Home

KINO-9453 Motherboard User Manual

image

Contents

1. 139 Local Flat Panel Scaling Autco U u u u 140 ASF Support Enabled u LL 2 141 Audio Controller 97 Audio 141 OnBoard LAN1 BCM5787M Enabled u 141 On board LAN2 BCM5787M Enabled u 141 Save Changes and EXIL eescncevectcsceccctecaeectetecctncsvncereunceratnccesuesfacsepeeatecteoeeretvenstduse 142 Discard Changes and Exit J J J J nennen nnnm J J J 142 Discard Changes eter ett u Su k u u saa uqa asus usss 143 Load Optimal Defaults J J J J J J J J J J T 143 Load Failsafe Defaults 143 Page 183 KINO 9453 Mini ITX Motherboard Appendix B DIO Interface Page 184 KINO 9453 Mini ITX Motherboard B 1 DIO Interface Introduction _ RTechnology Corp The DIO connector on the KINO 9453 is interfaced
2. 34 4 24 IDE FE 35 4 2 5 LCD Backlight Connector 37 4 20 LVDS LCD u aqa E waqaq 38 4 24 Mini PCI US 40 4 218 10 m 41 4 2 9 14 Pin Serial Port Connectors 42 4 2 10 10 Pin Serial Port 43 4 2 11 SATA Drive Connectors 44 4217 SPDIF CONBEIDE usa aan aaa 45 4 2 13 Internal USB Connecfors a aasssassanassaassssaskasssakasssanisassssassssshasssas 46 4 3 EXTERNAL INTERFACE CONNECTORS ndun dH E orbes eeu 47 4 34 A dio ONT RD 48 4 3 2 CRT o oro NL 48 4 3 3 DVI CONNECTOR T a 49 4 34 Ethernet CONIC ONG 50 4 3 5 Keyboard Mouse Connector 51 4 3 0 Serial Port uv as sasanussssapasaqanpastusakaqshaqaatkawayasaqsshanaqyaasaapassaasassay 52 4 3 7 USB Connector 53 INSTALLATION 55 TI STATIC PREGAUTIONS u bere ecu oret ear edad 56 5 2 57 2 2 1 I
3. 48 DVI Connector 49 Ethernet Connector 50 Keyboard Mouse Connector 51 Serial Port Connector 52 USB Connector 53 _ RITechnology Corp front panel sirinin aa 34 Front panel undae RARI 4 front 2 FOB euma spum ama eaten 93 re 76 C 76 IDE flat cable 76 IDE flat cable m ice 76 INCH ACE 17 installation checklist 58 IrDA tecti 102 65 AT ATX power select 66 clear 67 COM function select 69 jumper configuration 65 LVDS resolution selection 71 LVDS voltage selection 73 KEV DONG u u deese ettet ds 80 85 keyboard controller 21 Page 209 _ IE LCD backlight 4 37 LCD voltage a aasawa 5 65 diei ree ae 19 LPC interface eni 17 21 LVDS display ua tenes 71 73 resolution select
4. 114 Serial Port Mod PM 114 leiple 114 Redirection after BIOS POST U u u uu u 114 Terminal Type cee UE 115 VT UTF8 Combo Key Support u u u u 115 Sredir Memory Display Delay U u u uu uu u u 115 Serial Port Number CON1 115 Base Address IRQ 3F8h 4 ecce ecco touc era u uu u 115 Serial Port Mode 115200 8 n 1 U J J 115 Flow Control 22222 222 2022222 2 gana Cor gre rur naa cian 116 Redirection After BIOS POST Always U 116 Terminal Type ANSI aa aa ou niin kcu e unn Enn ie Dus 116 VT UTF8 Combo Key Support Disabled eere 117 Sredir Memory Display Delay Disabled eese 117 USB Function 8 USB pos III i 118 USB 2 0 Controller Enabled u
5. 43 Serial Port 14 42 SPDIF niit 45 75 a 75 cooling 62 63 cooling kit installation 62 CPU Cooling fan 62 62 installation sese 59 IC KINO 9453 Mini ITX Motherboard CPU 12 compaltlible 12 CRT MONTON 83 DB 15 connector 83 84 9 52 as 4 Digital 4 9 eri 9 external peripheral interface connector ep qia 10 64 installation 64 specifcations 64 DVI port device 80 electrostatic discharge 25 56 Enhanced Hardware Monitor 21 ertet cbe ea 80 RJ 45 cable connector 80 external peripheral interface 80 CONNGCUON nin cee 80 8 80 External Peripheral Interface Connectors Audio 48 CRT Connector
6. lt Technology Corp KINO 9453 Mini ITX Motherboard Chapter 4 Connector Pinouts Page 29 KINO 9453 Mini ITX Motherboard 4 1 Peripheral Interface Connectors Section 4 1 1 shows peripheral interface connector locations Section 4 1 2 lists all the peripheral interface connectors seen in Section 4 1 3 4 1 1 KINO 9453 Layout Figure 4 1 shows the on board peripheral connectors rear panel peripheral connectors and on board jumpers DIMM2 DIMM1 PWR1 Q CPU FAN1 P PANEL1 USB5 T SYS_ 0584 JP1 4 COM3 m U ili SPDIF1 Q 0101 LAN USB2 a KBMS1 1 2 TINED LAN USB1 AUDIO ID Figure 4 1 Connector and Jumper Locations KINO 9453 Mini ITX Motherboard 4 1 2 Peripheral Interface Connectors Table 4 1 shows a list of the peripheral interface connectors on the KINO 9453 Detailed _ RITechnology Corp descriptions of these connectors can be found in Section 4 2 Connector Type Label ATX power supply connector 20 pin ATX connector PWR1 Digital connector 10 pin header DIO1 Fan connector CPU 3 pin wafer CPU_
7. 176 Figure 7 38 Matrix Storage Manager Welcome Screen eene 176 Figure 7 39 Matrix Storage Manager Warning Screen 177 Figure 7 40 Matrix Storage Manager License Agreement eese 177 Figure 7 41 Matrix Storage Manager Readme File eee 178 Figure 7 42 Matrix Storage Manager Setup Complete 179 _ IE KINO 9453 Mini ITX Motherboard List of Tables Table 1 1 Technical Specifications u u u uu u u u u 7 Table 2 1 Processor Features U U U u u u u u u 12 Table 2 2 Supported Processors u 13 Table 2 3 Supported HDD 17 Table 2 4 Power Consumption U U u u u u u 23 Table 2 5 Power Consumption U nennen u u U u u 23 Table 3 1 Package List 1 3 1 u u u u u 27 Table 3 2 Optional REMS ersaat ARAA AARAA AAAA 28 Table 4 1 Peripher
8. 74 IEI Provided Cables irre tierno trc incen nueces 76 BIOS Navigation Keys u 89 Page XVII KINO 9453 Mini ITX Motherboard BIOS Menus Men ETUR 90 Men 2 Advanced u L L DN 92 Menu 3 CPU Configuration J u u u u u u u u 93 Menu 4 IDE Config rationm u U U U U U U u 94 Menu 5 IDE Master and IDE Slave Configuration u u u u 96 Menu 6 Super IO Configuration U u uu u u u 101 Menu 7 Hardware Health 104 Menu 8 ACPI Configuration U 109 Menu 9 General ACPI Configuration Advanced ACPI Configuration 110 Menu 10 Advanced Power Management Configuration 111 Menu 11 Remote Access Configuration Advanced 114 Menu 12 USB ConfIguratlOn ede neto nt eno e teoria u u u u 118 Menu 13 USB Mass Storage Device Configuration eese 120 Menu 14 PCI PnP Configuration U U 1
9. Figure 5 21 VGA Connector Step 4 Secure the connector Secure the DB 15 VGA connector from the VGA monitor to the external interface by tightening the two retention screws on either side of the connector 5 7 5 Serial Device Connection The KINO 9453 has two female DB 9 connectors on the external peripheral interface panel for serial devices Follow the steps below to connect a serial device to the KINO 9453 Step 1 Locate the DB 9 connector The location of the DB 9 connector is shown in Chapter 3 Step 2 Insert the serial connector Insert the DB 9 connector of a serial device into the DB 9 connector on the external peripheral interface See Figure 5 22 220 RIechnology Corp KINO 9453 Mini ITX Motherboard Figure 5 22 Serial Device Connector Step 3 Secure the connector Secure the serial device connector to the external interface by tightening the two retention screws on either side of the connector 5 7 6 PS 2 Keyboard Mouse Connection The KINO 9453 has a dual PS 2 connector on the external peripheral interface panel The dual PS 2 connector is used to connect to a keyboard and mouse to the system Follow the steps below to connect a keyboard and mouse to the KINO 9453 Step 1 Locate the dual PS 2 connector The location of the dual PS 2 connector is shown in Chapter 3 Step 2 Insert the keyboard mouse connector Insert a PS 2 keyboard or mouse connector into the appropriate
10. 71 voltage select 73 LVDS resolution selection jumper 71 ore iie 72 71 LVDS voltage selection jumper 73 lOCAUOM ess u 74 SENGS ane aya qhawa 74 Matrix Storage Manager 193 memory module installation 64 memory 13 Mini PCI 4 40 41 motherboard 75 installation 75 MOUSE 80 Northbridge 33 northbridge chipset 13 PO 4 40 41 PCI Express GbE controller 19 PCI interface 18 Page 210 KINO 9453 Mini ITX Motherboard 19 peripheral device cables 76 power supply AT ATX power select jumper 66 PIOCOSSOMS E 12 51 52 PS 2 connector 85 PS 2 keyboard connection 85 real time clock 18 REALTEK ALC655 CODEC 16 47 50 51
11. KINO 9453 Mini ITX Motherboard Chapter 7 Driver Installation Page 144 _ 0 RITechnology Corp KINO 9453 Mini ITX Motherboard 7 1 Available Software Drivers content of the vary throughout the life cycle of the product and is subject to change without prior notice You may visit the IEI website or contact technical support for the latest updates The following drivers can be installed on the system m Chipset driver m VGAdriver m LAN driver Installation instructions are given below 7 2 Driver CD Auto run All the drivers for the KINO 9453 are on the CD that came with the system To install the drivers please follow the steps below Step 1 Insert the CD into a CD drive connected to the system Step 2 The starts up automatically Step 3 Select KINO 9453 from the initial menu Step 4 Anew screen with a list of available drivers appears Figure 7 1 Page 145 _ IE Intel 915 945 965 I 1 Technology Corp a INF a VGA a LAN a AUDIO SATA 5 Manual a IDE ITE8211F lt lt Back Visit IEI Website Explore CD Exit Figure 7 1 Available Drivers Step 5 Select the driver to install from the list in Figure 7 1 7 3 Chipset Driver Installation To install the chipset driver please follow the steps below Step 1 Select the INF driver from the lis
12. lechnology Corp KINO 9453 Mini ITX Motherboard m Enter the correct CMOS setting m Load Optimal Defaults m Load Failsafe Defaults After having done one of the above save the changes and exit the CMOS Setup menu The clear CMOS jumper settings are shown in Table 5 3 Clear CMOS Description Short 1 2 Keep CMOS Setup Default Short 2 3 Clear CMOS Setup Table 5 3 Clear CMOS Jumper Settings The location of the clear CMOS jumper is shown in Figure 5 9 below Figure 5 9 Clear CMOS Jumper JP3 _ RITechnology Corp KINO 9453 Mini ITX Motherboard 5 4 3 COM 3 Function Select Jumper Jumper Label JP1 and JP7 Jumper Type 6 pin header Jumper Settings See Table 5 4 Jumper Location See Figure 5 10 The COM 3 Function Select jumper sets the communication protocol used by the second serial communications port COM 3 as RS 232 RS 422 or RS 485 The COM 3 Function Select settings are shown in Table 5 4 JP1 Description Short 1 2 RS 232 Short 3 4 RS 422 Short 5 6 RS 485 JP7 Description Short 1 3 2 4 RS 232 Default Short 3 5 4 6 RS 485 Table 5 4 COM 3 Function Select Jumper Settings The COM 3 Function Select jumper location is shown in Figure 5 10 KINO 9453 Mini
13. 66 OCA M 66 SENGS B 66 ATX 2 41 Audio 5 47 BIOS 20 88 89 90 91 92 93 94 95 96 100 101 104 108 109 110 111 113 114 116 117 118 120 122 123 128 129 130 131 132 133 134 135 136 140 142 BIOS 24 44 0 0 221 22 19 GAaD 6eS tenet nt ea ei e sean dun 76 dual RS 232 77 GhaSSISu usa sapu 32 47 75 i nstallatigh 75 eec 13 northbridge 13 Page 208 KINO 9453 Mini ITX Motherboard chipset driver 146 151 Clear CMOS 5 65 clear CMOS jumper 67 68 68 CMOS ntes ette 67 clear CMOS 67 COM 3 COM function select 69 COM function select jumper 69 022 11 8 69 71 69 70 connectors pinouts and location Digital Input Output 34 32 Front 33 Ju 35 Internal cias 46 LCD Backlight 37 LV DS vies uuu 38 u u u enit 40 POW s ara 41 44 Serial Port 10 pin
14. 76 2 6 2 IDE Cable etia IRE BERE NEM 76 5 6 3 Dual RS 232 Cable 27 5 6 4 SATA Drive Connection MP MM E 78 5 7 EXTERNAL PERIPHERAL INTERFACE CONNECTION nennen rennen 80 Did lh ConneclHhona MC ENESELE 80 Berner Connection aic t eapite 1 MIELE rU T P 62 5 7 4 VGA Monitor Connection 83 5 7 5 Serial Device ERA DE ATO RTI NEU 64 5 7 6 PS 2 Keyboard Mouse Connection 65 E 0B 1 m eiss sto i 87 DL INTRODUCTION Sui iei iie A deas beds 88 NNI 88 UN WE 88 6 4 3 Naa Eins 89 6 1 4 Unable to Reboot After Configuration Changes 89 6 1 3 BIOS Menu B 89 6 2 MAIN t 90 0 3 ADVANCED Lus PM 91 6 3 1 CPU rm 92 ii siae ra hin aam ias Rai 93 6 3 2 1 IDE Master IDE 96 6 3 3 Super
15. J J 128 Quick Boot Enabled u kasu aasawa ass 129 Quiet Boot Disabled LULU teen toe tee it Saee a sa sas ua 129 AddOn ROM Display Mode Force BIOS l l l u u u 130 Num Lock On reri cernere nn nun nin 130 PS 2 Mouse Support Auto u U u u u nana J J J 130 Boot From LAN Support Disabled J J J 131 Change Supervisor Password uu u u u u 134 Change User Pas Word u II ee asas auqa aaa saus ER RT UE Dia 134 Boots Graphics Adapter Priority PCI IGD U U 136 Internal Graphics Mode Select Enable 8MB J 137 PEG Port Auto 137 PEG Force X1 Disa bled 5 rrr rne sasaw enn 137 DVMT Mode Select DVMT Modci 138 DVMT FIXED Memory 128 1 139 Boot Display Device 139 Flat Panel Type 1024 768
16. 49 Table 4 17 DVI I Connector Pinouts U u u uu u 50 Table 4 18 and LAN2 Pinouts U 51 Table 4 19 RJ 45 Ethernet Connector LEDs u u u u uu 51 Table 4 20 PS 2 Connector Pinouts uu u uu u u 52 Table 4 21 External Serial Port Pinouts u u u u u 53 Table 4 22 External USB Connector Pinouts u uu u 54 Page XVI gt Table 5 1 Table 5 2 Table 5 3 Table 5 4 Table 5 5 Table 5 6 Table 5 7 Table 5 8 Table 5 9 Table 6 1 KINO 9453 Mini ITX Motherboard _ RITechnology Corp Niere 66 AT ATX Power Select Jumper Settings u u u u 66 Clear CMOS Jumper Settings 68 COM Function Select Jumper Settings u u u u 69 RS 422 Termination Resister Jumper Settings 70 RS 485 Termination Resister Jumper Settings 71 LVDS Screen Resolution Selection Jumper Settings 72 LVDS Voltage Selection Jumper Settings
17. INT 15H Initiates the INT 15H BIOS call B 3 2 Enable the DIO Output Function The BIOS interrupt call INT 15H controls the digital An assembly program to enable digital output functions is listed below MOV AX 6F09H Sets the digital port as output MOV BL 09H INT 15H Initiates the INT 15H BIOS call Page 186 zs 42 2 IC lt RIechnology Corp KINO 9453 Mini ITX Motherboard Appendix C Watchdog Timer Page 187 _ 188 KINO 9453 Mini ITX Motherboard The following discussion applies to DOS environment IEI support is contacted or the IEI website visited for specific drivers for more sophisticated operating systems e g Windows and Linux The Watchdog Timer is provided to ensure that standalone systems can always recover from catastrophic conditions that cause the CPU to crash This condition may have occurred by external EMI or a software bug When the CPU stops working correctly Watchdog Timer either performs a hardware reset cold boot or a Non Maskable Interrupt NMI to bring the system back to a known state A BIOS function call INT 15H is used to control the Watchdog Timer INT 15H AH 6FH Sub function AL 2 Sets the Watchdog Timer s period BL Time out value Its unit second is dependent on the item Watchdog Timer unit select in CMOS s
18. Please read the following license agreement carefully Press the Page Down key to view the rest of the agreement INTEL SOFTWARE LICENSE AGREEMENT IHY 2 ISV Distribution amp 4 Single User IMPORTANT READ BEFORE COPYING INSTALLING OR USING Do not use or load this software and any associated materials collectively the Software until you have carefully read the following terms and conditions By loading or using the Software you agree to the terms of this Agreement IF you do not wish to so agree do not install or use the Software Please Also Note If you are an Original Equipment Manufacturer OEM Independent Hardware Vendor or Independent Software Vendor ISV this complete LICENSE AGREEMENT applies You must accept all of the terms of the license agreement in order to continue the setup program Do you accept the terms lt Back Installation Frameworks Figure 7 40 Matrix Storage Manager License Agreement Page 177 _ IE IT echnology Gorp KINO 9453 Mini ITX Motherboard Step 10 Read the license agreement To accept the terms and conditions stipulated in the license agreement shown click YEs and the Readme information file shown in Figure 7 41 appears Intel R Matrix Storage Manager 6 2 0 2002 Readme File Information Refer to the Readme file below to view system requirements and installation n tel information Press the Page Down key to view t
