makes 2 41 GHz the next channel available for another ZVS group Using 2 MHz spacing the IFBIOO can simultaneously support 36 IFB channels 63 Chapter 6 Zaxcom Digital Wireless System User s Manual Selecting the frequency If interference is encountered the range of the system is affected If the range is less than 150 ft go to a different channel at least 30 MHz away from the interfered channel There are many devices that use the 2 4 GHz band The IFBIOO should be able to operate interference free while other devices share the band It is suggested that when operating in a new location that a range test be conducted before the unit is used for a production IFB Input Mix page IFD INPUI MIX LR MONO MIX This page controls the audio feed to the IFB transmitter Parameters RIGHT ONLY the IFB transmitter audio source is the right channel LEFT ONLY the IFB transmitter audio source is the left channel LR MONO MIX the IFB transmitter audio source is
46. 6 The Audio Timecode Output Connection u u u u u u 46 Timecode ipa u k 46 Operatic U STA boy 46 FOSE UNE cm 46 EATOU IFB EARPIECE ADAPTER uuu ond EDI dm INDEED LR INN IDEM MIN UMEN 47 pe TIMECODE ADA rr c 47 TP OER EO AP TER M 48 PD Pili Wi T 48 CHAPTER 5 DIGITAL WIRELESS SYSTEM RECEIVERS 49 GETTING TO KNOW YOUR RX900 M S ENG DIVERSITY RECEIVER 49 Powering the Receiver 49 liter IPE be Cu u a n uz bn D a om genre ry a IO nun a 49 External Power CC u uuu u u uuu acdsee snc ainsi D DR 49 Receiver Conheci assier uu au 49 Audio Output GOS CEO sessa swakassiwasasavaqkasqaywaawwwsqwayasqawsauayiaqkas qaqa sia aiqaesqaiwawqaqaykkuwaaayasanqkuqtawwu isawakissahusassawwwwkaskaywaskassis 50 Al el Sela eie t E saus 50 RX
47. 900 MIS Configuration Wienlsu u u lla was Ets act e cron edis 50 GETTING TO KNOW YOUR RX4900 DIVERSITY RECEIVER 5i err th ERE a t PIENE Re SEES ee deat ERR HIA Une I HEROUM IS ERU TIR 5 Powering the R ec lVver u uu diaii 52 a IINE COLOR 52 Aio 10 eo Uis Go 9 giclee ct ene aaa ree eee eee eee ere 52 Antenna COCCI PRI RE 52 u T 52 RX4900 Configuration Menus 53 COMMON RECEIVER STANDARD MENI uk la paqana EAE EEEE AEAEE E 54 e e T E RN IER RR 54 Audio Receiver Frequency Select bage 54 Audio Receiver Frequency Scan page s csscsscssssssssssscsssssssssssssaseassnssassnsensensensenscnssnseaseasenssanesnssassnceusensensenseasansenscnsenscassucocsucessanceasenceasancensencensenees 55 Best Practice Scanning for a Low Noise 55 Best
48. Audio Gain Change pepe E 62 Remote SIE E R 62 Remote Audio Frequency Change page cssssscssscsssssssscsssnsenssnsenssnsenssnsencsnsesssasccesonccnsanscossnsensensansensensensensencensenscasesscaneesenssuceasancensancensensensensensens 62 Remote Power Setting Change Lado o Re EE on or a nest 63 Timecode Tram erqie icona t ttu ME c t Acne v Tei Re 63 anaE EE Ea E S O A m 63 qa 64 LOCK uu nu a unan naa nu 64 Unlackina the transit ALI ea ree tbe n S tnnt eec E VEN A Inde ruris n EMEN 64 FB O0 EXTENDED MENU T C 64 Entering the Extended Menu LLL 64 Exiting the Extended Menu 64 lol G sl i i T 65 Q cocus oomen IMEEM MIU ECH pU EMITE NIU O E UEM D DIS UH e E 65 PEED TOOT G PO 65 MEE FEU INC en testi itn Be ep eid ence oid astute utut nu apatite Ec edu DES Taur 65 uui uias T 65 Timecode Jami Mode DODE cinirenen etiem oa asbl drained Mta do IUE Ed 66 Timecode Source bapa uuu uuu o eer 66 Timecode Output E
49. CCCCCC MBYTES SIZELBA 1 Optional screen occurs if the recording was not correctly closed SEG _ indicates how many previous recording s were found FOUND SEGS 222222 indicates which Transmission Format was set the Extended MODES 2 Menu ZAXCOM V TRX900 SN 4444 LOW BATTERY This screen appears when the battery has to be changed Lay Be aware if you get either alert the unit may not go into Record mode 581 6 X STOP Eh m 581 6 REC As soon as the initialization sequence has completed assuming no errors the ELh mmm unit immediately goes into Record mode indicated by LREC or REC 26 Zaxcom Digital Wireless System User s Manual Chapter 2 Pacifier page 581 6 STOP FET k umm 581 6 REC Eh umm 581 6 STOP Eh umm LOW2 REC NL hh m rS lig Te his is the default page at startup and displays the following information transmitter frequency remaining battery capacity available recording time IFB receive indicator e recording mode audio input level recording buffer overrun current power mode Press the INC or DEC key to temporarily display the current battery voltage in place of the battery icon Power Modes indicated by the frequency field 581 6 When the transmitter frequency is displayed the unit is fully powered up LOW1 TheRFPower Amplifier is disabled LOW2 RF Power Amplifier RF Board and Mic Pre amp are all disable
50. ER I SOFTWARE HISTORY 8 TRA ZERT AFB SOFTWARE HIST ORY uuu uuu uuu uuu u u L Tm 8 RA SOFTWARE AITOR Tereso uuu 25 E EN E AAA EA EE A A 86 CHAPTER MENU SHEETS uuu visi ivi Sue T Ue a a a aae o NON iiae aiani sii ones 88 MENU SHEET FOR 88 MENU SHEET FOR TRX700 TRX800 92 MENU SHEET FOR AI IURE 95 MENO SHEET FORIFB OG e 97 CHAPTER 13 ZAXCOM WARRANTY POLICY AND LIMITATION S 99 Table of Figures Raure MUS OO Front yi c Ec M Figure 2 L TRAX900 Front 3nd Top Ex HM 16 Figure 2 2 TRX992 Front Top Bottom Back amp Battery 18 Figure 2 3 Internal Switches LOCACiON tet M M 19 Figure 2 4 TRX700 Front 8 Top End Views 21 Figure 2 5 TRX800 Side Mic Capsule Body Threaded End Body
51. Gi TON es TPE 70 iles TM HM 7 SAMBLESSATE C ONVERSIOBI u unn u ee eae NU SIE E 7 MA uS ME SIZE c HP 7 UT RUT TEILE NAME n dad HERUM dame 7 TRACK ENABLE c 7 CHAPTER 9 SPECIFICATIONS uuu u aoa s EROR aUa u PERS VE Ee Eua e Vb es pU Ua eas 72 Zaxcom Digital Wireless System User s Manual E eU C ele IOS 72 TR2 992 SPECIFICATION 73 E Si rA gselirenu el MRNA 74 TRASOU SPECIFICATION Sirisa 75 RA 200 PECIFIC we 76 RA 4900 SPECIFICATIONS EA EEE E E 76 IPP 00 PECIFIC ATION u G 71 CHAPTER 10 WIRING DIAGRAMS 78 TRX900 AA MICROPHONE CABLES BEFORE SERIAL 3 5 u 78 TRX900 MICROPHONE CABLES AFTER SERIAL 3 Ste EP Eep Rees pe que E oie eia Manet Un nta ru Raoin 79 TER 79 MANU HUE E 79 STATO STAISO AND TFB 00 uuu lll l Faves ou uuu uui au kusam a ian uoa 80 E P VI 80 CHAPT
52. ICS Dynamics page Factory Setting PARMS OFF ON OFF SIDECHAIN IN LP1 LP2 HFB IN SPEED SLOWEST SLOW NORMAL FAST FASTEST SLOW ATTACK SLOWEST SLOW NORMAL FAST FASTEST SLOW CMP RATIO value range 1 0 1 to 5 0 1 step 1 3 0 1 CMP THRESH value range 0 to 96 dB step 1 20dB CMP KNEE value range 0 to 20 dB step 1 value range 1 1 00 to 1 4 00 step 01 1 1 10 EXP THRESH value range 0 to 96 dB step 1 40dB REDUCE value range 0 to 36 dB step 1 12dB GAIN value range 0 to 30 dB step 1 vii BATTERY TYPE _ LITHIUM ALKALINE NIMH 93 Chapter 12 Zaxcom Digital Wireless System User s Manual ix RECORD MODE Recording Mode page LOOP RECORD NON LOOP RECORD x TX POWER Audio Transmitter Power page LIOMW 25MW 50MW 100MW xi BOOT UP IN Boot Up Mode page INORMAL STANDBY xu MUTE SWITCH Mute Switch Enable page 10 DISABLED 1 ENABLED POSITIVE 0 ENABLED NEGATIVE xxvi LR SWITCH MODE LR Switch Mode page OFF ON UP KEY ON MENU ON DOWN KEY KEYS xii NAME _ Transmitter Name page max 8 chars char 0 to 9 space A to Z xiv IDI IDO Security Code page each value range 000 to FFF step 1 unless necessary use 000 RECORDING TO THE MINISD
53. IN Audio Gain page 0 to 52 dB step 2 ii TXFREQ Audio Transmitter Frequency page 518 to 872 MHz 30 MHz block step 100 KHz Minimum channel separation 500K Hz iv Transport Control page While in RECORD mode press DEC to STOP recording While in STOP press DEC to move the playback pointer backward To PLAY press INC While in PLAY press INC to move the playback pointer forward v TIMECODE Timecode Frame rate page 23 98 24 25 29 97NDF 29 97DF SONDF 30DF vi LOCK Lock page 5 sec countdown once entered To unlock simultaneously press MENU amp UP keys Extended Menu to reach these turn off the TX and hold the MENU key down while powering up Displays EXTENDED MENU PRESS UP TO EXIT i HIGH PASS _ Highpass Filter page OFF value range 30 to 220 7 step 10 LIMITER Limiter page DFF ON TX FORMAT Audio Transmission Format page 105 MONO EUROPEAN STEREO US MONO R iv POWER UP MODE Power up Mode page UNLOCKED LOCKED v PRESS UP KEY 5X Media Erase amp Format page 92 Zaxcom Digital Wireless System User s Manual Chapter 12 vi EXPANDER Expander page Factory Settin PARMS OFF ON OFF RATIO value range 1 1 01 to 1 4 00 step 01 1 1 30 THRESH value range 0 to 96 dB step 1 40 dB REDUCE value range 0 to 36 dB step 1 6 dB SPEED SLOW NORMAL FAST SLOW vil DYNAM
54. NORMAL FAST FASTEST SLOW Controls the amount of gain slewing which will general slow up the response to attack transients only CMP RATIO value range 1 0 1105 0 1 step 1 3 0 1 Compressor ratio Sets the compressor ratio i e 2 0 means for every dB above the compressor threshold the gain will be reduced 2 dB CMP THRESH value range 0 to 96dB step 1 20dB 35 Chapter 2 Zaxcom Digital Wireless System User s Manual Compressor threshold Sets the threshold below which grain reduction occurs according to the compressor ratio setting CMP KNEE value range 0 to 20dB step 1 OdB Compressor soft knee setting Sets the depth of the compressor s soft knee A soft knee of 6 dB will result in more gradual gain reduction in the 6 dB range over the compressor s set threshold Note that settings below 6 dB have very little effect EXP RATIO value range 1 1 00101 4 00 step 01 1 1 10 Expander ratio Sets the expansion ratio i e 2 0 means for every dB below the expander threshold the gain will be reduced 2 dB EXP THRESH value range 0 to 9 6dB step 1 40dB Expander threshold Sets the threshold below which gain reduction occurs according to the expander ratio setting REDUCE value range 0 to 3 6dB step 1 12dB Maximum amount of expander gain reduction Sets an absolute limit on the amount of gain reduction caused by the expander GAIN value range 0 to 3OdB step 1 OdB Make up g
55. OWER UP MODE Power up Mode page Unlocked Locked Unlock by simultaneously pressing the MENU and UP keys TC JAM MODE Timecode Jam Mode page MANUAL OFF AUTO JAM AUTO LOAD TC SOURCE Timecode Source page LAUDIO INPUT SIDE CONNECTOR TIMECODE OUTPUT Timecode Output Enable page ON OUTLEFT ON OUTRIGHT REMOTE CONTROL GROUP ID Remote Control Group ID page value range 0 to 99 step 1 REMOTE CONTROL UNIT ID Remote Control Unit ID page ALL value range 001 to 200 step 1 IFB TX POWER IFB Transmitter Power page value range 0 to 7 step 1 TVCHAN MIN TV Channel Minimum page value range 16 to 99 step 1 TVCHAN MAX TV Channel Maximum page value range 16 to 99 step 1 INSTALLING A NEW OPERATING SYSTEM Copy the program to a MiniSD card Insert the card into the media slot lii iV Simultaneously press the UP amp DOWN keys Unit displays BurningROM Process takes 20 seconds Power down and back up to run new version 98 Zaxcom Digital Wireless System User s Manual Chapter 13 Chapter 13 Zaxcom Warranty Policy and Limitations Zaxcom Inc values your business and always attempts to provide you with the very best service No limited warranty is provided by Zaxcom unless your Zaxcom Digital Wireless System Component Product was purchased from an authorized distributer or authorized reseller Distributers
56. Practice Finding the Quietest Frequencies for Multiple Transmitters 55 TSE VON coast a asun ma 56 COMMON RECEIVER EXTENDED MENU 56 Entering Extended M M M 56 Exiting the Ext nded Menu ass ood epa IRURE 56 she diui mee Er E ees 56 Power Saver m 56 Audio Reception Format 56 security Code Pait O e 57 Code Part E T u u u uuu POP 57 RS 485 Unit Identifier 58 RS 485 Communication Speed pbage 58 l IRIs Wi ip 58 Preset Frequency F 109 H 58 COMMON RECEIVER TEST MERU iet tto eti itt ire tea ers OI EE NEN EE E EN 59 Entering the Test u u 59 the umanuan nan n uu che torte Suma tec retain A errant errr 59 security ENGDI DODO u uu EN cme N nian esas aca 59 Ant
57. S Dynamics page Factory Setting PARMS OFF ON OFF SIDECHAIN IN LP1 LP2 HFB IN SPEED SLOWEST SLOW NORMAL FAST FASTEST SLOW 89 Chapter 12 Zaxcom Digital Wireless System User s Manual XVII XXII Xxl1ll XXIV ATTACK SLOWEST SLOW NORMAL FAST FASTEST SLOW CMP RATIO value range 1 0 1 to 5 0 1 step 1 3 0 1 CMP THRESH value range 0 to 96 dB step 1 20dB CMP KNEE value range O to 20 dB step 1 value range 1 1 00 to 1 4 00 step 01 1 1 10 EXP THRESH value range 0 to 96 dB step 1 40dB REDUCE value range 0 to 36 dB step 1 12dB GAIN value range 0 to 30 dB step 1 ADC ADC Location page INTERNAL EXTERNAL BATTERY TYPE _ Battery Type page LITHIUM ALKALINE NIMH RECORD MODE _ Recording Mode page LOOP RECORD NON LOOP RECORD TX POWER Audio Transmitter Power page IOMW 25MW SOMW 100MW BOOT UP IN Boot Up Mode page INORMAL STANDBY MUTE SWITCH Mute Switch Enable page 10 DISABLED 1 ENABLED POSITIVE 0 ENABLED NEGATIVE LR SWITCH MODE LR Switch Mode page OFF ON UP KEY ON MENU ON DOWN KEY NAME Transmitter Name page max 8 chars char 0 to 9 space A to Z 90 Zaxcom Digital Wireless System Use