19. The connector supports one or two channel 18 bit or 24 bit LVDS panel RITechnology Corp VCC2 VCC4 NC3 VCC1 VCC3 NC4 PIN NO DESCRIPTION PIN NO DESCRIPTION 1 GND 2 GND 3 1 t LVDS data0 output 4 1 t LVDS data0 output 5 1 t LVDS data1 output 6 1 t LVDS data1 output 7 1 t LVDS data2 output 8 1 t LVDS data2 output 9 1 t LVDS clock output 10 1 t LVDS clock output 11 NC 12 NC 13 GND 14 GND 15 2 LVDS data0 output 16 2 LVDS data0 output 17 274 LVDS datal output 18 274 LVDS datal output 19 2 d LVDS data2 output 20 2 LVDS data2 output 21 2 4 LVDS clock output 22 2 LVDS clock output 23 NC 24 NC 25 GND 26 GND 27 LCD 3 3V 5V or 12V 28 LCD 3 3V 5V or 12V 29 LCD 3 3V 5V or 12V 30 LCD 3 3V 5V or 12V Table 4 8 LVDS LCD Connector Pinouts 4 2 7 Mini PCI Slot CN Label MINIPCI CN Type 124 pin Mini PCI Type III slot CN Location See Figure 4 8 CN Pinouts See Table 4 9 KINO 9453 Mini ITX Motherboard Mini PCI is a small form factor version of a PCI card Mini PCI expansion devices can be inserted into the Mini PCI slot 35 AD 29 sPM 6 se RESERVED GROUND AD 30 39 AD 27 40 3 3v mmm MINIPCI NAME 3 3V FRAME CLKRUN TRDY
20. config engine32 Address wom GETDXVER Windows Cil wings fa ikernel WinNT4 layout Select item to view its description SR alcchkid README alcrmv setcbfmt See also E Setup Documents Sad slermv9x setup ibt My Network Places Sad alcupd 3 Setup My Computer F lakcupd64 setup Sagatcxpev a setup isn 4 setup iss 8 SetupEx IE sounoman datal hdr 31 object s 5 80 MB KE My Computer Figure 7 26 CD 4 AUDIO AC KITOSR Windows Folder Step 3 Double click the Setup exe file to begin the driver installation process Step 4 Once you double click the Setup icon the install shield wizard for the audio driver starts See Figure 7 27 Starting InstallShield Wizard Figure 7 27 AC 97 Audio Driver Install Shield Wizard Starting Step 5 The Realtek Audio Setup prepares the install shield to guide you through the rest of the setup process See Figure 7 24 Page 168 1 Corp Audio InstallShield Wizard Preparing Setup Please wait while the InstallShield Wizard prepares the setup Cancel Figure 7 28 AC 97 Audio Driver Setup Preparation Step 6 After the install shield is prepared the welcome screen shown in Figure 7 29 appears To continue the installation process click the NEXT button The install shield starts to c
21. gt Serial Port3 Address 3E8 Use the Serial Port3 Address option to select the base addresses for serial port 3 Page 102 _ RITechnology Corp KINO 9453 Mini ITX Motherboard gt Disabled No base address is assigned to serial port 3 gt 3E8 DEFAULT Serial port 3 I O port address is 3E8 gt 2E8 Serial port 3 I O port address is 2E8 gt 2F0 Serial port 3 I O port address is 2F0 gt 2E0 Serial port 3 I O port address is 2 0 gt Serial Port3 IRQ 11 Use the Serial Port3 IRQ option to select the interrupt address for serial port 3 gt 10 Serial port 3 IRQ address is 10 gt 11 DEFAULT Serial port 3 IRQ address is 11 gt Serial Port4 Address 2E8 Use the Serial Port4 IRQ option to select the interrupt address for serial port 4 gt Disabled No base address is assigned to serial port 3 gt 3E8 Serial port 4 I O port address is 3E8 gt 2E8 DEFAULT Serial port 4 I O port address is 2E8 gt 2F0 Serial port 3 I O port address is 2 0 gt 2E0 Serial port 4 I O port address is 2E0 Serial Port4 IRQ 10 Use the Serial Port4 IRQ option to select the interrupt address for serial port 4 gt 10 DEFAULT Serial port 4 IRQ address is 10 gt 11 Serial port 4 IRQ address is 11 Page 103 1 KINO 9453 Mini ITX Motherboard 6 3 4 Hardware Health Configuration The Hardware Health Configuration menu BIOS Menu 7 shows the operating temperature
22. KINO 9453 Mini ITX Motherboard Step 3 Save and Exit BIOS After the SATA support option is enabled save and exit the BIOS Step 4 Reboot the system Reboot the system after saving and exiting the BIOS Step 5 Press Ctrl I During the system boot process press Ctrl I when prompted to enter the RAID configuration software Step 6 Configure the RAID settings Use the Intel Matrix Storage Manager to configure the RAID array Brief descriptions of configuration options are given below Step 7 Install the OS After the RAID array has been configured install the OS To do this please refer to the documentation that came with the OS E 4 RAID Configuration E 4 1 Creating a RAID Volume WARNING All data previously stored on the member drives of a RAID configuration are destroyed during the RAID initialization process If used drives are used to create a RAID array make sure the data has been moved or backed up before creating a RAID array out of the disk drives Page 196 Ener I 5 SEES ESTA 3 e b 74 lt F lt E EL suu a KINO 9453 Mini ITX Motherboard Step 1 Select Create RAID Volume Use the arrow keys to highlight Create RAID Volume and press ENTER See Figure E 1 Intel R Matrix Storage Manager option 5 0 0 1032 ICH R wRAIDS Copyright C 2003 05 Intel Corporation All Rights Reserved 1 2
23. SERR STOP GROUND 3 3V AD 02 AD 00 RESERVED_WIP5 RESERVED_WIP5 t RIechnology Corp KINO 9453 Mini ITX Motherboard AD 28 C BE 1 RESERVED GROUND AC_SDATA_IN Es Ea Es Es Ea Es Es a a LED2 YELP LED2 YELN RESERVED INTB mm iav Ground RESERVED Table 4 9 Mini PCI Slot Pinouts 4 2 8 Power Connector CN Label PWR1 CN Type 20 pin connector CN Location See Figure 4 9 CN Pinouts See Table 4 10 This 20 pin power connector supports the ATX power supply _ IE IT echnology Gorp KINO 9453 Mini ITX Motherboard PWR1 20 OW Fs I 11 10 a 14 VCC12 O VCC5SBY PIN NO DESCRIPTIONIPIN DESCRIPTION 1 3 3V 11 3 3V 2 3 3V 12 12V 3 GND 13 GND 4 5V 14 PS_ON 5 GND 15 GND 6 5V 16 GND 7 GND 17 GND 8 Power good 18 5V 9 5VSB 19 5V 10 12V 20 5V Table 4 10 Power Connector Pinouts 4 2 9 14 Pin Serial Port Connectors CN Label COM3 CN Type 14 pin header 2x7 CN Location See Figure 4 10 Page 42 RTechnology Corp KINO 9453 Mini ITX Motherboard CN Pinouts See Table 4 11 The serial ports connectors connect to RS 232 422 485 serial port device COM3 Table 4 11 COM2 Pino
24. These messages inform the reader of essential but non critical information These messages should be read carefully as any directions or instructions contained therein can help avoid making mistakes Notes are easy to recognize The word note is written as NOTE both capitalized and bold and is followed by text The text is the cautionary message A note message is shown below NOTE This is an example of a note message Notes should always be read Notes contain critical information about the KINO 9453 Please take note messages seriously _ List NOTE If any of the components listed in the checklist below are missing please do not proceed with the installation Contact the IEI reseller or vendor you purchased the KINO 9453 from or contact an IEI sales representative directly To contact an IEI sales representative please send an email to sales iei com tw The items listed below should all be included in the KINO 9453 package m 1 9453 single board computer m x IDE cable m 1x SATA power cable m 2 SATA cables m 1x Dual RS 232 cable m 1 x O shielding m 1x Mini jumper pack m 1x Utility CD m x QIG quick installation guide Images of the above items are shown in Chapter 3 KINO 9453 Mini ITX Motherboard IC mme RITechnology Corp IL JINUBODUCTION 1 1 1 INTR
25. 21 2 8 3 5 Super Keyboard Controller eiie tatu ntn natn 21 2 9 ENVIRONMENTAL AND POWER SPECIFICATIONS eene 22 2 9 1 System Monitoring 22 2 9 2 Operating Temperature and Temperature Control 23 2 9 3 Power Conci LUN d a aaa taoide toii ei EE EE R iaoeia 23 3 UNPACKING 24 3 1 ANTI STATIC PRECAUTIONS uuu sees tes o dui canna 25 3 2 UNPACKING eS 25 3 2 1 Unpacking Precautions sessenta eria a iai 25 3 3 UNPACKING CHECKLIST osese RE 26 3 3 1 Package Contents T tirar R E E E E REE anders 26 3 3 2 E R ETENEE 27 4 CONNECTOR 29 4 1 PERIPHERAL INTERFACE CONNECTORS 30 lst tsa ln daa aes hati 30 4 1 2 Peripheral Interface Connectors 31 4 1 3 External Interface Panel Connectors 32 4 2 INTERNAL PERIPHERAL CONNECTORS 32 Page VIII 5 _ RITechnology Corp KINO 9453 Mini ITX Motherboard 4 2 1 32 5 22 Prom Panel Connector ayau V Gp pads 33 4 2 3 Digital Input Output Connector
26. BIOS Menu 14 PCI PnP Configuration Page 123 _ IE KINO 9453 Mini ITX Motherboard gt Clear NVRAM No Use the Clear NVRAM option to specify if the NVRAM Non Volatile RAM is cleared when the power is turned off gt No DEFAULT System does not clear NVRAM during system boot gt Yes System clears NVRAM during system boot gt Plug amp Play O S No Use the Plug amp Play O S BIOS option to specify whether system plug and play devices are configured by the operating system or the BIOS gt No DEFAULT ff the operating system does not meet the Plug and Play specifications this option allows the BIOS to configure all the devices in the system gt Yes This setting allows the operating system to change the interrupt DMA settings Set this option if the system is running Plug and Play aware operating systems Latency Timer 64 Use the PCI Latency Timer option to specify the PCI latency time The latency time is measured in units of PCI clock cycles for the PCI device latency timer register Configuration options are m 32 m 64 DEFAULT m 96 m 128 m 160 m 192 m 224 m 248 Page 124 _ RITechnology Corp KINO 9453 Mini ITX Motherboard Allocate IRQ to PCI VGA Yes Use the Allocate IRQ to PCI VGA option to restrict the system from giving the VGA adapter card an interrupt address gt Yes Defau
27. ICH7 M are listed below Complies with PCI Express Base Specification Revision 1 0a Complies with PCI Local Bus Specification Revision 2 3 and supports 33MHz PCI operations m Supports ACPI Power Management Logic m Contains O Enhanced DMA controller O Interrupt controller O Timer functions m Integrated SATA host controller with DMA operations interfaced to two SATA connectors on the KINO 9453 m Integrated IDE controller supports Ultra ATA 100 66 33 m Supports the six USB 2 0 devices on the KINO 9453 with four UHCI controllers and one EHCI controller Complies with System Management Bus SMBus Specification Version 2 0 m Supports Audio Codec 97 AC 97 Revision 2 3 m Supports Intel High Definition Audio m Contains Low Pin Count LPC interface m Supports Firmware Hub FWH interface 2 6 2 Intel ICH7 M Audio Codec 97 Controller The KINO 9453 has an integrated Realtek ALC655 codec The ALC655 codec is a 16 bit full duplex AC 97 Rev 2 3 compatible six channel audio codec designed for PC multimedia systems including host soft audio and AMR CNR based designs Complete surround sound requires six channel audio consisting of m Front left KINO 9453 Mini ITX Motherboard m Center m Subwoofer Front right m Back left m Back right 2 6 3 Intel ICH7 M IDE Interface _ RITechnology Corp The integrated IDE interface on the ICH7 M Southbridge supports two IDE hard disks and ATAPI device
28. RJ 45 connector 81 RJ 45 Ethernet CONNEC ON Ran 81 RJ 45 Ethernet 81 rotation 33 arp ER 77 cable connection 77 dual cable 77 SATA 2 5 44 Controller reete 18 SATA drive sse 78 GADES aa ieu 78 78 power 78 Serial Device conneclion 84 Serial 84 21 KINO 9453 Mini ITX Motherboard six channel audio CODEC 16 socket 479 CPU COOMMG Kites eee terres 62 cooling kit installation 62 installation sees 59 en 5 45 46 Super 20 system voltages 104 technical specifications 5 temperature 104 UNPACKING 25 _ RITechnology Corp
29. fan speeds and system voltages Harduare Health Configuration CPU Temperature Sustem Temperature 1 Sustem Temperature 2 CPU FAN Speed System FAN Speed CPU Core 2 5U 3 30U 5 000 12 00 GMCH 1 50 1 050 5USB UBAT 26 C 76 F ah eee ils i 34 C793 F 5869 RPH 5818 RPH 1 168 U 2 448 U 3 296 U 5 024 U 11 856 U 1 472 U 1 024 U 5 024 U 3 168 U BIOS Menu 7 Hardware Health Configuration CPU FAN Mode Setting Full Mode Use the CPU FAN Mode Setting option to configure the second fan gt Full On Mode gt Automatic mode gt PWM Manual mode Page 104 DEFAULT Fan is all the time Fan is off when the temperature is low enough Parameters must be set by the user Pulse width modulation set manually _ 0 RITechnology Corp KINO 9453 Mini ITX Motherboard When the CPU FAN Mode Setting option is in the Automatic Mode the following parameters can be set m CPU Temp Limit of OFF m CPU Temp Limit of Start m CPU Temp Limit of Full m CPU Fan Start PWM m Slope PWM 1 When the CPU FAN Mode Setting option is in the PWM Manual Mode the following parameters can be set m CPU Fan PWM control Temp Limit of OFF 000 WARNING Setting this value too high may cause the fan to stop when the CPU is at a high temperature and therefore cause the system to be damaged The CPU Temp Limit of OFF option can only be set if the
30. including the KINO 9453 Dry climates are especially susceptible to ESD It is therefore critical that whenever the KINO 9453 or any other electrical component is handled the following anti static precautions are strictly adhered to m Wear an anti static wristband Wearing a simple anti static wristband can help to prevent ESD from damaging the board m Self grounding Before handling the board touch any grounded conducting material During the time the board is handled frequently touch any conducting materials that are connected to the ground m Use an anti static pad When configuring the KINO 9453 place it on antic static pad This reduces the possibility of ESD damaging the KINO 9453 m Only handle the edges of the PCB When handling the PCB hold the PCB by the edges 3 2 Unpacking 3 2 1 Unpacking Precautions When the KINO 9453 is unpacked please do the following m Follow the anti static precautions outlined in Section 3 1 m sure the packing box is facing upwards so the KINO 9453 does not fall out of the box m Make sure all the components shown in Section 3 3 are present _ IE 3 3 Unpacki 9453 Motherboard Checklist If some of the components listed the checklist below missing please do not proceed with the installation Contact the IEI reseller or vendor you purchased the KINO 9453 from
31. the KINO 9453 motherboard supports connectivity to ATA 100 IDE devices with data transfer rates up to 100 MB s KINO 9453 Mini ITX Motherboard BOBRBDOBBU 20 0005000000 l IDERST lt lt PDD6 PDD5 PDD4 PDD3 PDD2 PDD1 PDD0 PDDREQ PDIOW PDIOR PHDRDY PDDACK IRQ14 PDA1 PDA0 PDCS1 HD_LED1 PDD8 PDD9 PDD10 PDD11 PDD12 PDD13 PDD14 PDD15 CS0 DASP DESCRIPTION RESET DATA 10 DATA 11 DATA 12 _ RITechnology Corp KINO 9453 Mini ITX Motherboard PIN NO DESCRIPTION PIN NO DESCRIPTION DATA 2 14 DATA 13 DATA 1 16 DATA 14 DATA 0 18 15 fone pe few Q m qm ow gt e m ow mman m we qm so pe sme e ow Table 4 6 IDE Connector Pinouts 4 2 5 LCD Backlight Connector CN Label CN1 CN Type 6 pin header 1x6 CN Location See Figure 4 6 CN Pinouts See Table 4 7 The LCD backlight connector is for the LCD inverter connection IE I Technology Gorp KINO 9453 Mini ITX Motherboard T gt BKL_POWER DESCRIPTION Back Light Power Table 4 7 LCD Backlight Connector Pinouts 4 2 6 LVDS LCD connector CN Label LVDS1 CN Type 30 pin connector 2x15 CN Location See Figure 4 7 CN Pinouts See Table 4 8
32. 0 devices supported m Dual PCle GbE Ethernet connectivity m Multiple display options including CRT DVI and dual channel LVDS m Mini ITX form factor m RoHS compliant m Supports AT and ATX power supplies 1 2 KINO 9453 Overview 1 2 1 KINO 9453 Overview Photo The KINO 9453 has a wide variety of internal and external peripheral connectors The peripheral connectors are connected to devices including PCI devices mini PCI devices storage devices display devices and serial communications devices A labeled photo of the peripheral connectors on the front of the KINO 9453 is shown in Figure 1 2 _ e IE KINO 9453 Mini ITX Motherboard DDR2 DIMM LCD Back Sockets CPU Fan et Panel T IDE USB 2 0 PCI slot COM Ports SPDIF GPIO LVDS Mini PCI slot Keyboard Mouse Audio Jacks amp DVI LANs amp Serial Ports USBs Figure 1 2 KINO 9453 Overview 1 2 2 KINO 9453 Peripheral Connectors and Jumpers The KINO 9453 has the following connectors on board m 2x DDR2 DIMM sockets m 1 x Digital connector m Fan connectors m 1 Front panel connector m 1x IDE Interface connector m 1xLCD backlight connector m 1xLVDSLCD connector m Mini PCI slot m x PCI slot m 1 Power connector KINO 9453 Mini ITX Motherboard _ RITechnology Corp 2 x Serial port connectors 2 x SATA connectors m 1x SPDIF connector m 2x USB connectors