58. SCEOBDL Rois mann TII O Edad In ME 69 Figure 8 1 ZaxConvert Windows amp Mac Main screens u 70 Figure 8 2 Choose Output File Type screen u 70 Figure 5 5 Timecode Options Gen tah iie mtt etd Tab ilii tute 7 Figure 8 4 Output Sample Rate Conversion screen 7 Figure 8 5 Maximum Output File Siz screen stie uu u S ansa nani A UH NU TE EM HE DAR aE SER AR A 7 Figure 10 1 Two wire microphone configuration previous transmitters 78 Figure 10 2 Three wire microphone configuration previous transmitters 78 Figure 10 3 Balanced Line to Pe AA MM 78 Zaxcom Digital Wireless System User s Manual Figure 10 4 Two wire microphone configuration current transmitters 79 Figure 10 5 Three wire microphone configuration current transmitters 79 Figure 10 6 Balanced Line to TRX900 GAA
59. SS UP TO EXIT i HIGH PASS _ Highpass Filter page OFF value range 30 to 220 7 step 10 LIMITER Limiter page DFF ON ii TX FORMAT Audio Transmission Format page US MONO EUROPEAN STEREO US MONO R iv IFB FORMAT IFB Format page LHI Q LOW Q v RXMODE o Enable page OFF RX 88 Zaxcom Digital Wireless System User s Manual Chapter 12 vi IFB VOTING IFB Voting Enable page INORMAL OFF 2 TXERS ON vii IFB FREQ IFB Frequency page value range 2 403 to 2 475 GHz step 001 POWER UP MODE Power up Mode page UNLOCKED LOCKED ix PRESS UP KEY 5X Media Erase amp Format page x TC JAM MODE Timecode Jam Mode page MANUAL OFF AUTO JAM AUTO LOAD xi TC SOURCE Timecode Source page LAUDIO INPUT RF SIDE CONNECTOR TIMECODE OUTPUT Timecode Output Enable page DFF ON OUTLEFT ON OUTRIGHT xii REMOTE CONTROL GROUP ID Remote Control Group ID page value range 0 to 99 step 1 xiv REMOTE CONTROL UNIT ID Remote Control Unit ID page ALL value range 1 to 200 step 1 xv EXPANDER Expander page Factory Settin PARMS OFF ON OFF RATIO value range 1 1 01 to 1 4 00 step 01 1 1 30 THRESH value range 0 to 96 dB step 1 40 dB REDUCE value range 0 to 36 dB step 1 6 dB SPEED SLOW NORMAL FAST SLOW xvi DYNAMIC
60. Scan page Start a Scan Press the UP key Accept the Frequency Press the DOWN key Discard the Frequency Press the MENU key iv Tone Test Tone page Off OdB 20 Extended Menu to reach these turn off the RX then hold the MENU key down while powering up i Lite Backlight On Off page On Power Saver Enable page Oft On ii Form Audio Reception Format page O US 12EU 2 ST iv IDO _ Security Code Part 0 page value range 000 to FFF step 1 unless necessary use 000 v 1 __ Security Code Part 1 page value range 000 to FFF step 1 unless necessary use 000 vi RxNum __ RS 485 Unit Identifier page value range 0 to 99 step 1 vii Baud RS 485 Communication Speed page 192 384 vii Preset Frequency pages 0 to 91 value range 30 MHz in 518 to 872 MHz step 100 KHz 95 Chapter 12 Zaxcom Digital Wireless System User s Manual Test Menu to reach these turn off the RX then hold the INC amp DEC keys down while powering up i Secure Security Enable page Off On ii a00b00 Antenna Signal Strength page veo VCO page iv 000000 Reception Error Counters page v S77gggg 700 Signal Reception Quality page 96 Zaxcom Digital Wireless System User s Manual Chapter 12 Menu Sheet for IFB 100 MENU SETTINGS Standard Menu i Pacifier page Displays transmitter frequency DC p
61. X900 MIS Front amp RX900 S Rear Views Powering the Receiver The ENG Diversity Receiver can be powered by batteries installed in the unit or using an external 9 to 18 VDC source Use the front panel power switch to select internal power external power or no power Internal Batteries Four AA batteries are used to power the receiver Use either Lithium or Nickel Metal Hydride NiMH AA batteries While alkaline batteries may be used they will only power the unit for a short time 30 to 60 minutes NiMHs will last up to 6 hours while Lithiums will last about 10 hours To use internal batteries set the power switch to the INT position The 4 AA batteries are accessed by pressing on the battery door while sliding the door away from the center of the unit External Power Source An external 12 VDC source can be used to power the receiver for an extended time Set the front panel power switch to the EXT position while using an external power source The receiver does not automatically switch to an internal power source if the external power source is lost You must manually change the front panel power switch from EXT to INT to power the unit from the internal AA batteries The receiver external power can range from 9 to 18 VDC However if the voltage drops below 10 VDC the audio quality will degrade Receiver Connections This section describes the physical connectors on the receiver The power connector was described in the previ
62. Zaxcom Digital Wireless System User s Manual TRX900 TRX900AA TRX800 TRX700 TRX992 Receiver Firmware Version 8 76 Transmitter Firmware Version 5 98 amp 5 98T Updated 2009 03 05 22 47 COIT 230 West Parkway Unit 9 Pompton Plains NJ 07444 USA e e Tel 973 835 5000 Fax 973 835 6633 Email info zaxcom com Website www zaxcom com Updated and Edited by Ray M Owen Production Sound Mixer Zaxcom Digital Wireless System User s Manual Table of Contents CHAPTER TOPICS THAT APPLY TO MOST UNITS IN THE 5 8 TRANSCEIVERS TXS WITH IFB TIMECODE AND REMOTE CONTROL CAPABLE RECEIVERS 8 What s included with the 9 AA ssssssccsssssssscsscsssnsssssnssnssnsenssnsenssnsenscsnecessnecossuscosonscasensansensensensensenscnsensensenscsueceestencencanceacensensenseasensenes 8 olo M 8 Whats With th IRAF092u uuu ua ie RR a k eto dn iron rata favis eso NU aft ene Satu 8 P oio Per M 8 TRAN MITER ONEI S T 8 Whats included with the TRX700 n nn anna 8 Goo Rec
63. able should be used For maximum performance use only high quality 50 ohm coax cable and only as much as is required otherwise the receiver s sensitivity may suffer When permanently installing cables use 2 Andrew heliax http lawapps commscope com catalog Using heliax cable a run of 100 feet 30 5 meters can be achieved without significant power loss Know Firmware Problems Transmitters e PROBLEM Naming your transmitter ZAXCOMSD the Transmitter Name page will cause the Format function in the Media Erase amp Format page to fail WORKAROUND Don do that e PROBLEM The first audio segment is always timecode stamped with 00 00 00 WORKAROUND Go into record mode for a few seconds after the card has been initialized Any recording after this point will have the correct timecode recorded in the file Receivers NONE IFB NONE Chapter 2 Zaxcom Digital Wireless System User s Manual Chapter 2 Digital Wireless System Transmitters This chapter is intended to quickly familiarize you with the functions of each of the Digital Wireless System transmitters Getting to Know Your TRX900 IAA Bodypack Transmitter Both the TRX900 and TRX900AA are identical in operation The only difference is the type of battery used The TRX900 uses a single CRI 23 battery whereas the TRX900AA uses two AA batteries Lithium or NiMH This section was written based on firmware version 5 98 Mm RWN O
64. age display on the PACIFIER screen and AUDIO GAIN screen press DOWN or UP key Modified Low Power mode triggers a new experimental Low Power mode This mode is triggered if LED mode lt LOW POWER TX Format US IFBMODE OFF Timecode IFB and Recording features are turned OFF in this mode To change to Low Power mode l Go to Extended Menu hold MENU while powering up the unit 2 Change IFBMODE to OFF if you have that option 3 Goto the LEDREVERSE screen one of the last menu pages The LEDREVERSE setting allows you to change the default color of the LED The LED should usually be green 4 Change the setting to LED LOW PWR MODE while keeping the LEDREVERSE setting the same digit as it was previously 5 If the conditions have been met the unit will display LOW POWER MODE IFB IS OFF when the unit boots up again and the LED turns OFF when not in use This setting should increase the battery life by over 1576 depending on the chemistry of the batteries you are using Added IFBI00 TXPWR SCREEN range 0 to 7 Version 5 00d UNKNOWN Added Timecode wrap at 24 hours for non jammed timecode setting using last recorded segment as TCjam Fixed serious record bug that prevented the unit from going into record if the timecode had wrapped around the 24 hour mark Version 5 00b UNKNOWN Added Special super Low Power operating mode It is triggered if LED mode LOW POWER MODE TX Format
65. ain setting Used to compensate for the gain reduction caused by the action of the compressor Dynamics comprises both a compressor and an expander which operate jointly The compressor in Dynamics can perform mild or extreme compression and features a soft knee for more transparent operation The expander in Dynamics can perform subtle or extreme noise reduction Note that the Dynamics processing is done before the existing expander which is still functional Thus the expander can be used as a stand alone noise gate while the dynamics can shape the sound as desired ADC Location page ADC INTERNAL NEL hh mmm acri his page indicates where the Analog to Digital Conversion ADC is performed Parameters e EXTERNAL AD conversion is done in the STAIOO STAI50 e INTERNAL AD conversion is done internally for use with the mic input connector Battery page BATTERY TYPE NIMH This page adjusts the algorithm used to display the remaining battery capacity LITHIUM ALKALINE NIMH Recording Mode page RECORD MODE NON LOOP RECORD his page maintains the transmitter s Recording mode Parameters 36 Zaxcom Digital Wireless System User s Manual Chapter 2 e NON LOOP RECORD Once the media has filled up recording stops and FULL is displayed This prevents over writing any portion of the audio LOOP RECORD Once the media has filled up the new audio will begin over writing th
66. alled For the TRX900 TRX900AA TRX992 TRX700 TRX800 and IFBIOO as newer firmware becomes available it can be downloaded from the Zaxcom website http lzaxcom com software up dates htm For the RX900 M S and RX4900 the unit must be returned to Zaxcom Inc to upgrade its firmware Each time a unit is powered up the firmware version number is displayed briefly on the LCD screen Upgrading the firmware in each unit By upgrading the software the range and feature set will dramatically increase over time Zaxcom has a reputation for constantly adding additional features and user suggestions during the product s lifetime This ensures that your wireless system will perform better and better the longer you own it Each unit can be programmed by downloading the program from the Zaxcom website and loading it onto a MiniSD memory card Once the program is on the card insert it into the unit Simultaneously hold down the INC and DEC keys while powering up the unit The screen will display the sequence below From power up to DONE takes about 30 seconds Upon completion cycle the power power down the unit and then power it up again to run on the new version LCD SYNTH AB PCB REV 0150 VER 4 444 03 indicates the currently installed version POUND SD CARD REV B 0150 BURN ROM TRX 4 4 bin TRX BIN indicates the firmware package being loaded ERASEO TRX bin ERASE1 TRX bin
67. ameters e IFB MIX ALL earpiece receives its audio from both the media and the IFB receiver e IFB RX AUDIO the earpiece receives its audio from the IFB receiver e REC PLAY the earpiece receives its audio from the media Lock page LOCK 5 m LOCKED 00 00 200 0 EET T m his page enables a lock function to prevent accidentally changing settings This page has a five second countdown After the timer expires the display indicates LOCKED Locking the controls prevents accidently changing settings As a safety feature while the unit is locked only the unlock combination is available Press the INC or DEC key to temporarily display the current battery voltage in place of the battery icon If you scan past the LOCK display to the next menu page the LOCK will not engage Unlocking the transmitter Simultaneously press the MENU and INC keys Once it is unlocked the screen will display the Pacifier page Powering down the unit will also clear the lock 29 Chapter 2 Zaxcom Digital Wireless System User s Manual Common Transmitter Extended Menu These menu pages contain parameters that are infrequently changed Extended Startup Sequence without any card inserted LCD SYNTH LOWER POWER MODE Optional entry only occurs if Low Power mode has been fully enabled LED X5 OFF 0 REVB 0150 REVB indicates the printed circuit board is revision VER 4 444 03 indica
68. aphics LCD True diversity single conversion digital demodulator proprietary method 518 0 to 872 0 MHz blocks are 24 to 36 MHz 100 KHz US Setting 200 KHz Euro Setting 125 KHz 500 KHz 700 KHz recommended 110 dBm 50 ohn BNC female 114 dB 0 001 24 bit 48 kHz 8 XLR 3M Mic 40 dBm Line 6 dBm 4 2 165 1 9 kg 1 75 x 19 x 7 94 44 mm x 483 mm x 202 mm 9 to 18 VDC 800 mA N A Graphics LCD 76 Zaxcom Digital Wireless System User s Manual Chapter 9 IFB100 Specifications Transmitter RF Power Output RF Modulation RF Frequency Range RF Frequency Step RF Bandwidth Channel Separation Antenna Connector Emission Designator FCC Part Transmitter Audio Dynamic range Distortion Frequency Response Highpass Filter System Group Delay Audio Input Connector Type Level Impedance ADC Bit depth ADC Sampling Rate Timecode Input Connector Level Range Impedance Physical Weight Dimensions H x W x D External Power Internal Power Display 100 mW Spread Spectrum 2 403 to 2 475 GHz 0 001 GHz MHz Digital Spread Spectrum 2 MHz 8 MHz recommended 50 ohm SMA female 180 KV2E CFR Title 47 Part 18 103 dB 0 01 20 Hz to 12 kHz Off or 30 to 220 Hz step 10 6 dB per octave 10 ms TA 5M balanced 10 to 8 dBu 10 k ohm 24 bits 48 kHz Stereo 1 8 3 5mm to 5V P P 10 k ohm 6 oz 170 3 44 x 3 88 x 9 87 mm x 98 mm x 23 mm 8 to 18 VDC
69. blue Zaxcom storage carrying case User manual on CD ROM Options o TRX90I Internal recording option Receivers What s included with the RX900 MIS e 2 SMA Whip Antennas e power connector e audio output connector RX900 S only e blue Zaxcom storage carrying case e User manual on CD ROM Options o A C power supply Zaxcom Digital Wireless System User s Manual Chapter What s included with the RX4900 A C power supply User manual on CD ROM Options o 8 dB gain passive 50 ohm log periodic Shark fin antenna IFB Remote Control Unit What s included with the 100 e 2 4 GHz SMA antenna e power connector e media slot dust plug e audio output connector e blue Zaxcom storage carrying case e User manual on CD ROM Options o A C power supply o 2 4 GHz 6 dB gain omni directional antenna Recommended for indoor or studio use where it can be placed in the center of the studio o 2 4 GHz 15 dB gain directional antenna Recommended for positioning against a wall or when a directional transmission is desired o 10 foot cable 3 meter from the IFBIOO to the 2 4 GHz antenna Chapter Zaxcom Digital Wireless System User s Manual System Features e Superb audio quality that rivals a hardwired microphone e Fault tolerant broadcast quality recording e Digital modulation wireless transmission Digital drop out protection 24 hours of audio directl
70. camera Power connector 6 Output level adjustment Timecode input connector 7 TA 5M audio input connector Screws to attach to TRX900 AA 8 Level trim for channel 2 right Electrical connectors to TRX900 AA 9 Level trim for channel 1 left Audio Timecode output connector Figure 4 1 STAI00 Front amp Back Views UAWN Installation The STAI00 attaches to the transmitter with two screws located under the Stereo Adapter label Tighten the two screws alternating between the two until the adapter and transmitter are tightly connected Connect a line level source to the TA 5M connector The line level input needs to be between 6 and 8 dBu Adjusting the Input Level Output tone from a mixer and adjust the 2 input pots so the meter on the LCD screen is at a level of 20 dBFS The stereo adapter does not have a limiter function so it is important not to overdrive or clip the input of the stereo adapter 45 Chapter 4 Zaxcom Digital Wireless System User s Manual Powering the STAIOO STA1I50 Connection of 12 VDC power to the stereo adapter is optional If no power source is connected to the STAIOO STAI50 it operates from the transmitter s internal battery Using an External Power Source When the 12 VDC input is connected to a power source it supplies power to the transmitter when its power switch is in the OFF position If batteries are installed in the transmitter and external power is connected the unit w
71. d Receiver Recorder status appears to the right of the frequency e M or S Indicates the remaining available recording time in hours minutes and finally seconds This item is only displayed if a MiniSD card is available for recording and the Recording Mode page is set to NON LOOP RECORD e RX This flag will be displayed alternately with the remaining recording available recording time if the IFBIOO is running and the TRX900 is receiving it eG Momentarily appears to the right of the RX flag when a Gain Change command is received from the 100 e R Recording buffer overrun indicator to 9 If it reaches 9 the recording will stop this means the card is too slow or has been removed MAX Occurs either when the 254 take is currently being recorded or when a card is inserted that already has 254 takes That is the maximum number of takes that can be recorded on one card no matter how large or small it is e FULL Appears to the left of the recording mode STOP when the card is full and the unit s Recording Mode page is set to Non Loop Record N Chapter 2 Zaxcom Digital Wireless System User s Manual Recording modes e STOP Recording is stopped accompanied by beep e LREC Recording is started and Loop Record mode is enabled accompanied by 2 beeps e REC Recording is started and Non Loop Record mode is enabled accompanied by 2 beeps e WAIT May appear just befor
72. d the output will appear on the left channel and when the button is pressed the audio is appears on the right channel This function will not work while the unit is in stereo Preset Frequency pages 0 to 9 p 560 0 Use these pages to store frequently used frequencies Parameters Character Valid Signal Changes from p to P when it receives a valid signal Character 2 Preset Identifier value range O to 9 step 1 identifies the preset storage Character 4 to 8 Receiver Frequency value range see Table 1 3 step 1 These characters display the currently selected frequency in MHz Use the INC or DEC key to change this frequency Between these pages 10 frequencies can be stored They appear before the lowest frequency on the Audio Receiver Frequency Select page 58 Zaxcom Digital Wireless System User s Manual Chapter 5 Common Receiver Test Menu Entering the Test Menu Power down the receiver 2 Hold down the INC amp DEC keys while powering it up The following items appear after the items in the Extended menu Exiting the Test Menu Cycle the power Security Enable page SecurOff his page enables disables the automatic creation of a random security code every time it boots up Off On This prevents the user from having to make one up every time if the user wants a really secure wireless system The user has to program this code into the associated transmitte
73. e going into record or if the card is ejected while recording Audio Gain page GAIN 20dB Eh m 0 his page adjusts the mic gain using the INC or DEC key value range O to 52 step 2 When audio is applied to the microphone input the LCD indicates the signal strength using a bar graph displayed horizontally from left to right 40 to 0 dBFS The gain should be set so that the meter is peaking between 20 and 10 dBFS This is about half way between 20 and 0 dBFS on the meter If no microphone is connected the bar graph remains blank The transmitter features a digitally controlled analog limiter that is situated before the A D converter This prevents the A D convertor from clipping by automatically attenuating the mic gain when excessive audio is detected The limiter engages before the signal exceeds the digital capabilities of the signal path The limiter activates at 6 dBFS The gain level should be set low enough to prevent it from engaging even when talent is screaming Audio Transmitter Frequency page 581 6 his page sets the audio transmitter s center frequency value range see Table 1 3 step 1 The transmitter can operate on any frequency between 518 0 and 870 0 MHz but your unit can only operate in its assigned block within this frequency range There is a one second delay while moving to a new frequency If the frequency is changed quickly the transmitter remains quie
74. e oldest audio on the card Audio Transmitter Power page TX POWER his page is available on hardware after Serial 2007 and maintains the audio transmitter s output power 10MW 25MW 5 0MW 10 0MW 100MW is optional Use the lowest power setting for a given situation to conserve battery power Boot Up Mode page BOOT UP IN NORMAL MODE actu This page maintains whether or not the unit will boot up in Normal or Standby Low Power mode Parameters e STANDBY The unit boots up in Standby mode a low power state Press the MENU key to to full power e NORMAL The unit boots up in Normal mode Mute Switch Enable page MUTE SWITCH 0 DISABLED acti IRX900 IAA ONLY This page enables disables the mute switch and assigns which direction is ON Parameters e 0 ENABLED NEGATIVE The switch is enabled and its function is reversed e 1 ENABLED POSITIVE The switch is enabled in its normal position e 0 DISABLED The switch is disabled Left Right Switch Mode page LR SWITCH MODE his page assigns a button buttons to enable a private line to the Mixer Parameters e ON ALL KEYS Press any key to activate e ON DOWN KEY Press the DEC key to activate e ON MENU KEY Press the MENU key to activate e ON UP KEY Press the INC key to activate e OFF This option is disabled Normally in mono mode the audio is sen
75. enna Signal Strength page 59 Zaxcom Digital Wireless System User s Manual 59 Receblion Error Counters 59 Signal Reception Quality Page ssscsscsscsssscnsssssssssccessnsssssnssssnceasensensencensensensensensenscoscsessnccsssnccassnceasenseusencensenscaseascanecscouccesouecasansansensencencensensenseaees 59 CHAPTER 6 IFBI00 IFB TRANSMITTER 60 GETTING TO KNOW YOUR IFB 60 gt 0 0 err 6 RGU CIA CIN NS ARE RU UEM NUI MUI SUE RM TIME 61 UNDE EET T 61 Adij stine the Input Audio T S 6l J 00 u uuu A E E ET T E E T ET A IT EEE T E E n s 6l IFB 00 Men s X 6l IFBIGUSTANDARDUIVIBNU E 62 62 Remotely Starting and Stopping the Transmitter Recorder u 62 Remote
76. er s range You should periodically check that the connector is still securely tightened RS 485 Connectors This connector is used by ZedAlpha to monitor the transmitter and receiver status Table 5 4 RX4900 RS 485 Pin outs RJ 45 52 Zaxcom Digital Wireless System User s Manual Chapter 5 RX4900 Configuration Menus There are four Standard thirteen Extended and seventeen Test menu pages as follows Standard Menu Extended Menu Test Menu q Select page Audio Rx Freq Select page Audio Rx Freq Select page q Scan page Audio Rx Freq Scan page Audio Rx Freq Scan page page Test Tone page Test Tone page EMEN Backlight On Off page Backlight On Off page BEES UO Power Saver Enable page Power Saver Enable page BEES UO Audio Reception Format page Audio Reception Format page Security Code Part O page Security Code Part 0 page _ Security Code Part bags R amp diiCemmsbibage RS 485 Comm Spd page Left Right Switch page Preset Freq pages W j UO Preset Freq pages Security Enable page x at Signal Strength page x lt x LL Hesse Error Counters page P Siral Reception Quality page Table 5 5 RX4900 Receiver Standard Extended amp Test Menus Each time the MENU key is pressed the menu advances to the next page in sequence 53 Chapter 5 Zaxcom Digital Wireless System User s Manual Common Receiver Standard Menu Pacifier page actae VVhen you power
77. er up Mode page POWER UP MODE UNLOCKED his page sets whether or not the unit will power up with the keys locked Parameters e LOCKED Only the unlock combination is available e UNLOCKED The keys function normally This page works like the Lock page The only difference is that while the unit is locked using Power up Mode every time it is powered up the keys will be locked and it will be necessary to unlock them before you can view change anything Unlocking the transmitter Simultaneously press the MENU and INC keys Once it is unlocked the screen will display the Pacifier page Media Erase amp Format page PRESO UP KEY ox LO ERASE CARD SUCCESS REBOOT MBYTES FORMAT FAILED ERROR his page erases and formats a MiniSD card This must be done before the card can be used or to erase the contents in the transmitter To Format a card Before formatting the card enter the name Transmitter Name page to be used for this card 2 With the power OFF insert the memory card into the media slot with the label to the back of the unit Press it all the way in it will lock down Press and hold the MENU key while the transmitter is powered up Repeatedly press the MENU key until the screen displays PRESS UP KEY 5X TO ERASE CARD Press the INC key 5 times displays FORMATTING FAT32 Sometime later displays ERASING SEGMENTS And finally displays SUCCESS MBYTES or FORMAT FAILED ERROR