33. 100 6 3 4 Hardware Health Configuration y 104 6 3 5 m 109 6 3 5 1 General ACPI Com eur ati 109 Page X _ RITechnology Corp KINO 9453 Mini ITX Motherboard 6 3 6 Configuration NK RUE RU dg E tu 111 6 3 7 Remote Access 13 6 3 8 USB 117 6 3 8 1 USB Mass Storage Device Configuration 120 0 4 POUPNP cA 122 6 3 BOOT m TE 128 6 5 1 Boot Settings Configuration 129 5 5 2 Device a a E 131 6 5 3 Removable Drives 133 SECURITY E E 134 CHIPSET Qa sa ananas aa 135 6 7 1 NorthBridge Configuration a 136 6 7 1 1 Video Function Configuration 137 6 7 2 SouthBridse Chipset Configuration 140 NTC 142
34. 7 DRIVERINSTALLATION 144 7 1 AVAILABLE SOFTWARE DRIVERS a 145 To DRIVER C EEAUTOSBUSN naqam qap cd et esi pau topic 145 7 3 CHIPSET DRIVER INSTALLATION n nanas 146 7 4 INTEL GRAPHICS MEDIA ACCELERATOR DRIVER 151 7 5 BROADCOM LAN DRIVER FOR GBE LAN INSTALLATION 157 7 6 REALTEK HD AUDIO DRIVER ALC883 INSTALLATION eene 163 7 0 1 BIOS Set Dr 163 76 2 Driver IDSIBIIQHOWQ aaa 163 7 7 REALTEK AC 97 AUDIO DRIVER ALC665 INSTALLATION 167 VE IQ Set p aa aaa 167 7 7 2 Driver Installation 167 7 8 INTEL MATRIX STORAGE MANAGER INSTALLATION enne 174 A BIOS EN 180 B 184 B 1 DIO INTERFACE INTRODUCTION 185 DID CONNECTOR PINQUTS 185 ASSEMBLY LANGUAGE SAMPLEG cccssceccccsseececcecececcseececceseececneseececceseeceeaeners 186 _ IE T echnology Gorp B 3 1 Enable the DIO Input Function 186
35. 945 SDVO SUDDOTrt2 a T 15 2 5 4 Intel 945GME Direct Media Interface DMI 15 2 6 INTEL ICH7 M SOUTHBRIDGE CHIPSET retentis 16 2 6 1 TCH IM OvervieW ua utc o cela 16 2 6 2 Intel ICH7 M Audio Codec 97 Controller e 16 2 6 3 Intel ICH7 M IDE Interface ettet tette trennt 17 2 6 4 Intel ICH7 M Low Pin Count 17 VII _ IE IT echnology Gorp 2 6 5 Intel ICH7 M PCI Interface eerte 18 2 6 6 Intel ICH7 M Real Time Clock 18 2 6 7 Intel ICH7 M SATA Controller iocus tein nate det oM in baee 18 2 6 8 Intel 18 2 PCIE BUS COMPONENTS EAEE dii EE AAE ETE 19 FANNIE UL EAEE TENERE 19 2 7 2 Broadcom PCI Express GbE interface 19 2 6 LPC BUS COMPONENTS 19 28 1 LPC Bus OV rVie C RH 19 236 2 BIOS Chipset cc 20 2 8 3 Super IRR UR EARN DS RENE 20 2 8 3 Super DO LPC Interface prie UR ita 21 2 5 3 2 S per T O 166950 UART uiii taste 21 2 8 3 3 Super I O Enhanced Hardware Monitor 21 2 8 3 4 Super I O Fan Speed Controller
36. B 3 2 Enable DIO Output Function 186 WATCHDOG TIMER 187 D ADDRESS EXSE REX MEEE EUER NUES PES VERRE EN ES UE 190 D L ADDRESS MAP p 191 D 2 18T MB MEMORY ADDRESS 191 IDS MAPPING 192 D 4 DMA CHANNEL ASSIGNMENTS 192 INTEL MATRIX STORAGE MANAGER 193 INTRODUCTION P 194 E T IL Precautions es 194 E 2 FEATURES AND BENEFITS aaa EN Re 195 E 3 ACCESSING THE INTEL MATRIX STORAGE MANAGER cete 195 EA RAID CONFIGURATION 196 E 4 1 Creating a RAID Volume ND 196 E 2 2 Deleting a RAID inssi a i E aii 201 E 4 3 Resetting a Disk to 203 4 4 Exiting the Matrix Storage Manager 206 ssas tosi 207 Page XII 1 Corp KINO 9453 Mini ITX Motherboard List of Figures Figure 1 1 KI
37. CPU FAN Mode Setting option is set to Automatic Mode Use the CPU Temp Limit of OFF option to select the CPU temperature at which the cooling fan should automatically turn off To select a value select the CPU Temp Limit of OFF option and enter a decimal number between 000 and 127 The temperature range is specified below Minimum Value 0 G Maximum Value 127 C gt CPU Temp Limit of Start 020 Page 105 _ KINO 9453 Mini ITX Motherboard A WARNING Setting this value too high may cause the fan to start only when the CPU is at a high temperature and therefore cause the system to be damaged The CPU Temp Limit of Start option can only be set if the CPU FAN Mode Seiting option is set to Automatic Mode Use the CPU Temp Limit of Start option to select the CPU temperature at which the cooling fan should automatically turn on When the fan starts it rotates using the starting pulse width modulation PWM specified in the CPU Fan Start PWM option below To select a value select the CPU Temp Limit of Start option and enter a decimal number between 000 and 127 The temperature range is specified below Minimum Value 0 C Maximum Value 127 C gt CPU Temp Limit of Full 080 WARNING Setting this value too high may cause the fan to start rotating at full speed only when the CPU is at a high temperature and therefore cause the system to
38. Handoff option for systems running OSes that do not have EHCI hand off support The EHCI ownership change is managed by the EHCI driver Page 119 KINO 9453 Mini ITX Motherboard gt Disabled Systems with OSes that do not support EHCI can use the EHCI handoff functionality gt Enabled DEFAULT Systems with OSes that do not support EHCI cannot use the EHCI handoff functionality 6 3 8 1 USB Mass Storage Device Configuration mass storage class devices USB Mass Storage Device Configuration Device 1 JetFlash TS1GJF110 BIOS Menu 13 USB Mass Storage Device Configuration USB Mass Storage Reset Delay 20 Sec Use the USB Mass Storage Reset Delay option to set the number of seconds POST waits for the USB mass storage device after the start unit command Page 120 _ RITechnology Corp KINO 9453 Mini ITX Motherboard gt 10 Sec POST waits 10 seconds for the USB mass storage device after the start unit command gt 20 Sec DEFAULT POST waits 20 seconds for the USB mass storage device after the start unit command gt 30 Sec POST waits 30 seconds for the USB mass storage device after the start unit command gt 40 Sec POST waits 40 seconds for the USB mass storage device after the start unit command gt Device The Device field lists the USB devices that are connected to the system Emulation Type Auto Use the Emu
39. Motherboard LVDS Resolution Select Description Open By BIOS setting fase ieee en Table 5 7 LVDS Screen Resolution Selection Jumper Settings The LVDS Screen Resolution Selection jumper location is shown in Figure 5 13 lt RITechnology Corp 200 JP2 Figure 5 12 LVDS Screen Resolution Selection Jumper Pinout Locations 5 4 6 LVDS Voltage Selection WARNING Permanent damage to the screen and KINO 9453 may occur if the wrong voltage is selected with this jumper Please refer to the user guide that cam with the monitor to select the correct voltage Jumper Label JP4 Jumper Type 4 pin header Jumper Settings See Table 5 8 Jumper Location See Figure 5 13 lechnology Corp KINO 9453 Mini ITX Motherboard The LVDS Voltage Selection jumper allows the LVDS screen voltage to be set The LVDS Voltage Selection jumper settings are shown in Table 5 8 LVDS Voltage Select Description Short 1 2 3V Default Short 3 4 5V Table 5 8 LVDS Voltage Selection Jumper Settings The LVDS Voltage Selection jumper location is shown in Figure 5 13 10 1 3 Figure 5 13 LVDS Voltage Selection Jumper Pinout Locations _ e RITechnology Corp KINO 9453 M
40. POST procedures are skipped gt Enabled DEFAULT Some POST procedures are skipped to decrease the system boot time 2 Quiet Boot Disabled Use the Quiet Boot BIOS option to select the screen display when the system boots Page 129 _ IE KINO 9453 Mini ITX Motherboard gt Disabled DEFAULT Normal POST messages displayed gt Enabled OEM Logo displayed instead of POST messages AddOn ROM Display Mode Force BIOS Use the AddOn ROM Display Mode option to allow add on ROM read only memory messages to be displayed gt Force BIOS DEFAULT The system forces third party BIOS to display during system boot gt Keep Current The system displays normal information during system boot gt Bootup Num Lock On Use the Bootup Num Lock BIOS option to specify if the number lock setting must be modified during boot up gt Off Does not enable the keyboard Number Lock automatically To use the 10 keys on the keyboard press the Number Lock key located on the upper left hand corner of the 10 key pad The Number Lock LED on the keyboard lights up when the Number Lock is engaged gt On DEFAULT Allows the Number Lock on the keyboard to be enabled automatically when the computer system boots up This allows the immediate use of the 10 key numeric keypad located on the right side of the keyboard To confirm this the Number Lock LED light on the keyboard is lit gt
41. PS 2 connector on the external peripheral interface connector See Figure 5 23 _ Figure 5 23 PS 2 Keyboard Mouse Connector 2 RiIechnology Corp KINO 9453 Mini ITX Motherboard Chapter 6 AMI BIOS _ KINO 9453 Mini ITX Motherboard 6 1 Introduction A licensed copy of AMI BIOS is preprogrammed into the ROM BIOS The BIOS setup program allows users to modify the basic system configuration This chapter describes how to access the BIOS setup program and the configuration options that may be changed 6 1 1 Starting Setup The AMI BIOS is activated when the computer is turned on The setup program can be activated in one of two ways 1 Press the DELETE key as soon as the system is turned on or 2 Press the DELETE key when the Press Del to enter SETUP message appears on the screen Ifthe message disappears before the DELETE key is pressed restart the computer and try again 6 1 2 Using Setup Use the arrow keys to highlight items press ENTER to select use the PageUp and PageDown keys to change entries press F1 for help and press Esc to quit Navigation keys are shown in m Move to previous item Move to next item Move to the item on the left hand side Right arrow Move to the item on the right hand side Esc key Main Menu Quit and not save changes into CMOS Status Pa
42. disk drives Drive locations can be identified by attaching stickers to the drive bays If a drive member of a RAID array should fail the failed drive can then be correctly identified Page 194 I _ 0 RTechnology Corp KINO 9453 Mini ITX Motherboard Do not accidentally disconnect the SATA drive cables Carefully route the cables within the chassis to avoid system down time E 2 Features and Benefits m Supports RAID levels 0 1 5 and 10 m Supports connectivity to two or more disk drives m Supported Operating Systems include Windows XP Windows Server 2003 and Windows Vista E 3 Accessing the Intel Matrix Storage Manager To access the Intel Matrix Storage Manager please follow the steps below Step 1 Connect SATA drives to the system Connect two or more SATA drives to the system Make sure the drives have the same capacity are the same type and have the same speed Make sure the SATA drives EXACTLY the same when they are configured in a RAID configuration If they are not the same size disk drive capacity is sacrificed and overall performance affected Step 2 Enable SATA drives in BIOS Start the computer and access the BIOS setup program Enable SATA support for all IDE devices Refer to the applicable BIOS configuration section in this user manual Page 195 _
43. disk drives such as IDE CD ROM drives check the specifications of the drive _ RITechnology Corp KINO 9453 Mini ITX Motherboard gt DMA Mode Auto Use the DMA Mode BIOS selection to adjust the DMA mode options gt Auto DEFAULT BIOS auto detects the DMA mode Use this value if the IDE disk drive support cannot be determined gt SWDMA0 Single Word DMA mode 0 selected with a maximum data transfer rate of 2 1MBps gt SWDMA1 Single Word DMA mode 1 selected with a maximum data transfer rate of 4 2MBps gt SWDMA2 Single Word DMA mode 2 selected with a maximum data transfer rate of 8 3MBps gt MWDMAO Multi Word DMA mode 0 selected with a maximum data transfer rate of 4 2MBps gt MWDMA1 Multi Word DMA mode 1 selected with a maximum data transfer rate of 13 3MBps gt MWDMA2 Multi Word DMA mode 2 selected with a maximum data transfer rate of 16 6MBps gt UDMA1 Ultra DMA mode 0 selected with a maximum data transfer rate of 16 6MBps gt UDMA1 Ultra DMA mode 1 selected with a maximum data transfer rate of 25MBps gt UDMA2 Ultra DMA mode 2 selected with a maximum data transfer rate of 33 3MBps gt UDMA3 Ultra DMA mode 3 selected with a maximum data transfer rate of 44MBps To use this mode it is required that an 80 conductor ATA cable is used _ KINO 9453 Mini ITX Motherboard gt UDMA4 Ultra DMA mode 4 selected with a
44. driver from the list in Figure 7 1 Step 2 Anew window opens Figure 7 7 Page 151 IE File Edit View Favorites Tools Help 4 E search Folders eu A Vista WINZK_XP WINXP64 Select an item to view its description See also My Documents My Network Places My Computer 4 objects 0 bytes My Computer 2 Figure 7 7 Select the Operating System Step 3 Select the operating system from those shown in Figure 7 7 Step 4 Anew window appears Figure 7 8 Page 152 mo RIechnology Corp KINO 9453 Mini ITX Motherboard Sn WINZK D xl File Edit View Favorites Tools Help Back gt Search GyFolders lt 2 Ui gt A Address a E 2 V GA WIN2K_XP gt Go readme 2k xp relnotes 2k win2k 1424 WIN2K XP Select an item to view its description See also My Documents My Network Places My Computer 3 objects 8 23 MB My Computer 2 Figure 7 8 VGA Driver Step 5 Click the installation program icon in Figure 7 8 Step 6 The Readme information file shown in Figure 7 9 appears Page 153 6 IE 2K AP bbk Production Version Releases Microsoft Windows 2000 Microsoft Windows XP Driver Revision 6 14 10 4497 Package 26137 Production Version
45. exe program icon in Figure 7 35 Page 174 KINO 9453 Mini ITX Motherboard 1 RIechnology Corp E 5 SATA INTEL File Edit View Favorites Tools Help Address a E 5 SATAVINTEL Go C Floppy Configuration Utility iata62 cd exe readme txt releasenotes html gt Type Application Size 19 3 19 3 g My Computer A Figure 7 35 SATA RAID Setup Program Icon Step 5 Figure 7 36 shows the InstallShield Wizard preparing to guide the user through the rest of the process Intel R Matrix Storage Manager InstallShield Wizard Preparing Setup Please wait while the InstallShield wizard prepares the setup Intel R Matrix Storage Manager Setup is preparing the InstallShield wizard which will guide you through the rest of the setup process Please wait InstallShield Figure 7 36 InstallShield Wizard Setup Screen Page 175 _ IE KINO 9453 Mini ITX Motherboard Step 6 Figure 7 37 shows the Matrix Storage Manager software configuring the installation process Intel R Matrix Storage Manager Setup Setup Status Intel R Matrix Storage Manager is configuring your new software installation Installing InstallShield Figure 7 37 Matrix Storage Manager Setup Screen Step 7 Figure 7 38 shows the Matrix Storage Manager welcome screen Intel R Matrix Storage Manager 6 2 0 20
46. features make the KINO 9453 a best choice for integrating into point of sale POS kiosk or digital signage applications The KINO 9453 supports up to two serial ATA SATA hard disk drives HDD with maximum transfer rates of 1 5 Gb s and up to eight USB 2 0 devices The dual PCI Express PCle Gigabit Ethernet GbE controllers provide GbE connectivity for network communication The KINO 9453 also has a PCI socket and a Mini PCI socket for system expansion Three RS 232 one RS 232 422 485 and one digital input output DIO port offer system integrators more choices of peripheral devices for the targeted application _ RITechnology Corp KINO 9453 Mini ITX Motherboard 1 1 1 KINO 9453 Benefits Some of the KINO 9453 benefits are listed below m Multiple display output options m Storage flexibility with support for SATA drives and IDE drives m Expandable system with PCI and mini PCI slots wm DDR2 support enables faster data transfers m Multiple I O interfaces provide connectivity to a broad range of external peripheral devices 1 1 2 KINO 9453 Features Some of the KINO 9453 features are listed below m Support for Socket 479 Intel Core 2 Duo or Core Solo CPUs m Maximum FSB of 667 MHz m Supports two 240 pin 400 MHz 533 MHz or 667 MHz 2GB DDR2 DIMM memory modules m Two SATA drives with transfer rates of 1 5 Gb s supported m Two Ultra ATA 100 Ultra ATA 66 or Ultra ATA 33 IDE HDDs supported m Eight USB 2