78. ess Transmitter The TRX800 uses a single CR123 battery Uses screw on microphone capsules made by Shure and Neumann Be aware that to use a Neumann capsule a special adapter is required Check with Zaxcom Sales for price and availability This section was written based on firmware version 5 98 9 10 l 12 13 capsule 6 Battery door power switch inside 11 DEC key 2 Mic body 7 MiniSD media slot 12 INC key 3 Capsule contacts 8 Antenna connector SMA 13 LCD screen 4 Body contact pins 9 RECORD key 5 Pad switch 10 dB 10 MENU key Figure 2 5 TRX800 Side Mic Capsule Body Threaded End Body Antenna End amp Barrel Views 23 Chapter 2 Zaxcom Digital Wireless System User s Manual TRX800 Configuration Menus There are six Standard and fourteen Extended menu pages as follows Standard Menu Extended Menu Pacifier page Highpass Filter page Audio Gain page Limiter page Audio Tx Frequency page page Transport Control page Power up Mode page Timecode Frame rate page Media Erase amp Format page Lock page Timecode Output Enable page www Recording Mode page es 5 BEEN Left Right Switch Mode page MENS Transmitter Name page MEN Security Code page Table 2 5 TRX800 Standard amp Extended Menus Each time the MENU key is pressed the menu advances to the next page in sequence 24 Zaxcom Digital Wireless System User s Manual Chapter 2 Common Transmitter Standard Menu Normal Startup Sequence
79. etc Remote Power Setting Change page POWERMODE 0 POWER ON CiN lli his page modifies the power setting to be used by each remote transmitter Parameters 6 POWER LOW2 Disables the RF Power Amplifier RF Board and Mic Pre amp In most cases you want to use LOW2 if you are using the remote power setting When using the Low2 setting the TRX900 AA draws half the current as the full power setting saving battery life 5 POWER LOW1 Disables the RF Power Amplifier in remote units 4 POWER ON Filler to prevent accidentally turning Off the remote unit s power 3 POWER ON Filler to prevent accidentally turning Off the remote unit s power 2 POWER ON Filler to prevent accidentally turning Off the remote unit s power 1 POWER ON Filler to prevent accidentally turning Off the remote unit s power 0 POWER ON Turns the remote unit s power fully ON Timecode Frame rate page TIMECODE 30NDF GEN 00 00 00 00 his page sets the frame rate to be transmitted with the timecode 23 98 24 25 29 97NDF 29 97DF SONDF 30DF The IFBIOO s timecode generator is in Free Run mode unless it is connected to a timecode source If an external timecode source is connected the IFBIOO s internal timecode generator stays in sync with it Ifa TRX9xx ZFRI0OO is in Autoload mode starting and stopping recording is controlled by the external source IFB Frequency page IFB FREO 2 40
80. ew minutes before its battery is depleted Characters 7 and 8 Transmitter Information Character 7 indicates the recording status of the transmitter R or S R means it is recording and S means it is not recording stopped Character 8 indicates the transmitter battery s level of charge and ranges from 9 to O When the level reaches 0 the transmitter has at most only a few minutes before its battery will be depleted Audio Receiver Frequency Select page 581 Gum his page maintains the audio receiver s frequency MHz Parameters Character Valid Signal Changes from to C when it receives a valid signal Characters 2 to 6 Receiver Frequency value range see Table 1 3 step These characters display the currently selected frequency in MHz Use the INC or DEC key to change this frequency Characters 7 amp 8 Signal Strength 54 Zaxcom Digital Wireless System User s Manual Chapter 5 These vertical bar graphs indicate the signal strength at the left and right antennas Audio Receiver Frequency Scan page Scan5816 0 his page allows you to scan an entire block of channels and quickly choose the quietest channel to use Parameters The screen initially displays Scan1234 where 1234 is the currently selected frequency xxx x MHz Starting a Scan Press the INC key to start a scan The receiver searches every possible channel A full scan takes about 8 seconds and the recei
81. force a LCD mode change Version 5 70T 2008 11 29 Added TRX992 mute chunk in IFB audio codec when no packets are arriving Version 5 70R 2009 01 29 Changed 0 problem and some more tweaks to terminal and Trx900 c Version 5 69R 2008 11 28 Added special IQ cal mode in Terminal c Version 5 68R 2008 11 24 Changed working on RXpacket power up down feature for Version 5 67R 2008 11 22 Changed command line seems to work Version 5 66R 2008 11 21 Changed RAW RS232 in and out work at 300 baud Version 5 65R 2008 11 17 Changed forced unit in sw Version 5 64R 2008 11 15 Changed turn on PTT pin for remove this for normal units Changed forced settings for uint IFB on Group 42 etc Zaxcom Digital Wireless System User s Manual Chapter I Version 5 62g 2008 10 23 Added MUTE switch option Changed RED LED also means MUTE Changed lock screen now locks out the transport buttons as well as the INC DEC MENU buttons Added DYNAMICS screen Added theatrical mod support Fixed FORMAT CARD to fix last wrapper file size corruption Fixed removed several useless menus from IFB products Changed renamed menu item LED Reverse to Hardware Options Changed extended GAIN range from 0 38 dB to 0 52 dB Changed allow US R format with a hand held mic for new audio board mod Version 5 53 2008 07 15 Added support for high capacity SD cards 4GB and higher and more suppor
82. ge sets the unit you control when you use any of the remote control settings ALL value range O to 200 step 1 Remote Audio Frequency Change page REMOTE CH 512 0 UNIT ID 1 000 IX CH WARNING UNIT ID ALL This page sets the unit you control when you use any of the remote control settings value range see Table 1 3 step 1 The frequency range is based on the frequency range selected in TV Channel Minimum page and TV Channel Maximum page 62 Zaxcom Digital Wireless System User s Manual Chapter 6 The top example is what you should normally see The bottom example is what you see if you have selected the ALL choice for Unit Code Since it s a really BAD idea to command all transmitters to start using the same frequency this warning basically reminds you to choose a specific transmitter While you are changing the frequency on the display the command is not sent to the selected TRX9xx transmitter until you stop on a specific frequency for longer then 5 sec This prevents the TRX9xx unit from transmitting on all channels between the old and new frequencies The transmit counter bottom line right three digits will increment and an asterisk will blink for each message sent several will be sent each time you press the INC or DEC button If you are at the extreme edge of your range you may need to take additional actions to get the change to take place i e re orient your antenna have talent move closer
83. he MENU key To change the designated character position press the INC or DEC key To exit this page press the MENU key for second value range 000 to FFF step 1 Security Code Part IDI and Security Code Part 0 IDO On this page 2 three digit numbers are entered These two numbers are formed into a single six digit security code This code is your security key for this transmitter An identical code must be entered into the associated receiver for the audio to be properly decoded Enabling this function is useful when sensitive information must not be made public Standard FM wireless transmitters can be picked up using scanners and other electronic devices Unless a Zaxcom receiver is used even an uncoded transmitter signal cannot be picked up using a scanner The six digit security code provides a total of 16 777 216 possible choices If a Zaxcom receiver has been programmed with a security code it will also continue to receive an uncoded transmitter both ID 0 and set to 000 Since the receiver has to check for two possible code situations a slight performance penalty may be incurred during long range reception To avoid this it is highly recommended that both the transmitter and receiver codes be set to 000 000 uncoded when high security communication is not required 39 Chapter 2 Zaxcom Digital Wireless System User s Manual Common Transmitter Independent Operations Disable the IFB Receiver during Power up
84. he six digit security code provides a total of 16 777 216 possible choices Zaxcom receiver has been programmed with a security code it will also continue to receive an uncoded transmitter both ID 0 and IDZ set to 000 Since the receiver has to check for two possible code situations a slight performance penalty may be incurred during long range reception To avoid this it is highly recommended that both the transmitter and receiver codes be set to 000 000 uncoded when high security communication is not required Chapter 5 Zaxcom Digital Wireless System User s Manual RS 485 Unit Identifier page his page maintains the number used to uniquely identify this receiver value range O to 99 step 1 This identifier is used by a 3 party program called ZedAlpha http www orbitalsound co uk This program can monitor each receiver using RS 485 commands RS 485 Communication Speed page This page controls how fast the RS 485 signals are transferred e 192 19 200 bps 384 38 400 bps 384 is a little unreliable always use 192 Left Right Switch page his page controls or enables output switching when used with the private line communications feature of the TRX9xx amp TRX800 Parameters Off whether not the button on the transmitter is pressed the receiver will output the same audio on both channels from the transmitter e when the button is not presse
85. his page maintains the timecode source SIDE CONNECTOR Accept a timecode source connected to the side connector e IFB RF Accept a timecode source connected to the IFBI0OO e AUDIO INPUT Accept a timecode source connected to the Audio Input connector Timecode Output Enable page TIMECODE OUTPUT ORF his page enables disables timecode output and specifies the output connector Parameters e ON OUTRIGHT Sends timecode to the timecode output connection on the STAIOO e ON OUTLEFT Sends timecode to the headphone output e OFF Timecode is not output Remote Control Group ID page REMOTE CONTROL GROUP ID 1 his page identifies which IFBIOO can remotely control this transmitter value range O to 99 step 1 It is highly desirable to have all transmitters and recorders in a given group assigned to the same IFBI0OO Remote Control Unit ID page REMOTE CONTROL UNIT ID 001 his page maintains the number used to uniquely identify this transmitter 34 Zaxcom Digital Wireless System User s Manual Chapter 2 ALL value range 1 to 200 step 1 When using the IFBI0O this identifier is used to remotely control one specific unit out of the entire group This information is also useful in Post to identify the unit since it is recorded in the BWF metadata Expander page EXPANDER CIS lig Ten his page maintains the info used to expand the transmitter s dynamic range To en
86. ill not be able to power down unless an external power switch is available to remove the external power Using the STAI00 STAI50 to Power the Transmitter The adapter can be used to power the transmitter while it is in Mono mode and using a mic level input The Audio Timecode Output Connection The audio output connection is used to monitor the audio functions of its host unit or to allow timecode to pass through the STAIOO STAI50 The transmitter s output setting Timecode Output Enable page determines if audio or timecode is sent through the output Timecode Input The timecode input is used to jam the transmitter s timecode generator the auto load function Timecode Jam Mode page is enabled the timecode input of the stereo adapter can be used Operation of the STAI00 STAI50 For the stereo adapter to operate the transmitter must select the stereo setting Audio Transmission Format page and external ADC ADC Location page must be selected Host Unit functions Selecting the stereo setting causes the transmitter to combine the two input signals together and transmit them on one frequency The ADC selection INTERNAL selects the internal mic input EXTERNAL selects the stereo adapter audio Figure 4 2 STAI00 attached to TRX900AA 46 Zaxcom Digital Wireless System User s Manual Chapter 4 EAI00 IFB Earpiece Adapter Figure 4 3 100 amp EAI00 attached to TRX900 The EA100 is used for monitoring IFB audio when