47. gt Forced Scaling Scaling is forced gt Disabled Scaling is disabled 6 7 2 SouthBridge Chipset Configuration The SouthBridge Chipset Configuration menu BIOS Menu 22 the Southbridge chipset to be configured cmm BIOS SETUP UTILITY South Bridge Chipset Configuration BIOS Menu 22 SouthBridge Chipset Configuration Page 140 dk _ RITechnology Corp KINO 9453 Mini ITX Motherboard ASF Support Enabled Use the ASF Support BIOS option to control the system s ability to connect to a remote management server gt Disabled The system will not communicate with a remote management server gt Enabled DEFAULT The Alert Standard Format ASF controller is activated and can communicate with a remote management server Audio Controller 97 Audio Only The Audio Controller option allows selection of the audio controller to use AC 97 Audio The on board AC 97 controller is enabled Only gt Disabled All audio controllers are disabled OnBoard LAN1 BCM5787M Enabled The OnBoard LAN1 BCM5787M option enables or disables the on board LAN1 gt Auto The on board LAN1 controller is automatically detected and enabled gt Enabled DEFAULT The on board controller is manually enabled gt Disabled The on board LAN1 controller is manually disabled On board LAN2 BCM5787M Enabled The On board LAN2 BCM5787M option enables or disables the on board LAN2 g
48. interface connectors m Audio devices m RJ 45 Ethernet cable m USB devices m VGA monitors m DVI port devices m Serial port devices m Mouse and keyboard To install these devices connect the corresponding cable connector from the actual device to the corresponding KINO 9453 external peripheral interface connector making sure the pins are properly aligned 5 7 1 Audio Connection Audio signals are interfaced through two phone jack connections The red phone jack is for Line Out and green is for MIC In Follow the steps below to connect audio devices to the KINO 9453 Step 1 Locate the audio phone jacks The location of the audio phone jacks are shown in Chapter 3 Step 2 Insert audio phone jack plugs Insert audio phone jack plugs into the audio phone jacks on the external peripheral interface See Figure 5 18 220 RIechnology Corp KINO 9453 Mini ITX Motherboard Figure 5 18 Audio Connectors 5 7 2 RJ 45 Ethernet Connection The KINO 9453 has two RJ 45 Ethernet connectors on the external peripheral interface panel for LAN communications Follow the steps below to connect an RJ 45 Ethernet connector to the KINO 9453 Step 1 Locate the RJ 45 connector The location of the RJ 45 connector is shown in Chapter 3 Step 2 Insert an RJ 45 plug Insert the RJ 45 plug of a LAN into the RJ 45 receptacle on the external peripheral interface See Figure 5 19 _ IT echnology Gor
49. screws Step 5 Connect the fan cable Connect the cooling kit fan cable to the fan connector on the motherboard Carefully route the cable and avoid heat generating chips and fan blades See Figure 5 5 Heatsink Figure 5 5 Connect the cooling fan cable lechnology Corp KINO 9453 Mini ITX Motherboard 5 3 3 DIMM Installation WARNING Only DDR2 memory module can be installed on the KINO 9453 Do not install DDR memory modules If a DDR memory module is installed on the KINO 9453 the KINO 9453 may be irreparably damaged Please make sure the purchased DIMM complies with the memory specifications of the KINO 9453 DIMM specifications compliant with the KINO 9453 are listed in Chapter 2 To install a DIMM into a DIMM socket please follow the steps below and refer to Figure 5 6 2 2 2 2 2 2 iq gt SS SS SSSSSSSSS Figure 5 6 Installing a DIMM Step 1 Open the DIMM socket handles The DIMM socket has two handles that secure the DIMM into the socket Before the DIMM can be inserted into the Socket the handles must be opened See Figure 5 6 KINO 9453 Mini ITX Motherboard _ RTechnology Corp Step 2 Align the DIMM with the socket The DIMM must be oriented in such a way that the notch in the middle of the DIMM must be aligned with the plastic bridge in the socket See Figure 5 6 Ste
50. specific DMA channel to a particular PCI PnP device gt Available DEFAULT The specified DMA is available to be used by PCI PnP devices gt Reserved The specified DMA is reserved for use by Legacy ISA devices Available DMA Channels are m Channel 0 m Channel 1 m Channel m Channel 5 m Channel 6 Page 127 m DM Channel 7 KINO 9453 Mini ITX Motherboard gt Reserved Memory Size Disabled Use the Reserved Memory Size BIOS option to specify the amount of memory that should be reserved for legacy ISA devices gt Disabled DEFAULT No memory block reserved for legacy ISA devices gt 16K 16KB reserved for legacy ISA devices gt 32K 32KB reserved for legacy ISA devices gt 64K 54KB reserved for legacy ISA devices 6 5 Boot Use the Boot menu BIOS Menu 15 to configure system boot options Boot Settimgs BIOS Menu 15 Boot Page 128 jm Corp KINO 9453 Mini ITX Motherboard 6 5 1 Boot Settings Configuration Use the Boot Settings Configuration menu BIOS Menu 15 to configure advanced system boot options Boot Settings Configuration lt gt Q lt lt SSs s ss sN S PP BIOS Menu 16 Boot Settings Configuration Quick Boot Enabled Use the Quick Boot BIOS option to make the computer speed up the boot process gt Disabled No
51. the Internal graphics device gt Disable gt Enable 1MB 1MB of memory used by internal graphics device gt Enable 8MB DEFAULT 8MB of memory used by internal graphics device PEG Port Auto Use the PEG Port option to enable or disable the PCI Express port gt Auto DEFAULT The system automatically detects the PEG port gt Disabled Installed PEG cards cannot function Force Disabled Use the PEG Force x1 option to convert a PCI express X16 slot into a PCI express X1 slot gt Disabled DEFAULT PCI express X16 slot runs in normal mode gt Enabled PCI express X16 slot runs in PCI express X1 mode 6 7 1 1 Video Function Configuration Use the Video Function Configuration menu to configure the video device connected to the system Page 137 KINO 9453 Mini ITX Motherboard Uideo Function Configuration Figure 6 1 Video Function Configuration DVMT Mode Select DVMT Mode Use the DVMT Mode Select option to select the Intel Dynamic Video Memory Technology DVMT operating mode gt Fixed Mode DvMT Mode gt Combo Mode Page 138 A fixed portion of graphics memory is reserved as graphics memory Graphics memory is dynamically allocated according to the system and graphics needs A fixed portion of graphics memory is reserved as graphics memory If more memory is needed graphics memory is dynamically alloca
52. u uu uu u 119 Legacy USB Support Enabled u u u uu 119 USB2 0 Controller Mode 5 222222222 2222 119 BIOS Handoft 119 USB Mass Storage Reset Delay 20 Sec 120 ts u E 121 Emulation Type 121 eia ui m 124 Plug amp Play O S No 124 PCI Latency Timer 64 eror evant pec I Duker dean ne nana 124 Page 182 4 2 IC _ RITechnology Corp KINO 9453 Mini ITX Motherboard Allocate IRQ to PCI VGA Yes U U L U L Uu 125 Palette Snooping Disabled J J 125 PCI IDE BusMaster Enabled J U U u Leere nennen nn 125 OffBoard IDE Card Auto u u u u u 126 Lie l l l AA AAEE AAAA 126 Channel Available u u U J J nennt nn 127 Reserved Memory Size Disabled U U u u
53. 01F DMA Controller 020 021 Interrupt Controller 040 043 System time 060 06F Keyboard Controller 070 07F System CMOS Real time Clock 080 09F DMA Controller 1 Interrupt Controller 0C0 0DF DMA Controller OFO OFF Numeric data processor 1F0 1F7 Primary IDE Channel 2F8 2FF Serial Port 2 COM2 378 37F Parallel Printer Port 1 LPT1 3B0 3BB Intel Graphics Controller 3C0 3DF Intel Graphics Controller 3F6 3F6 Primary IDE Channel 3F7 3F7 Standard floppy disk controller 3F8 3FF Serial Port 1 COM1 Table D 1 IO Address Map D 2 1st MB Memory Address Map Memory address Description 00000 9FFFF System memory A0000 BFFFF VGA buffer F0000 FFFFF System BIOS 1000000 Extend BIOS Table D 2 1 MB Memory Address Map Page 191 _ IE IT echnology Gorp D 3 IRQ Mapping Table System Timer IRQS KINO 9453 Mini ITX Motherboard RTC clock Keyboard IRQ9 ACPI Available IRQ10 LAN COM2 IRQ11 LAN USB2 0 SATA COM1 IRQ12 PS 2 mouse SMBus Controller IRQ13 FPU FDC IRQ14 Primary IDE Available Table D 3 IRQ Mapping Table D 4 DMA Channel Assignments IRQ15 Function Secondary IDE Available Available Floppy disk 8 bit transfer Available Cascade for DMA controller 1 Available Available Table D 4 IRQ Mapping Tab
54. 02 Welcome to the setup for the Intel R Matrix Storage Manager This setup program will install Intel R Matrix Storage Manager onto your computer It is strongly recommended that you exit all Windows programs before continuing setup Intel R Installation Frameworks Figure 7 38 Matrix Storage Manager Welcome Screen Page 176 _ 0 RTechnology Corp KINO 9453 Mini ITX Motherboard Step 8 Click NEXT and a warning appears Figure 7 39 Read the warning carefully and decide whether or not to continue the installation process Intel R Matrix Storage Manager 6 2 0 2002 Warning Please read the following information The driver you are about to install might be used to control the hard drive from which this computer is booting or to control a hard drive that contains Important data For this reason you cannot remove or uninstall this driver from the computer after installation However you can uninstall other non critical components The following components can be uninstalled Intel R Matrix Storage Console Help Documentation Start Menu Shortcuts System Tray Icon Service Event Monitor Service Click Next to continue the setup Click Cancel to exit the setup Intel R Installation Frameworks Figure 7 39 Matrix Storage Manager Warning Screen Step 9 Click NEXT and a license agreement appears Figure 7 40 Intel R Matrix Storage Manager 6 2 0 2002 4 License Agreement
55. 03 64 8 48e C Windows Server 2003 x86 64EM64T 8 48e Windows x86 64EM64T 8 48e C WindowsNTA4 8 48e 1 WindowsXP 8 48e CJ WindowsXP_IA64 8 48 8 readme txt Figure 7 21 Location Browsing Window Step 9 Click OK to continue A driver files location menu window appears Click NEXT to continue The driver is installed Page 162 _ e RITechnology Corp KINO 9453 Mini ITX Motherboard 7 6 Realtek HD Audio Driver ALC883 Installation To install the Realtek High Definition HD Audio driver please follow the steps below 7 6 1 BIOS Setup Step 1 Enter the BIOS setup To do this reboot the system and press DEL during POST Step 2 Go to the Southbridge Configuration menu Set the Audio Controller option to Azalia See Chapter 6 for details Step 3 Press F10 to save the changes and exit the BIOS setup The system reboots 7 6 2 Driver Installation Step 1 Insert the CD that came with the package Step 2 From the main driver menu navigate to X 4 AUDIO AC KIT883HD Windows or other appropriate OS X represents the system CD drive Anew window appears showing the folder contents Figure 6 26 ee File Edit View Favorites Tools Help Back gt Qsearch GyFolders Ui X A Address E M AUDIOYMAC KIT883HDYWindows Vista 5265 README WDM R140 Windows Select an item to view its description S
56. 14 19 50 4497 February 8 2006 NOTE This document refers to systems containing the following Intel chipsets Intel R 855GM Chipset v 4 Figure 7 9 GMA Driver Readme File Step 7 Click NEXT to extract the GMA driver files See Figure 7 10 Intel R Chipset Graphics Driver Software InstallShield R Wizard Extracting Files The contents of this package are being extracted Please wait while the InstallShield R Wizard extracts the files needed to install Intel R Chipset Graphics Driver Software on your computer This may take few moments Reading contents of package Ea Installshield Figure 7 10 GMA Driver File Extraction Step 8 The welcome screen shown in Figure 7 11 appears Page 154 _ RIechnology Corp KINO 9453 Mini ITX Motherboard Intel R Graphics Media Accelerator Driver Welcome to the setup for the Intel R Graphics Media Accelerator Driver This program will install the Intel R Graphics Media Accelerator Driver on this computer It is strongly recommended that you exit all Windows programs before continuing lt Back Cancel Intel R Installation Frameworks Figure 7 11 GMA Driver Installation Welcome Screen Step 9 To continue the installation process click NEXT Step 10 The license agreement in Figure 7 12 appears Page 155 _ IE IT echnology Gorp KINO 9453
57. 14 Pin Serial Port Connector Locations u u u 43 Figure 4 11 10 Pin Serial Port Connector Locations u u u u 44 Figure 4 12 SATA Drive Connector Locations eese nennen ennt nnns 45 Figure 4 13 SPDIF Connector Locations uu u u u u 46 Figure 4 14 Internal USB Connector Locations J u u nennen 47 Figure 4 15 KINO 9453 External Interface Connectors 48 Figure 4 16 Audio Connectors 48 Figure 4 17 VGA Connector IIIa siet etel 49 Figure 4 18 DVI I Connector Pinout Locations u u u u u 50 Figure 4 19 RJ 45 Ethernet Connector u u u u u u 51 Figure 4 20 PS 2 PIM OUTS 52 Figure 4 21 External Serial Port Connector uu u u u 53 Figure 5 1 Make sure the CPU socket retention screw is unlocked 60 Figure 5 2 Lock the CPU Socket Retention 61 Figure 5 3 IEI CF 479B RS Cooling Kit u u u u u
58. 2 2 External Interface Panel Dimensions External peripheral interface connector panel dimensions are shown in Figure 2 2 Figure 2 2 External Interface Panel Dimensions mm KINO 9453 Mini ITX Motherboard RI echnology Corp 2 3 Data Flow Figure 2 3 shows the data flow between the two on board chipsets and other components installed on the motherboard and described in the following sections of this chapter Socket 479 Intel Core 2 Duo Intel Core Duo Intel Core Solo 667MHz Ne Inte 945GME emory Bus PCle Bus x a er PCI Bus 2 x PCIe Gb E LAN Figure 2 3 Data Flow Block Diagram _ IE KINO 9453 Mini ITX Motherboard 2 4 Compatible Processors 2 4 1 Compatible Processor Overview The KINO 9453 supports the following socket 479 processors m Intel Core 2 Duo Mobile processors m Intel Core Duo processors m Intel Core Solo processors m Intel Celeron M processors The first three of the above processors communicate with the Intel amp 945GME GMCH through a 667 MHz FSB and the Intel Celeron amp M processor through a 533 MHz FSB Features of the supported processors are listed in Table 2 1 CPU Features Core 2 Duo Core Duo CoreTM Solo Celeron amp M Dual core Yes Yes No No Enhanced Halt State C1E No Yes No No Enhanced Intel Spee
59. 23 15 BOO ce p 128 Menu 16 Boot Settings Configuration sese 129 Menu 17 Boot Device Priority Settings 132 Menu 18 Removable Drives 133 19 22 2 2 134 A Rei cU 135 Menu 21 NorthBridge Chipset Configuration cease u u u 136 Menu 22 SouthBridge Chipset Configuration l l u u u 140 M u 23 EXIU u uu 142 Page XVIII iiie lt RiIechnology Corp KINO 9453 Mini ITX Motherboard Chapter 1 Introduction KINO 9453 Mini ITX Motherboard 1 1 Introduction Figure 1 1 KINO 9453 Embedded SBC The KINO 9453 Mini ITX form factor motherboard is an Intel dual core CPU platform Intel Core 2 Duo Core Duo and Core Solo CPU are all supported to enhance the system processing speed The KINO 9452 has a maximum front side bus FSB frequency of 667 MHz and contains two DDR2 SDRAM DIMM sockets that support up to 4 GB system memory The KINO 9453 supports diverse displays including one VGA display one DVI display and one LVDS display These multimedia
60. 62 Figure 5 4 Cooling Kit Support Bracket u u u u 63 Page XIII _ Figure 5 5 Connect the cooling fan cable eerie 63 Figure 5 6 Installing a DIMM 64 Figure 5 7 Jumper Locations U 65 Figure 5 8 AT ATX Power Select Jumper Location u u u 67 Figure 5 9 Clear CMOS Jumpetr U 68 Figure 5 10 COM Function Select Jumper Locations 70 Figure 5 11 RS 422 and RS 485 Termination Resister Jumper Locations 71 Figure 5 12 LVDS Screen Resolution Selection Jumper Pinout Locations 73 Figure 5 13 LVDS Voltage Selection Jumper Pinout 74 Figure 5 14 IDE Cable Connection 77 Figure 5 15 Dual RS 232 Cable Installation esses u u 78 Figure 5 16 SATA Drive Cable Connection u u u u 79 Figure 5 17 SATA Power Drive Connection u u u 79 Figure 5 18 Audio Connecto
61. 9453 Mini ITX Motherboard Step 4 Non RAID Disks After deleting the RAID volume the disks belonging to the volume will be shown as non RAID disks See Figure E 11 Intel R Matrix Storage Manager option ROM 5 0 0 1032 ICH R wRAIDS Copyright C 2003 05 Intel Corporation All Rights Reserved 1 Create RAID Volume 3 Reset Disks to Non RAID 4 Exit 1 RAID Volumes None defined Physical Disks Port Drive Model Serial Siz Type Status Vol ID Maxtor 67160 0 45 5 152 7GB WDC WD1600JD 75H UD UCAL92193433 149 0GB 1111 1 5 1 ENTER1 Select Menu Figure E 11 Non RAID Disks E 4 3 Resetting a Disk to Non RAID WARNING All data stored on the disk drive of a RAID volume is destroyed when resetting it to non RAID Make sure any data to be saved has been moved or backed up before resetting a disk to non RAID Page 203 KINO 9453 Mini ITX Motherboard Step 1 Select Reset Disk to Non RAID Use the arrow keys to highlight Reset Disk to Non RAID and press ENTER See Figure E 12 Intel R Matrix Storage Manager option ROM v5 0 0 1032 ICH R wRAIDS Copyright C 2003 05 Intel Corporation All Rights Reserved 1 1 Create RAID Volume 2 Delete RAID Volume Reset Disks to Non RAID 4 Exit 1 R ID Uolumes ID Name Level Strip Size Status Bootable 0 Uolume0 R IDO Stri
62. 9453 components and injury to the user Before and during the installation please DO the following m Read the user manual O user manual provides a complete description of the KINO 9453 installation instructions and configuration options m Wear an electrostatic discharge cuff ESD O Electronic components are easily damaged by ESD Wearing an ESD cuff removes ESD from the body and helps prevent ESD damage m Place the KINO 9453 on an antistatic pad O When installing or configuring the motherboard place it on an antistatic pad This helps to prevent potential ESD damage m Turn all power to the KINO 9453 off _ IE KINO 9453 Mini ITX Motherboard O When working with the KINO 9453 make sure that it is disconnected from all power supplies and that no electricity is being fed into the system Before and during the installation of the KINO 9453 DO NOT Remove any of the stickers on the PCB board These stickers are required for warranty validation Use the product before verifying all the cables and power connectors are properly connected Allow screws to come in contact with the PCB circuit connector pins or its components 5 2 2 Installation Checklist The following checklist is provided to ensure the KINO 9453 is properly installed All the items in the packing list are present The CPU is installed The CPU cooling kit is properly installed Acompatible memor
63. A as option to specify how to configure the available SATA devices gt IDE DEFAULT Enables the SATA devices as IDE devices RAID Enables the SATA devices as a RAID device gt AHCI Enables Native Command Queuing NCQ and SATA hot plug capability If AHCI is chosen enable the stagger Spinup Support and take all hard disks on board as master Configure SATA Channels Before PATA Use Configure SATA Channels option to specify how to configure the available SATA devices gt Behind The system detects the SATA devices after the IDE PATA devices gt Before DEFAULT system detects the SATA devices before the IDE PATA devices IDE Master and IDE Slave When entering setup BIOS auto detects the presence of IDE devices BIOS displays the status of the auto detected IDE devices The following IDE devices are detected and are shown in the IDE Configuration menu m Primary IDE Master m Primary IDE Slave m Secondary IDE Master KINO 9453 Mini ITX Motherboard m Secondary IDE Slave m Third IDE Master m Third IDE Slave The IDE Configuration menu BIOS Menu 4 allows changes to the configurations for the IDE devices installed in the system If an IDE device is detected and one of the above listed four BIOS configuration options are selected the IDE configuration options shown in Section 6 3 2 1 appear 6 3 2 1 IDE Master IDE Slave Use the IDE Master
64. C No will restart my computer later Click Finish then remove any installation media from the drives Figure 7 42 Matrix Storage Manager Setup Complete Step 13 The confirmation screen offers the option of restarting the computer now or later For the settings to take effect the computer must be restarted Click FINISH to restart the computer Page 179 _ IE KINO 9453 Mini ITX Motherboard Appendix A BIOS Options Page 180 ks ae 1 RITechnology Corp KINO 9453 Mini ITX Motherboard System u 90 System Time DOCGOCXX uuu lll 91 System Date XX XX XX p 91 ATA IDE Configuration Enhanced U u u nennen nennen 94 Configure SATA as IDE 95 Configure SATA Channels Before PATA 95 IDE Master and IDE Slave U U u u u uu uu u u u 95 Didot 96 97 Bp 97 LBA Large Mode Auto J u 97 Block Multi Sector Transfer J J J J 98 PIO D
65. DAC and hot plug CRT support supports analog CRT monitors up to QXGA 2 5 3 2 Intel 945GME LVDS Support A 30 pin LVDS crimp connector is interfaced to the Intel 945GME graphics engine The Intel 945GME internal graphics engine supports LVDS displays with the following features m Upto UXGA monitors with a maximum resolution of 1600 x 1200 m 18 bit or 24 bit 25 MHz to 112 MHz single channel or dual channel LVDS screens m CPIS 1 5 compliant LVDS screens 2 5 3 3 Intel 945GME SDVO Support The Intel 945GME internal graphics engine has the following SDVO output features m Concurrent operation of PCle x1 with SDVO m Two SDVO ports supported O SDVO is muxed onto the PCle pins DVI 1 0 support for external digital monitor O Only Downstream HDCP support O Display hot plug support 2 5 4 Intel 945GME Direct Media Interface DMI Intel 945GME Northbridge GMCH is connected to the Intel ICH7 M Southbridge Chipset through the chip to chip Direct Media Interface DMI Features of the Intel 945GME DMI are listed below m 2 GB s 1 GB s in each direction bus speed m 32 bit downstream address _ IE KINO 9453 Mini ITX Motherboard 2 6 Intel ICH7 M Southbridge Chipset 2 6 1 Intel ICH7 M Overview The Intel ICH7 M Southbridge chipset is connected to the Intel 945GME Northbridge GMCH through the chip to chip Direct Media Interface DMI Some of the features of the Intel
66. Delete RAID Volume 3 Reset Disks to Non RAID 4 Exit RAID Volumes None defined Physical Disks Port Drive Model Serial i Type Status Vol ID 2 Maxtor 6 0 4 2 5 Non RAID Disk 3 WDC 40166 934 4 Non R ID Disk 1111 1 1 1 ENTER1 Select Menu Figure 1 Matrix Storage Manager Menu Step 2 Name the RAID volume Enter a name for the RAID volume or press ENTER to accept the default volume name Upper and lower case alphabetic numeric space and underscore characters are all applicable for naming an array See Figure E 2 Intel R Matrix Storage Manager option ROM v5 0 0 1032 ICH R wRAIDS Copyright C 2003 05 Intel Corporation All Rights Reserved 1 Name Uolume0 RAID Level RAIDO Stripe Disks el Strip Size 128KB Capacity 298 0 GB Create Volume Enter a string between 1 and 16 characters in length that can be used to uniquely identify the RAID volume This name is case sensitive and cannot contain special characters 1 Tab Next ESC1 Previous Menu 1 1 Figure E 2 Create RAID Volume Name Page 197 lechnology Corp Step 3 Choose the RAID level Select a RAID level from the list RAID levels include KINO 9453 Mini ITX Motherboard RAID 0 1 5 and 10 See Figure E 3 RAID 0 and RAID1 levels require a minimum of two hard drives RAID 10 level requires
67. FAN1 Fan connector Northbridge 3 pin wafer _ 1 Fan connector System 3 pin wafer SYS_FAN1 Front panel connector 14 pin header F_PANEL1 IDE Interface connector 40 pin box header IDE1 LVDS connector 30 pin crimp LVDS1 LCD backlight connector 6 pin wafer connector CN1 PCI slot 124 pin slot PCl2 Mini PCI Card slot 124 pin slot MINIPCI Serial ATA SATA connector 7 pin SATA connector SATA1 Serial ATA SATA connector 7 pin SATA connector SATA2 Serial port connector COM 3 14 pin header COM3 Serial port connector COM 4 10 pin header COM4 SPDIF connector 5 pin header SPDIF1 USB connector 8 pin header USB4 USB connector 8 pin header USB5 Table 4 1 Peripheral Interface Connectors _ IE IT echnology Gorp KINO 9453 Mini ITX Motherboard 4 1 3 External Interface Panel Connectors Table 4 2 lists the rear panel connectors on the KINO 9453 Detailed descriptions of these connectors can be found in Section 4 3 Connector Type Label Audio connector Audio jack AUDIO Ethernet connector RJ 45 LAN USB1 Ethernet connector RJ 45 LAN USB2 Keyboard and mouse connector PS 2 connector KBMS1 RS 232 serial port connector Male DB 9 COM1 RS 232 serial port connector Male DB 9 COM2 USB ports USB port LAN USB1 USB ports USB port LAN USB2 VGA port connector Female DB 15 VIDEO DVI connector DVI connector VIDEO Table 4 2 Rear Panel Connectors 4 2 Internal Peripheral Con
68. IEI Technology Corp MODEL KINO 9453 User Manual Rev 2 00 July 2008 KINO 9453 Mini ITX Motherboard Revision Date Version Changes 2008 07 v2 00 Changed Northbridge chipset from Intel 945GM to Intel 945GME Added system fan connector 5 5 1 information Added three jumper information AT ATX power mode select jumpers LVDS screen resolution select jumper COMS mode select jumpers RS 422 485 terminal resister jumpers 2007 04 v1 00 Initial Release 29 4 54 4272 KINO 9453 Mini ITX Motherboard _ e RITechnology Corp Copyright COPYRIGHT NOTICE The information in this document is subject to change without prior notice in order to improve reliability design and function and does not represent a commitment on the part of the manufacturer In no event will the manufacturer be liable for direct indirect special incidental or consequential damages arising out of the use or inability to use the product or documentation even if advised of the possibility of such damages This document contains proprietary information protected by copyright All rights are reserved No part of this manual may be reproduced by any mechanical electronic or other means in any form without prior written permission of the manufacturer TRADEMARKS All registered tradem
69. ITX Motherboard Figure 5 10 COM 3 Function Select Jumper Locations 5 4 4 RS 422 or RS 486 Termination Resister Jumper Label JP8 and JP9 Jumper Type 2 pin header Jumper Settings See Table 5 5 and Table 5 6 Jumper Location See Figure 5 11 The JP8 sets the RS 422 Termination Resister while JP9 sets the RS 485 Termination Resister The RS 422 and RS 485 Termination Resister settings are shown in Table 5 5 and Table 5 6 JP8 Description Open Normal Operation Default Short Termination Resister Setting Table 5 5 RS 422 Termination Resister Jumper Settings c RITechnology Corp KINO 9453 Mini ITX Motherboard JP9 Description Open Normal Operation Default Short Termination Resister Setting Table 5 6 RS 485 Termination Resister Jumper Settings The RS 422 or RS 485 Termination Resister jumper location is shown in Figure 5 11 EEO MM n Figure 5 11 RS 422 and RS 485 Termination Resister Jumper Locations 5 4 5 LVDS Screen Resolution Selection Jumper Label JP2 Jumper Type 8 pin header Jumper Settings See Table 5 8 Jumper Location See Figure 5 13 The LVDS Screen Resolution Selection jumper allows the LVDS screen resolution to be set The LVDS Screen Resolution Selection jumper settings are shown in Table 5 8 KINO 9453 Mini ITX
70. Mini ITX Motherboard Intel R Graphics Media Accelerator Driver License Agreement Please read the following license agreement carefully Press the Page Down key to view the rest of the agreement INTEL SOFTWARE LICENSE AGREEMENT IHV 7 ISV Distribution amp 4 Single User IMPORTANT READ BEFORE COPYING INSTALLING OR USING Do not use or load this software and any associated materials collectively the Software until you have carefully read the following terms and conditions By loading or using the Software you agree to the terms of this amp greement If you do not wish to so agree do not install or use the Software Please Also Note f you are an Original Equipment Manufacturer OEM Independent Hardware Vendor or Independent Software Vendor ISV this complete LICENSE AGREEMENT applies xl You must accept all of the terms of the license agreement in order to continue the setup program Do you accept the terms Intel R Installation Frameworks Figure 7 12 GMA Driver License Agreement Step 11 Click the YEs in Figure 7 12 to continue Step 12 The installation notice shown in Figure 7 13 appears Installing version 6 14 10 4497 Figure 7 13 GMA Driver Installing Notice Step 13 A confirmation screen shown in Figure 7 14 appears Page 156 _ e RTechnology Corp The setup for the Intel R Graphics Media Accelerator Driver is c
71. NO 9453 Embedded 2 Figure 1 2 KINO 9453 Overview u u u u u u 4 Figure 2 1 KINO 9453 Dimensions mm U U enne ennemi nnns nnns 9 Figure 2 2 External Interface Panel Dimensions mm u u 10 Figure 2 3 Data Flow Block Diagram U u u u u u u 11 Figure 2 4 240 pin DIMM Sockets 2 14 Figure 4 1 Connector and Jumper Locations u u u u u 30 Figure 4 2 Fan Connector Locations U uu u u u u 33 Figure 4 3 Front Panel Connector Location esee u u u u 34 Figure 4 4 GPIO Connector Location u u u u u u u u 35 Figure 4 5 IDE Device Connector Location u u u u u 36 Figure 4 6 LCD Backlight Connector Location u u 38 Figure 4 7 LVDS LCD Connector Location u u u u u 39 Figure 4 8 Mini PCI Slot Location 40 Figure 4 9 Power Connector Location u u u u u 42 Figure 4 10
72. O LAN USB2 263 m LAN USB1 AUDIO Figure 4 15 KINO 9453 External Interface Connectors 4 3 1 Audio Connectors CN Label AUDIO CN Type Audio jack CN Location See Figure 4 15 CN Pinouts See Figure 4 16 m Line Out port Lime Connects a headphone or a speaker In 4 6 8 channel configuration the function of this port becomes Front Speaker Out Microphone Pink Connects a microphone Line Out micin ine Figure 4 16 Audio Connectors 4 3 2 CRT Connector CN Label VIDEO CN Type 15 pin female connector CN Location See Figure 4 15 Page 48 _ e RITechnology Corp KINO 9453 Mini ITX Motherboard CN Pinouts See Table 4 16 The standard 15 pin VGA connector connects to a CRT or LCD display monitor 15 11 Figure 4 17 VGA Connector PIN NO DESCRIPTION PIN NO DESCRIPTION 1 RED 2 GREEN 3 BLUE 4 N C 5 GND 6 GND 7 GND 8 GND 9 vcc 10 GND 11 N C 12 DDC DAT 13 HSYNC 14 VSYNC 15 DDC CLK Table 4 16 VGA Connector Pinouts 4 3 3 DVI Connector CN Label VIDEO CN Type DVI interface with analog RGB signal CN Location See Figure 4 15 CN Pinouts See Figure 4 18 and Table 4 17 The KINO 9453 has an external DVI connector _ KINO 9453 Mini ITX Motherboard o v ears es ne 2 21 22 5 Figure 4 18 DVI I Connector Pin
73. ODUCTION 2 LI KINO 9453 B hB6fif su 3 1 1 2 KINO 9453 T 3 1 2 KINO 9453 OVERVIEW TL 3 1 2 1 KINO 9453 Overview 3 1 2 2 KINO 9453 Peripheral Connectors and Jumpers 4 1 253 Technical Specifications 5 2 DETAILED SPECIFICATIONS 8 Del OVERVIEW M A REA 9 2 2 DIMENSIONS 9 2 21 Board EES 9 2 2 2 External Interface Panel Dimensions 10 2 3 DATA FLOW M 11 ZA COMPATIBLE PROCESSORS apuqa MA EEE 12 2 4 1 Compatible Processor Overview 12 2 4 2 Support ed PEODOSSUES cad ER M etui rx qua bead ta UA 12 2 5 INTEL 945GME NORTHBRIDGE CHIPSET ettet 13 254 Intel 945GME Overview ctim Dam abl OH DAN 13 2 5 2 Intel 945GME Memory SuUpDDF 13 2 5 3 Intel 945GME Integrated Graphics 14 2 5 3 1 Intel 945GME Analog CRT Suppotrt 15 2 5 3 2 Intel 945GME LVDS 15 2 5 3 3 Intel