87. l be necessary to unlock them before you can view change anything Unlocking the IFB100 Simultaneously press the MENU and INC keys Once it is unlocked the screen will display the Pacifier page Timecode Jam Mode page IC JAM MODE AUTO LOAD his page maintains how received timecode will be used Parameters e AUTO LOAD start and stop the transmitter s recorder when the input based on the Timecode Source page selection starts and stops e AUTO JAM jams timecode continuously based on the Timecode Source page selection e MANUAL OFF jam timecode once based on the Timecode Source page selection Timecode Source page TO SOURCE SIDE CONNECTOR his page sets the timecode source Parameters e SIDE CONNECTOR Accepts the timecode for syncing from the side connector e IFB RF Does not apply to the IFB e AUDIO INPUT Accepts the timecode for syncing from the Audio Input connector Timecode Output Enable page TIMECODE OUTPUL his page enables disables timecode output and specifies the output connector Parameters e ON OUTRIGHT Sends timecode to the timecode output connection on the side e ON OUTLEFT Notcurrently used for future expansion e OFF Timecode is not output Remote Control Group ID page CONTROL GROUP CODE 1 actis his page sets the Group ID for this IFBIOO value range O to 99 step 1 To use the remote control functi
88. less System User s Manual Getting to Chapter 6 IFBI00 IFB Transmitter This chapter is intended to quickly familiarize you with the functions of the Zaxcom IFB100 IFB transmitter and was written based on firmware version 5 98 Know Your IFB Transmitter It is a 100 mW RF transmitter designed to be used with the Zaxcom Digital wireless system The IFBIOO uses a digital spread spectrum signal to send and receive IFB audio timecode and remote control signals By using spread spectrum technology the IFB is immune from interference IFB audio has a range of approximately 150 feet timecode and remote control commands have a range of approximately 500 feet In locations where multiple IFBIOO units are used you can set each TRX9xx ZFRI xx to a specific IFBIOO unit The IFBIOO contains a simple menu driven interface with minimal physical keys and connectors 2 3 4 5 6 7 4 13 Antenna connector SMA 9 Timecode input connector 1 8 stereo 2 Power LED 10 Audio timecode output connector 1 8 stereo 3 MiniSD media slot Output level adjustment for audio timecode 4 LCD screen output connector 5 INC key 12 Audio input connector TA 5M 6 DEC key 13 Left IFB audio input trim 7 MENU key 14 Right IFB audio input trim 8 External power input 8 to 18 VDC Figure 6 1 100 Front amp Side Views 60 Zaxcom Digital Wireless System User s Manual Chapter 6 Setting the 100 This section describe
89. me rates Timecode Type IFB Receiver optional RF Frequency Range RF Frequency Step RF Bandwidth Channel Separation Sensitivity DAC Bit depth DAC Rate Frequency Response Output Impedance Physical Weight Dimensions H x W x D External Power 100 Internal Power Battery Display 10 25 50 mW Software selectable proprietary method 518 0 to 872 0 MHz blocks are 24 to 36 MHz 100 KHz US Setting 200 KHz Euro Setting 125 KHz 500 KHz 700 KHz recommended 50 ohm SSMA female 180 KV2E 74 86 106 dB 0 001 Mode 0 20 Hz to 16 kHz T amp M Model 0 2 Hz to 16 kHz Off or 30 to 220 Hz step 10 6 dB per octave US Mono mode 3 6 ms Euro mode 6 ms Stereo mode 6 ms 3 3 VDC 3 pin micro LEMO mic side FGB 00 303 CLAD 22 60 to 30 dBu 4 7 k ohms 24 bits 48 kHz MiniSD card Flash memory ZAX 24 hours with a 4 GB card 23 98 24 25 29 97NDF 29 97DF 30NDF 30DF SMPTE 2 403 to 2 475 GHz 0 001 GHz MHz Digital Spread Spectrum 2 MHz 8 MHz recommended 96 dBm 24 bit 48 kHz 20 Hz to 12 kHz 8 ohm minimum TRX900 4 0 oz 113 grams with battery TRX900AA 4 0 113 grams with battery TRX900 2 3 x 2 3 x 65 58 mm x 58 mm x 17 mm TRX900AA 3 38 x 2 3 x 65 85 mm x 58 mm x 17 mm 9 to 18 VDC 125 mA TRX900 up to 5 hours one CRI 23 TRX900AA up to 10 hours two AA Graphics LCD 72 Zaxcom Digital Wireless System User s Manual Cha
90. n must not be made public Standard FM wireless transmitters can be picked up using scanners and other electronic devices Unless a Zaxcom receiver is used even an uncoded transmitter signal cannot be picked up using a scanner The six digit security code provides a total of 16 777 216 possible choices If a Zaxcom receiver has been programmed with a security code it will also continue to receive an uncoded transmitter both ID 0 and set to 000 Since the receiver has to check for two possible code situations a slight performance penalty may be incurred during long range reception To avoid this it is highly recommended that both the transmitter and receiver codes be set to 000 000 uncoded when high security communication is not required Security Code Part page ID1 000 his page maintains the left half of the security code value range 000 to FFF step 1 This three digit number and the one entered in the Security Code Part 0 page are formed into a single six digit security code This code is your security key for this receiver An identical code must be entered into the associated transmitter for the audio to be properly decoded Enabling this function is useful when sensitive information must not be made public Standard FM wireless transmitters can be picked up using scanners and other electronic devices Unless a Zaxcom receiver is used even an uncoded transmitter signal cannot be picked up using a scanner T
91. n rom82 2009 01 15 Changed contrast from 50 to 30 not so dark any more Version rom82 and rom77 2009 01 10 Added LRswitch option for handheld use TRX v5 73 Version 81 2009 01 10 Added LRSwitch mode DO NOT USE WITH STEREO MODE When used with TRX version 5 86 and higher holding a user selectable button on the transmitter causes the receiver s audio to move from the left channel to the right channel This is useful for times when the talent wants to say something private to the sound mixer without the audio being heard by an audience Version rom80 2008 12 04 Added new LCD module support this version no longer supports the old LCD Version rom076 2007 08 22 Changed disable modulation when writing to ROM to fix timing problem while decoding Stereo Version rom075 2007 08 22 Added ROM readback check re writes if ROM is not correct Added extra delay before readback Version rom074 2007 08 17 Added 3rd copy that is only changed in ext menu Removed RAPMARMS2 copy Version rom073 UNKNOWN Changed if corrupt block info default to wide open unit Changed re read ROM if bad chksum on boot Changed reset both idcodes if one is bad Changed increased factory menu entry key sequence timeout Version 071 2007 07 24 Added spare ROM copy update mechanism Changed use chksum for real to determine which table to load Changed copy is updated 10 seconds after Ist copy Changed increased delay time f
92. nable PaCo MOM 66 Remote Control Group ID page u u u uu u u uu u 66 Remote Control Unit ID Pre D aRi 67 IF B Transimitt r PoOWer DODE 67 TV Channel Minimum 67 TV Channel Maximum Dag ETE 67 IEB TOO INDEPENDENT OPERATION c 67 Disable the IFB Transmitter during POWer ub L a ananassa desaueaticeerentanandaveasdtindaneadistscd 67 Display a Detailed Startup Sequence u uuu u uuu u u u 68 Detailed Startup Sequence without any card inserted u 68 Detailed Startup Sequence with a formatted card inserted u 68 CHAPTER 7 ZEDALPHA DIGITAL WIRELESS MONITORING SOFTWARE 69 CHAPTERS ZAXCONVERT UTILITY uuu l voe ue peu e eye aa ess FERE STE VETE Sea E PER E essa versa areae 70 ABOUT ZAX 70 U INE ZAX CONVER 70
93. ng 2MHz apart from each other If a receiver has voting turned ON and it loses its IFB signal it will try to acquire an IFB signal a channel that is 2MHz higher than its current RX frequency For example set the IFB to receive on 2 403GHz and set up two IFB transmitters far apart from each other one at 2 403GHz and one at 2 405 GHz The receiver s will switch from one channel to the other if the IFB signal degrades This feature dramatically increases the IFB range when using two or more IFB transmitters Added Safe Boot Mode feature If the unit crashes after boot and the battery is OK hold the MENU and DEC keys while powering up This will turn OFF the IFB An older unit may crash if IFB and STEREO are both enabled There is a modification to the power supply board that will fix this 85 Chapter I Zaxcom Digital Wireless System User s Manual RX Software History Software Version example 076 last 2 digits are the rom number I E 76 prefix code normal receiver both mono and stereo 2xx European channel scheme Axx European channels with BATTERY METER ACTIVE 8xx battery meter active Lift pin 6 of UI4 for this to work Fxx all menu screens active all the time debug Version rom83 and rom78 2009 01 21 Fixed LRswitch stereo problem LRswitch mode is now properly disabled when stereo is turned on Changed inverted LRswitch bit polarity so it now defaults to OFF Versio
94. not sold to you as new Additional Limitations on Warranty Zaxcom s warranty does not cover Product which has been received improperly packaged altered or physically abused 99
95. nual TRX992 Configuration Menus There are seven Standard and twenty five Extended menu pages as follows Standard Menu Extended Menu Pacifier page Highpass Filter page Audio Gain page Limiter page Audio Tx Frequency page page Transport Control page IFB Format page Timecode Frame rate page IFB Rx Enable page Earpiece Source page IFB Voting Enable page Lock page IFB Frequency page Power up Mode page BEEN Media Erase amp Format page DM Timecode Jam Mode page Timecode Source page xl Tinecode Enti pags xl Remote Conrol Grup D pase MN Remote Control Unit ID page MEE ADC Location page WW s Recording Mode page Audio Tx Power page es 5 w Kms Mute Switch Enable page Left Right Switch Mode page Ww w ss Transmitter Name page Security Code page Table 2 3 TRX992 Standard amp Extended Menus Each time the MENU key is pressed the menu advances to the next page in sequence 20 Zaxcom Digital Wireless System User s Manual Chapter 2 Getting to Know Your TRX700 Plug on Transmitter The TRX70O uses two AA type batteries Lithium or NiMH It includes a switch on the side of the case to turn ON OFF the 48 VDC phantom power There is a MiniSD slot behind the battery cover which is used to update the Operating System and to record audio This section was written based on firmware version 5 98 2 3 4 5 6 l 12 LCD screen 7 Battery compartmen
96. om line contains the count of recording segments on the currently installed card 28 Zaxcom Digital Wireless System User s Manual Chapter 2 The transport control page changes based on whether the transmitter is in Play mode Stop mode or is displaying the current timecode information Enter the Transport Control page Repeatedly press the MENU key until the transport status is shown on the left side of the LCD The current transport timecode is displayed while in the transport control page Stop mode playback Pressing the DEC key places the transmitter in Stop mode While in Stop mode the playback pointer can be moved backward by pressing the DEC key Play mode playback Pressing the INC key places the transmitter in Play mode While in Play mode the playback pointer can be moved forward by pressing the INC key The current playback timecode is displayed in the transport control page Exiting the Transport Control page Pressing the MENU key returns the transmitter to Record mode at the last recorded location on the media Timecode Frame rate page TIMECODE 30NDF GEN 00 00 00 00 his page sets the frame rate used to record audio on the inserted MiniSD card and displays the timecode as it is being recorded 23 98 24 25 29 97NDF 29 97DF 30NDF 30DF Earpiece Source page TRX9xx only IFB EARPIECE IFB RX AUDIO This page establishes the source for the audio being monitored during operation Par