74. PS 2 Mouse Support Auto Use the PS 2 Mouse Support option adjusts PS 2 mouse support capabilities Page 130 _ RITechnology Corp KINO 9453 Mini ITX Motherboard gt Disabled PS 2 mouse support is disabled and prevented from using system resources gt Enabled Allows the system to use a PS 2 mouse gt Auto DEFAULT The system auto adjusts PS 2 mouse support gt BootFrom LAN Support Disabled Use the Boot From LAN Support option to enable the system to be booted from a remote system gt Disabled DEFAULT Cannot be booted from a remote system through the LAN gt Enabled Can be booted from a remote system through the LAN 6 5 2 Boot Device Priority Use the Boot Device Priority menu BIOS Menu 17 to specify the boot sequence from the available devices Possible boot devices may include m 1 FLOPPY DRIVE m HDD CD DVD Page 131 HN BIOS SETUP UTILITY KINO 9453 Mini ITX Motherboard Boot Device Priority BIOS Menu 17 Boot Device Priority Settings Page 132 2 RIechnology Corp KINO 9453 Mini ITX Motherboard 6 5 3 Removable Drives Use the Removable Drives menu BIOS Menu 18 to specify the boot sequence of the available FDDs When the menu is opened the FDDs connected to the system are listed as shown below m st Drive ist FLOPPY DRIVE m 2nd Drive 2nd FLOPPY DRIVE pA NOTE Only the dr
75. S PCI Slot 1 is selected as the location PCI IDE adapter card Only select adapter card is installed in PCI Slot 1 PCI Slot 2 is selected as the location PCI IDE adapter card Only select adapter card is installed in PCI Slot 2 PCI Slot 3 is selected as the location PCI IDE adapter card Only select adapter card is installed in PCI Slot 3 PCI Slot 4 is selected as the location PCI IDE adapter card Only select adapter card is installed in PCI Slot 4 PCI Slot 5 is selected as the location PCI IDE adapter card Only select adapter card is installed in PCI Slot 5 PCI Slot 6 is selected as the location PCI IDE adapter card Only select adapter card is installed in PCI Slot 6 of the OffBoard this slot if the of the OffBoard this slot if the of the OffBoard this slot if the of the OffBoard this slot if the of the OffBoard this slot if the of the OffBoard this slot if the Use the IRQ address to specify what IRQs can be assigned to a particular peripheral device Page 126 _ RITechnology Corp KINO 9453 Mini ITX Motherboard gt Available DEFAULT The specified IRQ is available to be used by PCI PnP devices gt Reserved The specified IRQ is reserved for use by Legacy ISA devices Available IRQ addresses are m IRQ3 m IRQ4 m IRQ5 m IRQ7 m IRQQ m 18010 m IRQ11 m IRQ14 m 1809015 DMA Channel Available Use the DMA Channel option to assign a
76. S Menu 3 lists the following CPU details m Manufacturer Lists the name of the CPU manufacturer m Brand String Lists the brand name of the CPU being used m Frequency Lists the CPU processing speed FSB Speed Lists the FSB speed m Cache L1 Lists the CPU L1 cache size m Cache L2 Lists the CPU L2 cache size 6 3 2 IDE Configuration Use the IDE Configuration menu BIOS Menu 4 to change and or set the configuration of the IDE devices installed in the system 1 KINO 9453 Mini ITX Motherboard BIOS SETUP UTILITY IDE Configuration BIOS Menu 4 IDE Configuration Configuration Enhanced The ATA IDE Configuration BIOS option allows the user to configure the ATA IDE device mode gt Disabled Compatible Enhanced DEFAULT Disable all ATA IDE ports No Primary Secondary IDE mode is presented for configuration Up to 6 HDDs can be used four for SATA and the other for PATA IDE If this option is selected Legacy IDE Channels option is presented for configuration The motherboard allows up to 6 HDDs to use and SATA drives can be configured into RAID volumes If this option is selected Configure SATA as and Configure _ RITechnology Corp KINO 9453 Mini ITX Motherboard SATA channels options are presented for configuration gt Configure SATA as IDE Use the Configure SAT
77. Slope PWM 1 1 PWM wsiccscccssccctsccccanecneauecaccsnseancesnaesacenaesenedenadeessetnectceusesacteaneenatevace ance 107 CPU Fan PWM Control 100 l l uuu u u u u 108 Hardware Health Monitoring 108 Suspend Mode S3 STR u sassa qa 110 Power Management APM Enabled u u u u 111 Page 181 Power Supply Mode ATX 1 u UI 112 Restore on AC Power Loss by IO Power O 112 Resume on Ring Disabled 1 eerie nnn nnn nin 112 Resume on PME Disabled 112 Resume RTC Alarm Disabled U U U J J 113 RIC Alarm Date uy u u L aS cca Ernie etae Deci veda died 113 System TIm x EE 113 Resume On PCI Express WAKE Enabled J J 113 Remote Access Disabled 114 Serial Port Number 4 encore vache cede tuer
78. Termination Resister JP9 2 pin header Table 5 1 Jumpers 5 4 1 AT ATX Power Select Jumper Settings Jumper Label JP5 and JP6 Jumper Type 2 pin header Jumper Settings See Table 5 2 Jumper Location See Figure 5 8 The AT ATX Power Select jumper specifies the systems power mode as AT or ATX AT ATX Power Select jumper settings are shown in Table 5 2 JP5 Description Short Use ATX power Default Open Use AT power JP6 Description Short Use AT power Open Use ATX power Default Table 5 2 AT ATX Power Select Jumper Settings The location of the AT ATX Power Select jumper is shown in Figure 5 8 below RITechnology Corp o en sss Figure 5 8 AT ATX Power Select Jumper Location 5 4 2 Clear CMOS Jumper Jumper Label JP3 Jumper Type 3 pin header Jumper Settings See Table 5 3 Jumper Location See Figure 5 9 If the KINO 9453 fails to boot due to improper BIOS settings the clear CMOS jumper clears the CMOS data and resets the system BIOS information To do this use the jumper cap to close pins 2 and 3 for a few seconds then reinstall the jumper clip back to pins 1 and 2 If the CMOS Settings Wrong message is displayed during the boot up process the fault may be corrected by pressing the F1 to enter the CMOS Setup menu Do one of the following
79. The KINO 9453 has the following external peripheral interface connectors on the board rear panel m 2 x Audio jacks m 1x VGA connector m 2 Ethernet connectors 2 Keyboard Mouse connectors m 2x Serial port connectors m 1x DVI connector m 4x USB 2 0 ports The KINO 9453 has the following on board jumpers m AT ATX power mode selection m Clear CMOS m mode selection RS 232 422 485 m RS 422 or RS 485 termination resister m LVDS LCD voltage selection m LVDS screen resolution selection 1 2 3 Technical Specifications KINO 9453 technical specifications are listed in Table 1 1 See Chapter 2 for details sme Socket 479 Intel CoreTM 2 Duo Mobile Socket 479 Intel CoreTM Duo Socket 479 Intel Core Solo _ IE KINO 9453 Mini ITX Motherboard LM 0 02 479 Intel Celeron FSB 533 MHz socket Front Side Bus 533 MHz or 667 MHz Northbridge Intel 945GME System Chipset Southbridge Intel ICH7 M Two 240 pin 400 MHz 533 MHz or 667 MHz DDR2 SDRAM Memory DIMMs supported system max 4 GB CRT Integrated in the Intel 945GME to support CRT Display DVI Integrated in the Intel 945GME by SDVO interface LVDS Dual channel 18 bit or 24 bit LVDS LCD panel lN m Broadcom BCM5787M PCle GbE controllers N Three RS 232 serial ports one internal two external id One RS 232 RS 422 or RS 485 serial port 5 pe One 40 pi
80. _ IT echnology Gorp KINO 9453 Mini ITX Motherboard Figure 5 15 Dual RS 232 Cable Installation Step 3 Secure the bracket The dual RS 232 connector has two D sub 9 male connectors secured on a bracket To secure the bracket to the chassis please refer to the reference material that came with the chassis 5 6 4 SATA Drive Connection The KINO 9453 is shipped with two SATA drive cables and one SATA drive power cable To connect the SATA drives to the connectors please follow the steps below Step 1 Locate the connectors The locations of the SATA drive connectors are shown in Chapter 3 Step 2 Insert the cable connector Press the clip on the connector at the end of the SATA cable and insert the cable connector into the onboard SATA drive connector See Figure 5 16 220 RIechnology Corp KINO 9453 Mini ITX Motherboard Figure 5 16 SATA Drive Cable Connection Step 3 Connect the cable to the SATA disk Connect the connector on the other end of the cable to the connector at the back of the SATA drive See Figure 5 17 Step 4 Connect the SATA power cable Connect the SATA power connector to the back of the SATA drive See Figure 5 17 Figure 5 17 SATA Power Drive Connection _ IE IT echnology Gorp KINO 9453 Mini ITX Motherboard 5 7 External Peripheral Interface Connection The following external peripheral devices can be connected to the external peripheral
81. a minimum of four hard drives RAID5 level requires a minimum of three hard drives e AID Leve 8120 51 Figure E 3 Choose the Raid Level Page 198 diia 42 2 IC NIS aN Moo 5 Y KINO 9453 Mini ITX Motherboard Figure E 4 Select the Stripe Size Step 5 Enter the Volume Capacity Enter the volume capacity or press ENTER to accept the default capacity See Figure E 5 Figure E 5 Enter the Volume Capacity Page 199 WS T BEPERAS m gt 9 gt 45257 Pchnology Corp 49 4 mue KINO 9453 Mini ITX Motherboard Step 6 Create the RAID Volume Press ENTER to create the RAID volume as specified See Figure E 6 reate Volume Figure E 6 Create the RAID Volume Step 7 Create RAID Volume Verification After reading the warning press Y to create the RAID volume as specified or N to return to the Create RAID Volume menu See Figure E 7 Are you sure you want to create this volume Y N Figure E 7 Create RAID Volume Verification Page 200 KINO 9453 Mini ITX Motherboard E 4 2 Deleting a RAID Volume WARNING _ RIechnology Corp All data stored on the member drives of a RAID volume are destroyed during the RAID deletion process Make sure any data to be save
82. al Interface Connectors J 31 Table 4 2 Rear Panel Connectors U u u u u u u 32 Table 4 3 Fan Connector Pinouts U u u u u u uu 33 Table 4 4 Front Panel Connector Pinouts u u u u u u 34 Table 4 5 GPIO Connector Pinouts U u u u u u u 35 Table 4 6 IDE Connector Pinouts U U u u u uu uu u 37 Table 4 7 LCD Backlight Connector Pinout J 38 Table 4 8 LVDS LCD Connector Pinouts 39 Table 4 9 Mini PCI Slot Pinouts J u U J J J 41 Table 4 10 Power Connector Pinouts 42 Table 4 11 COM2 Pinouts U U u u u u u u u J 43 Table spera ccce M 44 Table 4 13 SATA Drive Connector u u u 45 4 14 5 G 46 Table 4 15 USB3 USB4 Pinouts u u u u u 47 Table 4 16 VGA Connector Pinouts U
83. and IDE Slave configuration menu to view both primary and secondary IDE device details and configure the IDE devices connected to the system a Primary IDE Master Device Not Detected BIOS Menu 5 IDE Master and IDE Slave Configuration gt Type Auto Page 96 _ RITechnology Corp KINO 9453 Mini ITX Motherboard Use the Type BIOS option select the type of device the AMIBIOS attempts to boot from after the Power On Self Test POST is complete gt Not Installed BIOS is prevented from searching for an IDE disk drive on the specified channel gt Auto DEFAULT The BIOS auto detects the IDE disk drive type attached to the specified channel This setting should be used if an IDE hard disk drive is attached to the specified channel gt CD DVD The CD DVD option specifies that an IDE CD ROM drive is attached to the specified IDE channel The BIOS does not attempt to search for other types of IDE disk drives on the specified channel gt ARMD This option specifies an ATAPI Removable Media Device These include but are not limited to gt ZIP gt LS 120 Mode Auto Use the LBA Large Mode option to disable or enable BIOS to auto detects LBA Logical Block Addressing LBA is a method of addressing data on a disk drive In LBA mode the maximum drive capacity is 137 GB gt Disabled BIOS is prevented from using the LBA mode control on the specified c
84. arks and product names mentioned herein are used for identification purposes only and may be trademarks and or registered trademarks of their respective owners Page Ill _ Manual Conventions WARNING Warnings appear where overlooked details may cause damage to the equipment or result in personal injury Warnings should be taken seriously Warnings are easy to recognize The word warning is written as WARNING both capitalized and bold and is followed by text The text is the warning message A warning message is shown below WARNING This is an example of a warning message Failure to adhere to warning messages may result in permanent damage to the KINO 9453 or personal injury to the user Please take warning messages seriously CAUTION Cautionary messages should also be heeded to help reduce the chance of losing data or damaging the KINO 9453 Cautions are easy to recognize The word caution is written as CAUTION both capitalized and bold and is followed The italicized text is the cautionary message A caution message is shown below 4272 IC _ e RIechnology Corp KINO 9453 Mini ITX Motherboard This is an example of a caution message Failure to adhere to cautions messages may result in permanent damage to the KINO 9453 Please take caution messages seriously A NOTE
85. be damaged The CPU Temp Limit of Full option can only be set if the CPU FAN Mode Setting option is set to Automatic Mode Use the CPU Temp Limit of Full option to select the CPU temperature at which the cooling fan starts to rotate at full speed When the CPU temperature exceeds the temperature specified in this option the fan starts to rotate at full Page 106 Ener I _ RITechnology Corp KINO 9453 Mini ITX Motherboard speed To select a value select the CPU Temp Limit of Full option and enter a decimal number between 000 and 127 The temperature range is specified below Minimum Value 0 C Maximum Value 127 C CPU Fan Start PWM 070 The CPU Fan Start PWM option can only be set if the CPU FAN Mode Setting option is set to Automatic Mode Use the CPU Fan Start PWM option to select the PWM mode the fan starts to rotate with after the temperature specified in the CPU Temp Limit of Start is exceeded The Super I O chipset supports 128 PWM modes To select a value select the CPU Fan Start PWM option and enter a decimal number between 000 and 127 The temperature range is specified below PWM Minimum Mode 0 PWM Maximum Mode 127 gt Slope PWM 1 1 PWN The Slope PWM 1 option can only be set if the CPU FAN Mode Setting option is set to Automatic Mode Use the Slope PWM 1 option to select the linear rate at which the PWM mode increases with respect to an increase in tempera
86. button in Figure 7 31 the installation of the driver begins Figure 7 32 Realtek 97 Audio Setup 5 18 Setup Status InstallShield Figure 7 32 AC 97 Audio Driver Installation Begins Page 172 1 RIechnology Corp KINO 9453 Mini ITX Motherboard Step 9 After the driver installation process is complete a confirmation screen shown in Figure 7 33 appears Realtek 97 Audio Setup 5 18 InstallShield Wizard Complete Setup has finished installing Realtek AC 37 Audio on your Install Siveld Figure 7 33 97 Audio Driver Installation Complete Step 10 The confirmation screen shown in Figure 7 33 allows you to restart the computer immediately after the installation is complete or to restart the computer later For the settings to take effect the computer must be restarted Once you have decided when to restart the computer click the FINISH button Page 173 KINO 9453 Mini ITX Motherboard 7 8 Intel Matrix Storage Manager Installation To install the Intel Matrix Storage Manager driver please follow the steps below Step 1 Select SATA from the list in Figure 7 1 Step 2 Anew window opens Figure 7 34 gt 3 object s D bytes g My Computer 2 Figure 7 34 SATA RAID Driver Installation Program Step 3 Double click the INTEL folder Step 4 Double click the iata62_cd
87. ch the console redirection is made The following configuration options are available m 115200 8 n 1 DEFAULT m 57600 8 n 1 m 38400 8 n 1 m 19200 8 n 1 09600 8 n 1 Page 115 KINO 9453 Mini ITX Motherboard Identical baud rate setting musts set the host management computer running a terminal software and the slave gt Flow Control None Use the Flow Control option to report the flow control method for the console redirection application gt None DEFAULT No control flow gt Hardware Hardware is set as the console redirection gt Software Software is set as the console redirection Redirection After BIOS POST Always Use the Redirection After BIOS POST option to specify when console redirection should occur gt Disabled The console is not redirected after POST gt Boot Loader Redirection is active during POST and during Boot Loader gt Always DEFAULT Redirection is always active Some OSes may not work if set to Always gt Terminal Type ANSI Use the Terminal Type BIOS option to specify the remote terminal type gt ANSI DEFAULT The target terminal type is ANSI Page 116 Ener IC _ RITechnology Corp KINO 9453 Mini ITX Motherboard gt VT100 The target terminal type is VT100 vt utFs The target terminal type is VT UTF8 VT UTF8 Combo Key Support Disabled U
88. d has been moved or backed up before deleting a RAID volume Step 1 Select Delete RAID Volume Use the arrow keys to highlight Delete RAID Volume and press ENTER See Figure E 8 Intel R Matrix Storage Manager option ROM v5 0 0 1032 ICH R wRAIDS Copyright C 2003 05 Intel Corporation All Rights Reserved t 1 1 Create R ID Uolume p Delete RAID Volune 3 4 Reset Disks to Non R ID Exit 1 RAID Volumes ID Name Level Strip Size Status Bootable 0 Uolume0 RAIDO Stripe 128KB 298 0GB Yes Physical Disks Port Drive Model Serial Size Type Status Vol ID 2 Maxtor 6Y160MO Y45TDYSE 152 261 WDC UD1600JD 5H UD UC L92193433 149 0GB 1111 1 3 1 ENTER1 Select Menu Figure 8 Delete Volume Menu Page 201 lechnology Corp KINO 9453 Mini ITX Motherboard Step 2 Select RAID Volume to be Deleted Use the arrow keys to highlight the RAID volume to be deleted and press ENTER See Figure E 9 o 00 0 eve Bootable olume RAIDO Stripe 298 0GB Normal Yes Figure E 9 Select RAID Volume to be Deleted Step 3 Delete Volume Verification After reading the warning press Y to delete the specified RAID volume or N to return to the Delete Volume menu See Figure E 10 Figure E 10 Delete Volume Verification Page 202 Ener IC Srdo Corp KINO
89. dstep Technolgy yes Yes No Execute Disable Bit Yes Yes Yes Yes Intel EM64T Yes No No No Intel Virtualization Technology Yes Yes No No Table 2 1 Processor Features 2 4 2 Supported Processors Specifications for the compatible processors are listed in Table 2 2 below Family sSpec CPU Speed Processor Bus Speed Mfg Tech Stepping Cache Size Core 2 Duo Mobile 5195 2 33 GHz T7600 667 MHz 65 nm B2 4 MB 5195 2 16 GHz T7400 667 MHz 65 nm B2 4 MB SL9SL 2 GHz T7200 667 MHz 65 nm B2 4 MB 5195 1 83 GHz T5600 667 MHz 65 nm B2 2 MB 4272 IC _ RITechnology Corp KINO 9453 Mini ITX Motherboard Family sSpec CPU Speed Processor Bus Speed Mfg Tech Stepping Cache Size 51950 11 66 GHz T5500 667 MHz 65 nm B2 2 MB Core Duo SL8VT 2 GHz T2500 667 MHz 65 nm CO 2 MB SL9DN 1 66 GHz T2300E 667 MHz 65 nm CO 2 MB Core Solo SL92X 1 83 GHz T1400 667 MHz 65 nm CO 2 MB Celeron M SL9VA 11 73 GHz 530 533 MHz 65 nm A1 1 MB SL9LF 11 86 GHz 440 533 MHz 65 nm DO 1MB Table 2 2 Supported Processors 2 5 Intel 945GME Northbridge Chipset 2 5 1 Intel 945GME Overview The Intel 945GME Northbridge chipset has the Generation 3 1 Intel Integrated Graphics Engine and the Intel Graphics Media Accelerator 950 Intel GMA 950 The integrated graphics and memory controller hub GMCH facilitates the flow of infor
90. e BIOS 2 8 3 5 Super I O Keyboard Controller The Super I O keyboard controller can execute the 8042 instruction set Some of the keyboard controller features are listed below m The 8042 instruction is compatible with a PS 2 keyboard and PS 2 mouse m Gate A20 and Keyboard reset output m Supports multiple keyboard power on events m Supports mouse double click and or mouse move power on events IT echnology Gorp KINO 9453 Mini ITX Motherboard 2 9 Environmental and Power Specifications 2 9 1 System Monitoring Three thermal inputs on the KINO 9453 Super I O Enhanced Hardware Monitor monitor the following temperatures m System temperature m Power temperature m CPU temperature Eight voltage inputs on the KINO 9453 Super I O Enhanced Hardware Monitor monitor the following voltages CPU Core m 2 5V m 3 30V m 5 00 m 12 0V m GMCH 1 5 1 05V m 5VSB m VBAT The KINO 9453 Super I O Enhanced Hardware Monitor also monitors the following voltages internally m VBAT The KINO 9453 Super I O Enhanced Hardware Monitor also monitors the following fan speeds m CPU Fan speed The values for the above environmental parameters are all recorded in the BIOS Hardware Health Configuration menu IC _ RITechnology Corp KINO 9453 Mini ITX Motherboard 2 9 2 Operating Temperature and Temperature Control The maximum and minimum operatin
91. e CPU is installed properly and ensure the correct cooling kit is properly installed To install a socket 479 CPU onto the KINO 9453 follow the steps below KINO 9453 Mini ITX Motherboard WARNING Step 1 When handling the CPU only hold it on the sides DO NOT touch the pins at the bottom of the CPU Unlock the CPU retention screw When shipped the retention screw of the CPU socket should be in the unlocked position If it is not in the unlocked position use a screwdriver to unlock the screw See Figure 5 1 Cut edge Figure 5 1 Make sure the CPU socket retention screw is unlocked Step 2 Step 3 Step 4 Inspect the CPU socket Make sure there are no bent pins and make sure the socket contacts are free of foreign material If any debris is found remove it with compressed air Correctly Orientate the CPU Make sure the IHS integrated heat sink side is facing upwards Correctly position the CPU Match the Pin 1 mark with the cut edge on the CPU socket See Figure 5 1 pm fe IEI RIechnology Corp KINO 9453 Mini ITX Motherboard Step 5 Align the CPU pins Carefully align the CPU pins with the holes in the CPU socket Step 6 Insert the CPU Gently insert the CPU into the socket If the CPU pins are properly aligned the CPU should slide into the CPU socket smoothly Step 7 Lock the retention screw Rotate the retent
92. e IEEE 1284 Parallel Port m Floppy Disk Controller m Keyboard Controller m Watchdog Timer m Serial Support m Vbat amp Vcch Support m Single 5V Power Supply Some of the Super I O features are described in more detail below IC KINO 9453 Mini ITX Motherboard _ RITechnology Corp 2 8 3 1 Super I O LPC Interface The LPC interface on the Super I O complies with the Intel Low Pin Count Specification Rev 1 0 The LPC interface supports both LDRQ and SERIRQ protocols as well as PCI PME interfaces 2 8 3 2 Super I O 16C550 UARTs The on board Super has two integrated 16C550 UARTs that can support the following m Two standard serial ports COM1 and COM2 m 1 0 and ASKIR protocols Another two chipsets connected to the LPC bus provided connectivity to another two serial port connectors COM3 and 2 8 3 3 Super I O Enhanced Hardware Monitor The Super I O Enhanced Hardware Monitor monitors three thermal inputs VBAT internally and eight voltage monitor inputs These hardware parameters are reported in the BIOS and can be read from the BIOS Hardware Health Configuration menu 2 8 3 4 Super I O Fan Speed Controller The Super I O fan speed controller enables the system to monitor the speed of the fan One of the pins on the fan connector is reserved for fan speed detection and interfaced to the fan speed controller on the Super I O The fan speed is then reported in th
93. ee also My Documents My Network Places My Computer 3 object s 24 3 MB My Computer 2 Figure 7 22 4 AUDIO AC KIT883HD Windows Folder Step 3 Double click the WDM_R140 icon to begin the driver installation process Page 163 _ IE KINO 9453 Mini ITX Motherboard Step 4 Once the WDM_R140 icon is double clicked the contents of the installation package are extracted See Figure 7 23 Realtek HD Audio InstallShield Wizard Extractir Files The contents of this package are being extracted Please wait while the InstallShield Wizard extracts the files needed to install Realtek HD Audio on your computer This may take a few moments Reading contents of package Bac Next Cancel Figure 7 23 HD Audio Driver Setup Extracting Files Page 164 acc lt e I 1 Corp KINO 9453 Mini ITX Motherboard Step 5 The Welcome screen appears Click NEXT See Figure 7 24 Next gt Cancel Figure 7 24 HD Audio Driver Setup Welcome Screen Page 165 KINO 9453 Mini ITX Motherboard Step 6 The driver is automatically installed Step 7 After the driver installation process is complete a confirmation screen shown in Figure 7 25 appears Realtek High Definition Audio Driver Setup 2 15 hemove any disks from their drives and then cl
94. ement carefully Press the Page Down key to view the rest of the agreement INTEL SOFTWARE LICENSE AGREEMENT IHV 15 Distribution amp 4 Single User IMPORTANT READ BEFORE COPYING INSTALLING OR USING Do not use or load this software and any associated materials collectively the Software until you have carefully read the following terms and conditions By loading or using the Software you agree to the terms of this Agreement If you do not wish to so agree do not install or use the Software Please Also Note f vou an Original Equipment Manufacturer Independent Hardware Vendor or Independent Software Vendor 15 this complete LICENSE AGREEMENT applies x You must accept all the terms of the license agreement in order to continue the setup program Do you accept the terms lt Back Intel R Installation Frameworks Figure 7 4 Chipset Driver Installation License Agreement Step 7 Click YES to continue the setup Step 8 The Readme file in Figure 7 5 appears Page 149 _ KINO 9453 Mini ITX Motherboard Intel R Chipset Software Installation Utility 8 1 1 1010 Readme File Information Refer to the Readme file below to view system requirements and installation information Press the Page Down key to view the rest of the file Product Intel R Chipset Software Installation Utility Release Production Versi
95. er KINO 9453 Mini ITX Motherboard Password 6 7 Chipset Use the Chipset menu BIOS Menu 20 to access the NorthBridge and SouthBridge configuration menus WARNING Setting the wrong values for the Chipset BIOS selections in the Chipset BIOS menu may cause the system to malfunction duanced Chipset Settimgs WARNING Setting wrong values in below sections may cause system to malfunction BIOS Menu 20 Chipset Page 135 1 6 7 1 NorthBridge Configuration KINO 9453 Mini ITX Motherboard Use the NorthBridge Configuration menu BIOS Menu 20 to configure the Northbridge chipset BIOS SETUP UT North Bridge Chipset Configuration PEG Port Configuration BIOS Menu 21 NorthBridge Chipset Configuration Boots Graphics Adapter Priority PCI IGD Use the Boots Graphics Adapter Priority option to select the graphics controller used as the primary boot device Select either an integrated graphics controller IGD or a combination of PCI graphics controller a PCI express PEG controller or an IGD Configuration options are listed below m IGD m PEG IGD m PCI PEG 136 _ RITechnology Corp KINO 9453 Mini ITX Motherboard m PCI IGD DEFAULT Internal Graphics Mode Select Enable 8MB Use the Internal Graphic Mode Select option to specify the amount of system memory that can be used by
96. especially susceptible to ESD It is therefore critical that whenever the KINO 9453 or any other electrical component is handled the following anti static precautions are strictly adhered to m Wear an anti static wristband Wearing a simple anti static wristband can help to prevent ESD from damaging the board m Self grounding Before handling the board touch any grounded conducting material During the time the board is handled frequently touch any conducting materials that are connected to the ground m Use an anti static pad When configuring the KINO 9453 place it on an antic static pad This reduces the possibility of ESD damaging the KINO 9453 m Only handle the edges of the PCB When handling the PCB hold the PCB by the edges IC _ e RITechnology Corp KINO 9453 Mini ITX Motherboard 5 2 Installation Considerations A NOTE The following installation notices and installation considerations should be read and understood before the KINO 9453 is installed All installation notices pertaining to the installation of the KINO 9453 should be strictly adhered to Failing to adhere to these precautions may lead to severe damage of the KINO 9453 and injury to the person installing the motherboard 5 2 1 Installation Notices WARNING The installation instructions described in this manual should be carefully followed in order to prevent damage to the KINO 9453 KINO
97. etup Table C 1 AH 6FH Sub function Call sub function 2 to set the time out period of Watchdog Timer first If the time out value is not zero the Watchdog Timer starts counting down While the timer value reaches zero the system resets To ensure that this reset condition does not occur calling sub function 2 must periodically refresh the Watchdog Timer However the Watchdog timer is disabled if the time out value is set to zero A tolerance of at least 1096 must be maintained to avoid unknown routines within the operating system DOS such as disk I O that can be very time consuming IC KINO 9453 Mini ITX Motherboard A NOTE When exiting a program it is necessary to disable the Watchdog Timer otherwise the system resets Example program INITIAL TI MER PERI OD COUNTER W_LOOP MOV AX 6F02H setting the time out value MOV BL 30 time out value is 48 seconds INT 15H ADD THE APPLICATION PROGRAM HERE CMP EXIT_AP 1 is the application over JNE W_LOOP No restart the application MOV AX 6F02H disable Watchdog Timer MOV BL 0 INT 15H EXIT Page 189 _ RITechnology Corp CX KS 9 uide Corp 9453 Motherboard Appendix D Address Mapping Page 190 2 RiIechnology Corp KINO 9453 Mini ITX Motherboard D 1 Address Map I O address Range Description 000
98. g call Resume on PME Disabled Use the Resume on PME BIOS option to enable activity on the PCI PME power management event controller to rouse the system from a suspend or standby state gt Disabled DEFAULT Wake event not generated by PCI PME controller Page 112 IC _ RITechnology Corp KINO 9453 Mini ITX Motherboard activity gt Enabled Wake event generated by PCI PME controller activity Resume RTC Alarm Disabled Use the Resume On RTC Alarm option to specify the time the system should be roused from a suspended state gt Disabled DEFAULT The real time clock RTC cannot generate a wake event gt Enabled If selected the following appears with values that can be selected RTC Alarm Date Days gt System Time After setting the alarm the computer turns itself on from a suspend state when the alarm goes off Resume On PCI Express WAKE Enabled The Resume On PCI Express WAKE BIOS option specifies if the system is roused from a suspended or standby state when there is activity on the PCI express port gt Disabled Wake event not generated by PCI express activity gt Enabled DEFAULT Wake event generated by PCI express activity 6 3 7 Remote Access Configuration Use the Remote Access Configuration menu BIOS Menu 11 to configure remote access parameters The Remote Access Configuration is an AMIBIOS feature and allows a remote host running a ter
99. g temperatures for the KINO 9453 are listed below m Minimum Operating Temperature 0 C 32 F m Maximum Operating Temperature 60 C 140 F A cooling fan and heat sink must be installed on the CPU Thermal paste must be smeared on the lower side of the heat sink before it is mounted on the CPU Heat sinks are also mounted on the Northbridge and Southbridge chipsets to ensure the operating temperature of these chips remain low 2 9 3 Power Consumption Table 2 4 shows the power consumption parameters for the KINO 9453 running with a 2 33 GHz Intel Core 2 Duo T7600 processor with 2 GB of DDR2 memory Voltage Current 5V 4 1A 12V 2 23A 5VSB 0 58A Table 2 4 Power Consumption Table 2 4 shows the power consumption parameters for the KINO 9453 running with a 2 33 GHz Intel CoreTM Duo T2700 processor with 2 GB of DDR2 memory Voltage Current 45V 4 16A 12V 1 96A 5VSB 0 59A Table 2 5 Power Consumption _ IE KINO 9453 Mini ITX Motherboard Chapter 3 Unpacking mme RTechnology Corp KINO 9453 Mini ITX Motherboard 3 1 Anti static Precautions WARNING Failure to take ESD precautions during the installation of the KINO 9453 may result in permanent damage to the KINO 9453 and severe injury to the user Electrostatic discharge ESD can cause serious damage to electronic components