97. on a group code must be selected If it has not been selected the IFB 100 remote control is not enabled When setting the group code be sure it is unique This is very important when multiple wireless groups are in the same area since any IFBIOO on the same group code as yours can affect your TRX9xx ZFR xx units To avoid this coordinate with others in the area and ensure everybody is on a separate group code Once the group code is set multiple TRX9xx ZFRI xx units can be controlled remotely 66 Zaxcom Digital Wireless System User s Manual Chapter 6 Remote Control Unit ID page CONTROL UNIT ID 001 his page maintains the number used to uniquely identify this transmitter ALL value range 1 to 200 step 1 When using the IFBI0O this identifier is used to remotely control one specific unit out of the entire group This information is also useful in Post to identify the unit since it is recorded in the BWF metadata IFB Transmitter Power page IEB IX POWER 7 his page sets the IFB transmitter power output value range 7 to O step 1 7 is full power Use the lowest power setting for a given situation to conserve battery power TV Channel Minimum page MIN FREQ 560 0 MIN 29 his page maintains the frequency scan s starting channel value range 16 to 99 step 1 It should be the same as the start of the unit s block TV Channel Maximum page MAX FREQ 590
98. osened jam requirements Version 5 20 2008 03 07 Added Higher resolution transmit waveform to increase TX range Version 5 19 2008 02 29 Added Timecode display in LOCK screen Added Timecode debug codes to screen Fixed 23 24 25 fps TC reader problems Fixed name initialization was always NLD by default now it s Version 5 17 2008 02 18 Fixed Timecode problem with 23 98 24 and 25fps timecode This was causing autoload to trigger several times a take This version should be used in an IFB transmitter if using the wireless autoload feature 83 Chapter 11 Zaxcom Digital Wireless System User s Manual Version 5 13 2007 12 18 Added Low battery warning text on PACIFIER screen Added EXPANDER screen experimental version Added BATTERY TYPE screen LITHIUM ALKALINE and NIMH NIMH needs some tweaking Added Voltage display in PACIFIER screen press INC key Added 500ms delay in AUDIO GAIN screen to prevent accidental gain change when leaving the LOCK screen Added Support for Non Loop Record mode Added FULL message to PACIFIER screen for Non Loop Record mode Changed LOCK screen to prevent unintended GAIN changes Fixed Left right audio channel swap problem effected only some units Modified IFBIOO TXPWR screen to Extended Menu to adjust transmitter output power Version 5 04 2007 11 12 Fixed Stereo TONE transmit problem since 5 02 Version 5 03 2007 11 09 Added Accurate volt
99. ous section 49 Chapter 5 Zaxcom Digital Wireless System User s Manual Audio Output Connector The XLR connector provides the receiver s output stereo receiver has an XLR 5M connector the mono receiver has an XLR 3M connector You can select either line level or mic level output using the switches on the rear of the receiver In the MIC position the output level is 42 dB In the LINE position the output level is 2 Ground Ground 2 Left Channel dB There is 20 dB of system headroom Mono Left Channel Right Channel EE Right Channel Table 5 1 RX900 MIS Audio Pin outs Antenna Connectors The front of the receiver has two SMA connectors intended to connect to external 50 ohm log periodic Shark fin or whip antennas For best performance keep any transmitters at least 3 feet meter away from the antennas This is because strong radio frequency sources reduce the receiver s sensitivity The receiver is optimized for properly tuned external log periodic antennas When whip antennas are used there is a noticeable reduction in the receiver s range You should periodically check that the connector is still securely tightened RX900 MIS Configuration Menus There are four Standard thirteen Extended and seventeen Test menu pages as follows Standard Menu Extended Menu Test Menu Audio Rx Freq Select page Audio Rx Freq Select page Audio Rx Freq Select page Audio Rx Freq Scan page Audio Rx F
100. ower level audio level meter and remote transport control status ii REMOTE GAIN Remote Audio Gain Change page UP increases gain DOWN decreases gain 1i REMOTE CONTROL UNIT ID Remote Unit ID page LALL value range 0 to 200 step 1 iv REMOTE Remote Audio Frequency Change page value range 512 0 to 752 0 MHZ step 1 v REMOTE POWERMODE _ Remote Power Setting Change page 10 POWER ON 1 POWER ON 2 POWER ON 3 POWER ON 4 POWERZON 5 POWER LOW 1 6 POWER ZLOW2 vi TIMECODE _ Timecode Frame rate page 23 98 24 25 29 97 NDF 29 97 DF 30 NDF 30 DF vii IFB FREQ IFB Frequency page value range 2 403 to 2 475 GHz step 001 viii IFB INPUT MIX IFB Input Mix page MONO MIX LEFT ONLY RIGHT ONLY J ix LOCK Lock page 5 sec countdown once entered To unlock simultaneously press MENU amp UP keys Extended Menu to reach these turn off the RX and hold the MENU key down while powering up Displays EXTENDED MENU PRESS UP TO EXIT i HIGH PASS _ High Pass Filter page value 30 to 220 Hz step 101 LIMITER _ Limiter page OFF ON ii IFB FORMAT IFB Format page LHI Q LOW Q iv FREQ IFB Frequency page value range 2 403 to 2 475 GHz step 001 97 Chapter 12 Zaxcom Digital Wireless System User s Manual V V1 Vil Vill 1X xiii P
101. oz 232g Capsule example 3 0 x 3 0 76mmx 76mm 490z 139g o RX900 M S 1 25 x 3 25 x 525 32mm x 83mm x 133mm 4 00z Ilg o RX4900 1 75 x 19 0 x 7 994 44mm x 483 mm x 202mm 4 2 165 l 9kg o IFBIOO 3 44 x 3 88 x 09 87mmx 99 23mm 6 0 02 170g Zaxcom Digital Wireless System User s Manual Chapter Menu System The user interface for each unit consists of a Liquid Crystal Display with 3 keys as follows e MENU Menu page function select press once to move to the next menu page e INC up arrow Increment the current parameter selected by the MENU key e DEC down arrow Decrement the current parameter selected by the MENU key Each menu has several pages allowing you to change configuration settings All of these settings are stored in Flash ROM immediately after making the change Figure 1 1 TRX900 Front View Media Some of the units read from and or record to a MiniSD card which is inserted into the MinisD media slot All of the transmitters use a MiniSD card to update the unit s firmware To be safe you must use approved media SDSDM 2048 A10M SDSDM 2048 Bulk NO NO TS2GSDM80 No TS4GSDM80 NO Table l I Approved vs Unapproved Media Chapter Zaxcom Digital Wireless System User s Manual Microphones Compatible Lavs Use one of the following microphone models Brand Mode Voltage Noes FCouneryman
102. p Removed IFB100 amp ZFRxxx LR SWITCH MODE screen Removed IFBIOO NAME display during bootup Version 5 92 UNKNOWN Added Changed Card reformat to the MEDIA ERASE amp FORMAT screen 9 DEC key presses Version 5 89 2009 01 27 Changed IFBIOO hardcoded the previously updatable record status preventing the display of LREC to prevent confusion Changed Disallow record mode screen if the record option is not installed Added IFBI00 TVCH MAX amp TYCH MIN screens to Extended menu to support the REMOTE FREQUENCY CHANGE screen Changed IFBIOO amp TYCH MIN screens display the frequency as well as the existing TV channel Changed Increased size of RECFIFO buffer Removed TRX700 IFB EARPIECE SOURCE screen Removed IFBIOO IFB INPUT MIX screen Version 5 88 2009 01 26 Added Changed TRX992 VPX battery formula TRX992 swapped IFB mixer knob rotation to match the silk screen Version 5 87 2009 01 25 Deleted Deleted remnants of BlownPA detector ICAL QCAL and DIAMOND screens from factory menu Version 5 86T UNKNOWN Changed Changed HeadPhone Beep tones are now SUMMED into HP location of channel changer in RX INT handler glFBSlotTimer Version 5 85T 2009 01 22 Added Added 500Hz headphone to LRSWitch mode tone64 Version 5 84T 2009 01 22 Changed TRX900 text to TRX992 Version 5 83 2009 01 21 Added TRX900 amp TRX800 LRswitch
103. pter 9 TRX992 Specifications Transmitter RF Power Output RF Modulation RF Frequency Range RF Frequency Step RF Bandwidth Channel Separation Antenna Connector Emission Designator FCC Part Transmitter Audio Dynamic Range Distortion Frequency Response Highpass Filter System Group Delay Mic Power Mic Connector Input Range Impedance ADC Bit depth ADC Sampling Rate Recording Media File Format Recording Time Timecode Frame rates Timecode Type IFB Receiver RF Frequency Range RF Frequency Step RF Bandwidth Channel Separation Sensitivity DAC Bit depth DAC Rate Frequency Response Output Impedance Physical Weight Dimensions H x W x D External Power Internal Power Display I0 25 50 100 mW Software selectable proprietary method 518 0 to 872 0 MHz blocks are 24 to 36 MHz I00 KHz US Setting 200 KHz Euro Setting 125 KHz 500 KHz 700 KHz recommended 50 ohm SMA female 180 KV2E 74 86 106 dB 0 001 Mode 0 20 Hz to 16 kHz T amp M Model 0 2 Hz to 16 kHz Off or 30 to 220 Hz step 10 6 dB per octave US Mono mode 3 6 ms Euro mode 6 ms Stereo mode 6 ms 48 VDC Phantom balanced 10 mA max XLR 3F Line level 10 to 4 dBu Mic level 60 to 30 dBu Line level 6 2 k ohms Mic level 4 6 k ohms 24 bits 48 kHz MiniSD card Flash memory ZAX 24 hours with a 4 GB card 23 98 24 25 29 97NDF 29 97DF 30NDF 30DF SMPTE 2 403 to 2 475 GHz 0
104. r As always the receiver will continue to work with a transmitter that is set to 000 000 Antenna Signal Strength page a00 500 his page is used to diagnose antenna connection problems It displays the signal strength of each antenna in dB Under normal circumstances they should be approximately the same number VCO page his page is used to tune and debug the receiver s RF voltage controlled oscillator It should be about 1 5 volts while receiving a valid signal The meter s range is O to 3 3 volts Reception Error Counters page Ea000000 his page displays the reception error counters The first three digits are the errors detected from antenna A the last 3 digits are those from antenna B The single letter character 2 increments every time both channel and channel B have an error on the same block of audio If the letter increments both channels had a problem with that block and the audio was received damaged If the letter does not increment the audio is being received without errors Signal Reception Quality page This page displays how well the signal is being received The first two numbers represent the signal quality for channels A amp B as do the 2 meters The letter V cycles through the alphabet whenever an uncorrectable audio error has occurred The other 2 digits each increment when an error has occured on channel A or B respectively 59 Chapter 6 Zaxcom Digital Wire
105. r Included is an antenna cut to the correct length for your transmitter s specific frequency block You should periodically check that the connector is still securely tightened Mix Ratio This fader controls the ratio between the audio coming directly from the mic and audio coming from the IFB feed and is enabled when you set IFB Earpiece Source page to IFB MIX ALL Headphone Fader This fader controls the volume level to the 1 8 headphone jack When first putting your headphones be sure to turn OFF full counter clockwise the headphone volume Power Switch This switch is not as low profile as those on the TRX900 AA Since this unit is not being used on talent it should not be a problem Battery The VPX battery slides in to the battery opening in the bottom of the unit Be sure to press it in far enough that it clicks locks in place To remove the battery press the red edge inward and gently pull the battery out Phantom Power Switch amp Mic Line Switch See Fig 2 3 to get your bearings Looking inside the opening for the battery behind the XLR 3F you will see a red base and two black switches sticking up from it The closest switch is for phantom power Pushing it away from the bottom is ON The farthest switch is for Mic Line level selection The closest position is for Line level E Mic Line in Switch Phantom Power Figure 2 3 Internal Switches Location Chapter 2 Zaxcom Digital Wireless System User s Ma
106. r s Manual Chapter 12 xxv 1 IDO Security Code page each value range 000 to FFF step 1 unless necessary use 000 RECORDING TO THE MINISD CARD 1 Format the card 1 With the power off insert the card into the slot 2 Hold the MENU key while powering up 3 Once up release the MENU key 4 Press the MENU key repeatedly until PRESS UP KEY 5X appears 5 Press the UP key 5 times to erase and format the card 6 The display indicates it progress 7 Wait for successful completion before using If it fails do not use it to record in TRX900 1i Record to card Turn OFF the transmitter 2 Insert the MiniSD card 3 Turn ON the transmitter The unit will go into Record mode after the initialization process has completed INSTALLING A NEW OPERATING SYSTEM i Copy the program to a MiniSD card ii Insert the card into the media slot iii Simultaneously press the UP amp DOWN keys while powering up the unit iv Unit displays BurningROM Process takes 20 seconds v Once Done is displayed cycle the power to run on the new version SAFE BOOT MODE Simultaneously press the MENU and DOWN keys while powering up 91 Chapter 12 Zaxcom Digital Wireless System User s Manual Menu Sheet for TRX700 TRX800 MENU SETTINGS Standard Menu i Pacifier page Displays transmit frequency remaining battery capacity available recording time recording mode audio input level and recording buffer overrun GA
107. req Scan page Audio Rx Freq Scan page Test Tone page Test Tone page tein ner Backlight On Off page Backlight On Off page 2 Code Part 0 page Security Code Part 0 page ss Security Code Part page Security Code Part page s LE RS 485 Unit ID page RS 485 Unit ID page ww_ U W UO RD Switch page Preset Freq pages Preset Freq pages Security Enable page Table 5 2 RX900 MIS Receiver Standard Extended amp Test Menus Each time the MENU key is pressed the menu advances to the next page in sequence 50 Zaxcom Digital Wireless System User s Manual Chapter 5 Getting to know your RX4900 Diversity Receiver RF IN RF OUT RIGHT RXI TE m 4 N 4 x9 LI LI 4 LI 4 _ RIGHT be 7 gt 1 4 Menden Wet 6 7 8 9 10 l 12 13 3 HEADPHONE MIX MONO VOLUME RX1 RX2 RX3 RX4 STEREO 14 15 16 7 18 19 20 21 22 23 24 25 26 Stereo Receiver 1 10 12 19 Receiver Power Switch 2 Stereo Receiver 2 Receiver 2 Left amp Right Audio 20 Receiver 1 Monitor Switch 3 Common Controls 12 Receiver 1 Left amp Right Audio 2 Receiver 2 Monitor Switch 4 Stereo Receiver 3 3 Receiver Left Antenna Loop Thru 22 Receiver 3 Monitor Switch 5 Stereo Receiver 4 14 DEC key 23 Receiver 4 Monitor Switch 6 Receiver Right
108. rom 200 to 300 for UpdateRom calls Version rom070 2007 05 09 Added channel presets to non EUchannel software Changed FREQUENCY SCAN screen to use full MHZ display Removed 3 digit goldline style channel screen 86 Zaxcom Digital Wireless System User s Manual Chapter I Version rom069 2007 03 09 Added TPmode display support from TRX900 s Version rom068 2007 02 05 Removed voting option so RxNum 31 is now usefull Version rom067 2006 11 31 Added RO ERR display in init sci rs485 Version rom066 2006 11 27 Added tuner readback error display in init tuner Version rom064 2006 09 1 Added 5485 support for RX4900 s Version rom062 2006 07 24 Changed moved TONE screen to main menu Version 061 2006 05 09 Added Security mode option random IDcodes on boot Version rom060 2005 05 16 Changed increased contrast setting to 8f was 84 Version rom059 2004 12 20 Added battery ADC routines version 859 Version rom058 2004 06 14 Added re added power save mode Changed slowed down DSP during power saver Added menu in debug screens Version rom057 2004 05 20 Added more VCO feedback loop gain and limited symbol offset in vco to 3 symbols Version rom056 2004 05 07 Fixed pointer Version rom055 2004 04 26 Added FREQUENCY SCAN screen see disp asm Changed limited VCO some more during no TX condition Version rom054 2004 04 13 Added wait for LRCLK to prevent sample s
109. s implemented in the digital domain the automatic limiter may engage even when you don t hear any substantial audio The purpose of the limiter is to prevent the mic preamp connected to the TA 5M from over driving the A D converter so the limiter operates on audio before it has been processed by the highpass filter If there is a massive amount of low frequency audio content being filtered out such as wind noise you may hear the effects of the limiter without hearing the audio that caused the limiter to engage If this occurs the gain is set too high and you must reduce it to below the level that triggers the limiter IFB Format page FORMAT LOW Q his page controls the quality of the transmitted IFB signal Parameters LOW Q Selects the standard quality codec HI Q Selects the high quality codec IFB Frequency page IFB 2 4205 his page sets the band the IFB transmitter uses value range 2 403 to 2 475 GHz step 0 001 Power up Mode page POWER UP MODE UNLOCKED actu his page whether the keys will be consistently locked after powered up e LOCKED Only the unlock combination is available e UNLOCKED The keys function normally 65 Chapter 6 Zaxcom Digital Wireless System User s Manual This page works like the Lock page The only difference is that while the unit is locked using Power up Mode every time it is powered up the keys will be locked and it wil
110. s setting up the IFBIOO for the first time Power Requirements The IFBIOO requires an external power source 8 to 18 VDC Ideally the source should be 12 VDC Normal current draw is 125 mA at 12 VDC but a power supply needs to be capable of supplying at least amp Audio Input The two channel balanced audio input on the IFBIOO has a TA 5M connector The input audio range is 8 dBu to 4 dBu You can configure the IFBIOO to transmit a single channel or a mix of the two input channels Adjusting the Input Audio Level The input audio level is preset by Zaxcom at 4 dBu However this level can be adjusted using the trim pots located on the outside of the unit See the Side View in Fig 6 1 Timecode Unless an external timecode source is present the IFBIOO outputs free run timecode When connected to an external timecode source the timecode generator syncs with it 00 Configuration Menus The IFBIOO uses a series of menus for configuration These menus are similar to other Zaxcom wireless devices and behave in a similar fashion There are nine Standard and thirteen Extended menu pages as follows Standard Menu Extended Menu Pacifier page Highpass Filter page Remote Unit ID page IFB Format page Remote Audio Freq Chg page IFB Frequency page Remote Power Setting page Power up Mode page Timecode Frame rate page Timecode Jam Mode page IFB Frequency page Timecode Source page IFB Input Mix page Timecode Output Enable page
111. smitter and tune it to this channel 4 Place the transmitter at least 20 feet 6 meters away from the scanning receiver 5 Perform another pair of scans Since the most recently selected frequency is now occupied the next receiver to perform a scan finds the next quietest frequency Repeat this procedure for each additional transmitter This procedure assumes that all of the transmitters will be operating in the same block 55 Chapter 5 Zaxcom Digital Wireless System User s Manual Test Tone page Tone Off his page allows the operator to generate a kHz test tone Off OdB 20 The tone amplitude is 0 dB This is 20 dBFS However you can change the tone amplitude using the INC and DEC keys When you exit this page the tone is automatically disabled Common Receiver Extended Menu Entering Extended Menu Power down the receiver 2 Hold down the MENU key while powering it up The following items appear after the items in the Standard menu Exiting the Extended Menu Cycle the power Backlight On Off page Lite Off his page controls the display s backlight Off On Power Saver Enable page PsaveOff his page enables disables Power Saver mode Off On The receiver draws 2 A at 12 VDC so it must dissipate 2 4 watts of heat It must have some ventilation even at this low level When using multiple receivers in a sound bag without ventilation you may encounter
112. t Battery cover 8 MiniSD media slot shown w card Battery cover retention screw 9 MENU key INC key 10 Phantom On Off on bottom DEC key Power switch Microphone connector XLR 3F 12 Antenna connector SMA Figure 2 4 TRX700 Front amp Top End Views Connectors Switches and LEDs Antenna The transmitter uses a gold plated SSMA connector Included is an antenna cut to the correct length for your transmitter s specific frequency block You should periodically check that the connector is still securely tightened 21 Chapter 2 Zaxcom Digital Wireless System User s Manual TRX700 Configuration Menus There are six Standard and nineteen Extended menu pages as follows Standard Menu Extended Menu Pacifier page Highpass Filter page Audio Gain page Limiter page Audio Tx Frequency page page Transport Control page Power up Mode page Timecode Frame rate page Media Erase amp Format page Lock page Timecode Jam Mode page Timecode Source page Ww Timecode Output Enable page ADC Location page SJ Recording Mode page MN Audio Tx Power page 5 Boot up Mode page BEEN Mute Switch Enable page Left Right Switch Mode page BEEN Transmitter Name page Security Code page Table 2 4 TRX700 Standard amp Extended Menus Each time the MENU key is pressed the menu advances to the next page in sequence 22 Zaxcom Digital Wireless System User s Manual Chapter 2 Getting to Know Your TRX800 Handheld Wirel
113. t for other smaller cards This change could possibly cause some older cards to stop working If you upgrade to this version and find that your brand of SD card no longer works you may need to use another brand of SD card to downgrade to an older version Version 5 51 2008 05 21 Fixed recent IFB jam bug could cause timecode to stop Version 5 50 UNKNOWN Changed re wrote IFB audio codec sounds less crunchy Starting with this version s firmware the IFB audio transmission format has changed To maintain IFB audio compatibility both the IFB transmitter s and the audio transmitter s must be loaded with this version or higher Version 5 36a 2008 05 13 Changed Reversed cursor direction in the OPT and IDCODES screens Fixed bug OPT screen Version 5 34a 2008 04 23 Added IFBIOO always allow IFB POWER SELECTION screen in the Extended Menu Disabled 1 100 EXPANDER IDCODES screens Version 5 33c 2008 04 2 Added TIMECODE OUTPUT ENABLE screen Added New user power level settings for high power RF boards Moved EXPANDER screen to bottom of extended menu Added TRX990 separate Left and Right gain setting Fixed TRX990 a new gain problem in Mono mode Changed TRX990 GAIN L to Changed TRX990 GAIN R to GAIN 2 Fixed IFBIOO IFB power setting to work above power level 3 Version 5 33b UNKNOWN Fixed Reader no longer jams on seconds boundary Version 5 333 UNKNOWN Changed Lo
114. t to the left channel of a stereo receiver Pressing the key assigned by this page sends the audio to the right channel only for as long as the key is pressed In addition if the individual is listening to the IFB connection a low frequency tone is added to indicate that they are on the private line 37 Zaxcom Digital Wireless System User s Manual Chapter 2 Transmitter Name page NAME FREDERIC t his page maintains the name applied to the MiniSD card and to the audio s metadata To move to the next character momentarily press the MENU key To change the designated character position press the INC or DEC key To exit this page press the MENU key for second max 8 chars char O to 9 space A to Z The name entered into the transmitter becomes part of the name of the audio files generated by the unit and is also included in the metadata of the BWF file When powered up this name appears in the transmitter s screen after several seconds To set change the name do the following Press the INC or DEC key to change the character in the current position 2 Press the MENU key to proceed to the next character 3 When finished press and hold the MENU key to leave this function or cycle the power to resume normal operation Security Code page ID1 000 1 0 000 1 his page maintains the code used to encrypt the audio transmitted to the receiver To move to the next character momentarily press t
115. t until the desired frequency has been selected When operating multiple transmitters in the same area it is recommended that you use at least MHz separation between radios If audio frequencies are difficult to obtain the minimum spacing can be as low as 0 6 MHz while using US modulation or 0 5 MHz while using European modulation Using a large frequency separation between each transmitter aids in their clear reception Maintaining a distance of 20 feet or more between transmitter and receiver also aids in reception when several transmitters are used at the same time This will prevent any transmitter from de sensing any of the receivers Frequency planning programs which are used to prevent intermodulation problems are not needed when using the Zaxcom Digital Wireless system However if regular FM wireless mics are being used near the Zaxcom system you must plan your frequency assignments to prevent intermodulation When two FM transmitters come close to each other they can produce interference on adjacent frequencies Since this interference is transmitted over the air there is no way for a Zaxcom receiver to reject it However Zaxcom transmitters do not suffer from this problem Transport Control page STOP 00700700700 000 his page allows the operator to review the recorded audio The top line left hand side displays the current mode REC PLAY or STOP The right side contains the timecode based on the current mode The bott
116. tches up with 2 ST on the receiver e EUROPEAN This setting transmits in Wideband Mono mode This mode is recommended for European customers or countries where 120 kHz channel bandwidth is legal matches up with I EU on the receiver e US MONO This setting transmits in Wideband Mono mode This mode is recommended for US customers or other countries where a 200 kHz channel bandwidth is legal matches up with 0 US on the receiver IMPORTANT Any change made to this page requires a reboot before the new setting will take effect 3l Chapter 2 Zaxcom Digital Wireless System User s Manual NOTE If the Transmission Format here and the Reception Format the associated receiver do not match the receiver will be unable to correctly decode the audio from this transmitter IFB Format page FB FORMAT LOW Q RXIxx ONLY This page controls the quality of the received IFB signal Parameters LOW Q enables reception of timecode remote control signals and IFB audio if the unit is so equipped e HI Q enables high quality audio and disables timecode and remote control reception while still allowing local recording IMPORTANT All units MUST be using the same format to function correctly IFB Enable page RXMODE RX RXED BLOCKS 000 his page enables disables the IFB receiver OFF RX Disabling the IFB receiver will reduce power consumption by 20 mA and increase battery run time by 10 IFB
117. ter this page press the INC or DEC key To move to the next parameter momentarily press the MENU key To exit this page press the MENU key for second Factory Setting PARMS OFF ON OFF RATIO value range 1 1 01101 4 00 step 01 1 1 30 THRESH value range 0 to 9 6dB step 1 40dB REDUCE value range 0 to 36dB step 1 6dB SPEED SLOW NORMAL FAST SLOW Dynamics page DYNAMICS ADVANCED USERS ONLY This page controls a compressor effect that will decrease the gain of loud passages To enter this page press the INC or DEC key To move to the next parameter momentarily press the MENU key To exit this page press the MENU key for second Factory Setting PARMS OFF ON OFF SIDECHAIN IN LP1 LP2 HF B IN Side chain selection This parameter selects the audio used to control the dynamics specifically it selects the audio feed to the dynamics peak detector The options are e HFB Input audio to the mic high passed LP2 Input audio to the mic low passed more LP1 Input audio to the mic low passed e IN Input audio to the mic Note that this selection does not change the audio that is being processed by the dynamics rather it changes the audio signal used to determine the level or loudness of the audio SPEED SLOWEST SLOW NORMAL FAST FASTEST SLOW Controls the decay speed of the peak detector used by the dynamics processing ATTACK SLOWEST SLOW
118. tereo offset Fixed VEU mode freq band freq channels now start at 838Mhz Version rom053 2004 03 19 Added VCO limiting during no TX condition Version rom052 2004 03 19 Removed power save Version 051 2004 03 15 Added menu function for Backlight 87 Chapter 12 Zaxcom Digital Wireless System User s Manual Chapter 12 Menu Sheets Menu Sheet for TRX9xx MENU SETTINGS Standard Menu i Pacifier page Displays transmit frequency remaining battery capacity available recording time IFB receive indicator recording mode audio input level recording buffer overrun and current power mode GAIN Audio Gain page 0 to 52 dB step 2 ii TXFREQ Audio Transmitter Frequency page 518 to 872 MHz 30 MHz block step 100 KHz Minimum channel separation 500KHz iv Transport Control page While in RECORD mode press DEC to STOP recording While in STOP press DEC to move the playback pointer backward To PLAY press INC While in PLAY press INC to move the playback pointer forward v TIMECODE Timecode Frame rate page 23 98 24 25 29 97 NDF 29 97DF 3ONDF 30DF vi IFB EARPIECE Earpiece Source page REC PLAY RX AUDIO MIX ALL vii LOCK Lock page 5 sec countdown once entered To unlock simultaneously press MENU amp UP keys Extended Menu to reach these turn off the TX and hold the MENU key down while powering up Displays EXTENDED MENU PRE
119. tes the version of the firmware loaded 0150 Programmable logic device revision code 0000 means no NO CARD timecode input available EXT MENU APR 9 17 31 17 ZAXCOM V TRX900 SN indicates the transmitter s serial number hardwired into the printed circuit board EXIENDED MENU ERESS UP TO EXILI Extended Startup Sequence with a formatted card inserted LCD SYNTH AB LOWER POWER MODE Optional entry only occurs if Low Power mode has been fully enabled IFB IS OFF 0 PCB REVB 03 indicates options available 00 01 02 IFB 03 IFB amp VER 03 record POUND 50 CARD REVS 0150 EXT MENU APR 9 17 31 17 FOUND SEGS indicates how many previous recording s were found MODE 222222 277777 indicates which Transmission Format was set in the Extended Menu ZAXCOM V TRX900 SN EXTENDED MENU PRESS UP EXIT 30 Zaxcom Digital Wireless System User s Manual Chapter 2 Entering the Extended Menu Power down the transmitter 2 Press and hold the MENU key while powering up the unit Exiting the Extended Menu Cycle the power or hold down the MENU key to get back to this page and press the INC key Highpass Filter page HIGH PASS OFF his page maintains the cutoff frequency for the highpass filter OFF value range 30 to 220Hz step 10 Limiter page LIMLTER
120. to four batteries Battery Life External Power Some of the units can be powered from an external power source The external power connection is a 2 5 mm 0 1 barrel connector The center pin is positive The connector for the receiver 761K is longer than the connector for the STAI00 and IFBIOO 760K The 760K will not work in the receiver Common Settings for Associated Transmitters and Receivers The following settings must agree to allow associated AUDIO transmitters and receivers to work together AUDIO Transmitter side AUDIO Receiver side Install the same or compatible versions Standard Menu Standard Menu Audio Transmitter Frequency page Audio Receiver Frequency Select page Extended Menu Extended Menu Audio Transmission Format page Audio Reception Format page Security Code page Security Code Part 0 page Security Code Part page Table 1 4 Compatible Audio Settings The following settings must agree to allow associated IFBIOO and TRX9xx units to work together IFB Transmitter side IFB Receiver side Install the same or compatible versions Extended Menu Extended Menu Remote Control Group ID page IFB Receiver Enable page Standard Menu Remote Unit ID page Remote Control Group ID page IFB Transmitter Frequency page IFB Receiver Frequency page Table 1 5 Compatible IFB Settings Chapter Zaxcom Digital Wireless System User s Manual Firmware Each unit is shipped with the latest firmware version inst
121. ttp www orbitalsound co ukl It is a very powerful software tool able to simultaneously monitor and control up to 128 Zaxcom Digital Receivers t can resize its graphics to make the best use of the available screen space whether you re using 8 or 128 audio channels It allows the remote monitoring of all of the principle parameters of each TRXxxx transmitter including remaining battery life RF level and audio level Plus an expanded view of each channel streams the last minute of data for analysis and faultfinding In addition it can be used to program the receiver functions including setting the encryption codes enabling secure and confidential transmission PREV CLOSE Jes a Figure 7 1 ZedAlpha screen 69 Chapter 8 Zaxcom Digital Wireless System User s Manual About ZaxConvert Chapter 8 ZaxConvert Utility The ZaxConvert software is available for both MS Windows and Mac OS X The software is functionally identical on both operating systems You must use the ZaxConvert software to convert the audio from ZAX files to files Fie lye T Poly 2445 Track Enable od lrerenctie 3 arrest trom Taneocke Stayt Folder Using ZaxConvert Windows XP Caman trem Timecose Start ZaxConvert Timecode Norma Sample Rate Conversion Output File Name Max file Size 408 Bemowe Traesmirter Start E ann Options
122. up the unit this page appears and displays the following information antenna being used signal strength audio level transmitter limiter status receiver reception format receiver battery capacity transmitter recorder status transmitter battery capacity Parameters Character Antenna Displays which antenna is being used This character is always either an or B Characters 2 and 3 Signal Strength Two vertical bar graphs are displayed representing the signal strength at the antennas strong RF input level is shown using a checkered pattern This is the ideal signal strength Character 4 Audio Level When this character turns into a checkered pattern the transmitter s limiter is engaging due to excessive audio input levels If this occurs reduce the audio gain on the transmitter This ensures the highest level of unprocessed audio quality Characters 5 and 6 Receiver Information The meaning of these characters changes based on when you look at them If you turn ON the receiver after the transmitter it will display the Reception Format for about one second before it starts displaying the Receiver s Battery Level At all other times only the Receiver s Battery Level is displayed Reception Format e us US mono format 0 e eu European narrow band format 1 e St US stereo format 2 Receiver Battery Level This ranges from R9 down to RO When the level reaches RO the receiver has only a f
123. ver displays the quietest frequency once the scan has completed Accepting the Frequency Press the DEC key to load the selected frequency into the receiver Discarding the Frequency Press the MENU key to discard the selected frequency The receiver exits to the Pacifier page after discarding the frequency Blocking Frequencies with RF Interference Press the INC key to restart the scan However when the scan restarts instead of performing an entirely new scan it averages the current and previous scans Frequencies that are temporarily occupied are remembered in the final selection allowing the receiver to block frequencies that contain intermittent RF interference Starting a New Scan Repeatedly press the MENU key until you have stepped all the way around the menu back to the Audio Receiver Frequency Scan page Best Practice Scanning for a Low Noise Frequency The easiest way to remember the proper way to scan is to push the keys from right to left Repeatedly press the MENU key until SCAN is displayed 2 Press the INC key to start the scanning process Ensure the transmitter is OFF before starting the scan 3 Press the DEC key to load the selected frequency into the receiver The menu advances to the next item Best Practice Finding the Quietest Frequencies for Multiple Transmitters Turn all transmitters OFF and perform a couple of scans 2 Accept the quiet channel by pressing the DEC key 3 Turn ON the first tran
124. y on a 4 GB removable MiniSD card Audio recording and transmission at 24 bits 48 kHz Supports both record stop and continuous loop recording Backlit graphic Liquid Crystal Display Frequency selectable highpass filter Selectable peak limiter Lightweight rugged design Efficient keypad for one handed operation Integrated timecode reception RF remote control of TRX9xx transmitters o Audio gain Raise Lower o Recording Stop Start o Transmitter power On Standby o Remote frequency change e Transmission delay o US Mono mode 3 6 ms o Euro mode 6 ms o Stereo mode 6 ms e Battery runtime o TRX900 up to five hours on one 23 battery o TRX900AA to ten hours two AA Lithium batteries o TRX992 up to four hours on one VPX battery o TRX700 up to four hours on two AA Lithium batteries o TRX800 up to five hours one CR123 battery o RX900 M S up to four hours on four AA NiMH batteries o RX4900 no internal batteries always runs on external power o IFBIOO no internal batteries always runs on external power e Size and weight H x W x D while looking at the screen o TRX900 2 3 x 23 x 0 65 58mmx 58mmx 17 400z Ilg o TRX900AA 338 x 23 x 0 65 86mm x 58mmx 17 4 0 02 Ilg o TRX992 55 x 29 x 1 140 74mmx 28mm 13 2oz 374g o TRX700 1 75 x 375 x 75 44mm x 95mmx 44mm 6 6 02 187g o TRX800 Body 6 12 x 1 5 155 x 38mm 8 2

Download Pdf Manuals

Related Search

Related Contents

Manual de Utilização do Easy Reader versão 6    Le jeudi 13 février 2014, le premier Comité de Rivière du  EDK_II_Build_v1_22 - Firmware Encoding Index    Aventail VPN Setup Instructions for  FreeFlow®VIPP Pro Publisher Guia do Usuário  Catalogo Ecosferas para Museos  MTX TN12-02  

Copyright © All rights reserved. Failed to retrieve file