100. g wrong values for the BIOS selections in the PCIPnP BIOS menu may cause the system to malfunction Page 122 E I Riechnology Corp BIOS SETUP UTILITY Main Advanced Boot Security Chipset Exit Advanced PCI PnP Settings 4 Clear NURAM during System Boot WARNING Setting wrong values in below sections mau cause system to malfunction Plug amp Play 0 5 No PCI Latency Timer 64 Allocate IRQ to PCI VGA Yes Palette Snooping Disabled PCI IDE BusMaster Enabled OffBoard PCI ISA IDE Card Auto lt Select Screen IRQ3 Available 11 Select Item TRQ4 Available Change IRQ5 Available F1 General Help IRQ Available F10 Save and Exit IRQS Available ESC Exit IRQ10 Available IRQ11 Available v02 59 C Copyright 1985 2005 American Megatrends Inc BIOS SETUP UTILITY Main Advanced Boot Security Chipset Exit OffBoard PCI ISA IDE Card Auto 4 Size of memory block to reserve for legacy IRQ3 Available ISA devices Available IRQ5 Available IRQ Available IRQS Available IRQ10 Available IRQ11 Available IRQ14 Available IRQ15 Available DMA Channel 0 Available Select Screen DMA Channel 1 Available 11 Select Item DMA Channel 3 Available Change Option DMA Channel 5 Available F1 General Help DMA Channel 6 Available F10 Save and Exit DMA Channel 7 Available ESC Exit v02 59 C Copyright 1985 2005 American Megatrends Inc
101. ge Setup Menu and Option Page Setup Menu Exit current page and return to Main Menu Page Up key Increase the numeric value or make changes Page Dn key Decrease the numeric value or make changes IC _ RITechnology Corp KINO 9453 Mini ITX Motherboard Key F1 key General help only for Status Page Setup Menu and Option Page Setup Menu F2 F3 key Change color from total 16 colors F2 to select color forward F10 key Save all the CMOS changes only for Main Menu Table 6 1 BIOS Navigation Keys 6 1 3 Getting Help When F1 is pressed a small help window describing the appropriate keys to use and the possible selections for the highlighted item appears To exit the Help Window press Esc or the F1 key again 6 1 4 Unable to Reboot After Configuration Changes If the computer cannot boot after changes to the system configuration is made CMOS defaults Use the jumper described in Chapter 5 6 1 5 BIOS Menu Bar The menu bar on top of the BIOS screen has the following main items m Changes the basic system configuration m Advanced Changes the advanced system settings m PCIPnP Changes the advanced PCI PnP Settings m Boot Changes the system boot configuration m Security Sets User and Supervisor Passwords Chipset Changes the chipset settings m Power Changes power management settings m Exit Selects exit options and loads default settings The following sections completel
102. hannel Auto DEFAULT BIOS auto detects the LBA mode control on the specified channel _ IE KINO 9453 Mini ITX Motherboard gt Block Multi Sector Transfer Auto Use the Block Multi Sector Transfer to disable or enable BIOS to auto detect if the device supports multi sector transfers gt Disabled BIOS is prevented from using Multi Sector Transfer on the specified channel The data to and from the device occurs one sector at a time gt Auto DEFAULT BIOS auto detects Multi Sector Transfer support on the gt PIO Mode Auto drive on the specified channel If supported the data transfer to and from the device occurs multiple sectors at a time Use the PIO Mode option to select the IDE PIO Programmable I O mode program timing cycles between the IDE drive and the programmable IDE controller As the PIO mode increases the cycle time decreases gt Auto DEFAULT v Vv V v v BIOS auto detects the PIO mode Use this value if the IDE disk drive support cannot be determined PIO mode 0 selected with a maximum transfer rate of 3 3MBps PIO mode 1 selected with a maximum transfer rate of 5 2MBps PIO mode 2 selected with a maximum transfer rate of 8 3MBps PIO mode 3 selected with a maximum transfer rate of 11 1MBps PIO mode 4 selected with a maximum transfer rate of 16 6MBps This setting generally works with all hard disk drives manufactured after 1999 For other
103. he rest of the file xxxXXXXXXXXXXXXXXXXXXXXX XX XXXXXX30XXX XX XXX XXX HHH RHR XxxXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX X XXXXXXXXXXXXXXX XXX XXXXXOXKX Installation Readme for Intel R Matrix Storage Manager Refer to the system requirements for the operating systems supported by Intel R Matrix Storage Manager This document makes references to products developed by Intel There are some restrictions on how these products may be used and what information may be disclosed to others Please read the Disclaimer section at the bottom of this document and contact your Intel field representative if vou would like more information xxXxXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX X XXXXXX XK Intel R Installation Frameworks Figure 7 41 Matrix Storage Manager Readme File Step 11 Read the Readme file information and click NEXT Page 178 ESEI IC _ 0 RITechnology Corp KINO 9453 Mini ITX Motherboard Step 12 After the driver installation process is complete a confirmation screen appears Figure 7 42 Intel R Matrix Storage Manager 6 2 0 2002 The setup for the Intel R Matrix Storage Manager is complete You must restart this computer for the changes to take effect Would you like to restart the computer now Yes want to restart my computer now
104. ick Finish to complete setup Ico Q Finish Cancel Figure 7 25 HD Audio Driver Installation Complete Step8 The confirmation screen shown in Figure 7 25 allows you to restart the computer immediately after the installation is complete or to restart the computer later For the settings to take effect the computer must be restarted Once you have decided when to restart the computer click the FINISH button Page 166 IC _ e RITechnology Corp KINO 9453 Mini ITX Motherboard 7 7 Realtek AC 97 Audio Driver ALC665 Installation To install the Realtek AC 97 audio driver please follow the steps below 7 7 1 BIOS Setup Step 1 Enter the BIOS setup To do this reboot the system and press DEL during POST Step 2 Go to the Southbridge Configuration menu Set the Audio Controller option to AC 97 See Section 6 7 2 for details Step 3 Press F10 to save the changes and exit the BIOS setup The system reboots 7 7 2 Driver Installation Step 1 Insert the CD that came with the package Step 2 From the main driver menu navigate to X 4 AUDIO AC KIT08R Windows or other appropriate OS X represents the system CD drive A new window appears showing the folder contents Figure 7 26 Page 167 _ IE IT echnology Gorp File Edit View Favorites Tools Help Search L Folders S UI X wz a E M AUDIOVAC KITOSRYWindows Go
105. ification Step 4 Disk Drive and RAID Volume Status After the disk drives have been reset the Matrix Storage Manager Main menu is shown indicating the status of the RAID volumes and disk drives See Figure E 15 Delete RAID Volume Reset Disks to Non RAID Figure E 15 Disk Drive and RAID Volume Status Page 205 KINO 9453 Mini ITX Motherboard E 4 4 Exiting the Matrix Storage Manager Step 1 Select Exit Use the arrow keys to highlight Exit and press ENTER See Figure E 16 Figure E 16 Exit Menu Step2 Exit Verification Press Y to exit the Matrix Storage Manager or N to return to the Main menu See Figure E 17 Figure E 17 Exit Verification Page 206 lt 2 IC _ o RIechnology Corp KINO 9453 Mini ITX Motherboard Index Page 207 _ 109 110 Advanced Power Management 111 141 Clo 75 ALC655 16 anti static precautions 25 56 anti static 25 56 anti static wristband 25 56 handling 25 56 self grounding 25 56 power select jumper
106. ini ITX Motherboard 5 5 Chassis Installation 5 5 1 Airflow WARNING Airflow is critical to the cooling of the CPU and other onboard components The chassis in which the KINO 9453 must have air vents to allow cool air to move into the system and hot air to move out The KINO 9453 must be installed in a chassis with ventilation holes on the sides allowing airflow to travel through the heat sink surface In a system with an individual power supply unit the cooling fan of a power supply can also help generate airflow through the board surface IEI has a wide range of backplanes available Please contact your KINO 9453 vendor reseller or sales representative at sales iei com tw or visit the IEI website http www ieiworld com tw to find out more about the available chassis 5 5 2 Motherboard Installation To install the KINO 9453 motherboard into the chassis please refer to the reference material that came with the chassis 5 6 Internal Peripheral Device Connections KINO 9453 Mini ITX Motherboard 5 6 1 Peripheral Device Cables The cables listed in Table 5 9 are shipped with the KINO 9453 Quantity Type 1 IDE Cable 1 Dual RS 232 cable 2 SATA drive cables 1 SATA drive power cable Table 5 9 IEI Provided Cables Optional cables are listed below m USB cable dual port m USB cable four por
107. ion screw into the locked position See Figure 5 2 Pin 1 location Figure 5 2 Lock the CPU Socket Retention Screw _ IE IT echnology Gorp KINO 9453 Mini ITX Motherboard 5 3 2 Cooling Kit CF 479B RS Installation Figure 5 3 CF 479B RS Cooling An IEI Socket 479 CPU cooling kit can be purchased separately The cooling kit comprises a CPU heat sink and a cooling fan WARNING Do not wipe off accidentally or otherwise the pre sprayed layer of thermal paste on the bottom of the CF 479B RS heat sink The thermal paste between the CPU and the heat sink is important for optimum heat dissipation To install the CF 479B RS cooling kit please follow the steps below Step 1 Place the cooling kit onto the CPU Make sure the CPU cooling fan cable can be properly routed when the cooling kit is installed Step 2 Properly align the cooling kit Make sure its four spring screw fasteners can pass through the pre drilled holes on the PCB Step 3 Secure the cooling kit From the solder side of the PCB align the support bracket to the screw threads on heat sink that were inserted through the PCB holes See Figure 5 4 220 RIechnology Corp KINO 9453 Mini ITX Motherboard Support Bracket Figure 5 4 Cooling Kit Support Bracket Step 4 Tighten the screws Use a screwdriver to tighten the four screws Tighten each nut a few turns at a time and do not over tighten the
108. ives connected to the system are shown For example if only one FDD is connected only 1st Drive is listed The boot sequence from the available devices is selected If the 151 Drive option is selected a list of available FDDs is shown Select the first FDD the system boots from If the 1st Drive is not used for booting this option may be disabled BIOS SETUP UTILITY 1st Drive USB JetFlash 151671 BIOS Menu 18 Removable Drives Page 133 KINO 9453 Mini ITX Motherboard 6 6 Security Use the Security menu BIOS Menu 19 to set system and user passwords BIOS SETUP UTI Securitu Settimgs Supervisor Password Not Installed User Password Not Installed BIOS Menu 19 Security gt Change Supervisor Password Use the Change Supervisor Password to set or change a supervisor password The default for this option is Not Installed If a supervisor password must be installed select this field and enter the password After the password has been added Install appears next to Change Supervisor Password gt Change User Password Use the Change User Password to set or change a user password The default for this option is Not Installed If a user password must be installed select this field and enter the Page 134 password After password has been added Install appears next to Change Us
109. lation Type BIOS option to specify the type of emulation BIOS has to provide for the USB device Please note that the device s formatted type and the emulation type provided by the BIOS must match for a device to boot properly If both types do not match then device s behavior is undefined To make sure both types match format the device using BIOS INT13h calls after selecting the proper emulation option in BIOS setup The FORMAT utility provided by Microsoft MS DOS Microsoft Windows 95 and Microsoft Windows 98 can be used for this purpose Page 121 KINO 9453 Mini ITX Motherboard Auto DEFAULT BIOS auto detects the current USB Floppy The USB device will be emulated as a floppy drive The device can be either A or B responding to INT13h calls that return DL 0 or DL 1 respectively gt Forced FDD Allows a hard disk image to be connected as a floppy image This option works only for drives formatted with FAT12 FAT16 or FAT32 gt Hard Disk Allows the USB device to be emulated as hard disk responding to INT13h calls that return DL values of 80h or above gt CDROM Assumes the CD ROM is formatted as bootable media All the devices that support block sizes greater than 512 bytes can only be booted using this option 6 4 PCI PnP Use the PCI PnP menu BIOS Menu 12 to configure advanced PCI and PnP settings WARNING Settin
110. le Page 192 Available IC lt RiIechnology Corp KINO 9453 Mini ITX Motherboard Appendix Intel Matrix Storage Manager Page 193 _ KINO 9453 Mini ITX Motherboard E 1 Introduction The Intel ICH7R chipset can provide data protection for serial ATA SATA disks via the Intel Matrix Storage Manager using one of three fault tolerant RAID levels RAID 1 5 or 10 When using two hard drives matrix RAID allows RAID 0 and RAID 1 functions to be combined where critical files can be stored on RAID 1 and RAID 0 can be used for non critical items such as software RAID 5 and RAID 0 can be combined to provide higher performance capacity and fault tolerance CAUTION Aconfigured RAID volume which may consist of multiple hard drives appears to an operating system as a contingent storage space The operating system will not be able to distinguish the physical disk drives contained in a RAID configuration E 1 1 Precautions One key benefit a RAID configuration brings is that a single hard drive can fail within a RAID array without damaging data With RAID1 array a failed drive can be replaced and the RAID configuration restored WARNING Irrecoverable data loss occurs if a working drive is removed when trying to remove a failed drive It is strongly recommended to mark the physical connections of all SATA
111. lt Assigns an IRQ to a PCI VGA card if card requests IRQ gt No Does not assign IRQ to a PCI VGA card even if the card requests an IRQ Palette Snooping Disabled Use the Palette Snooping option to enable or disable the palette snooping function gt Disabled DEFAULT Unless the VGA card manufacturer requires palette snooping to be enabled this option should be disabled gt No PCI devices are informed that an ISA based Graphics Enabled device is installed in the system so the ISA based Graphics card functions correctly This does not necessarily indicate a physical ISA adapter card The graphics chipset can be mounted on a PCI card Always check with the adapter card manual first before modifying the default settings in the BIOS PCIIDE BusMaster Enabled Use the PCI IDE BusMaster BIOS option to enable or prevent PCI IDE busmastering gt Disabled Busmastering is prevented gt No Enabled DEFAULT IDE controller on the PCI local bus has mastering capabilities Page 125 _ IE gt OffBoard PCI ISA Card Auto KINO 9453 Mini ITX Motherboard Use the OffBoard PCI ISA IDE Card BIOS option to select the OffBoard PCI ISA IDE Card gt IRQ Available Auto PCI Slot 1 PCI Slot 2 PCI Slot 3 PCI Slot 4 PCI Slot 5 PCI Slot 6 DEFAULT The location of the Off Board PCI IDE adapter card is automatically detected by the AMIBIO
112. mation primarily between the following four interfaces m Front Side Bus FSB m System Memory Interface m Graphics Interface m Direct Media Interface DMI 2 5 2 Intel 945GME Memory Support WARNING Only DDR2 memory module can be installed on the KINO 9453 Do not install DDR memory modules If a DDR memory module is installed on the KINO 9453 the KINO 9453 may be irreparably damaged _ e IE KINO 9453 Mini ITX Motherboard The Intel 945GME Northbridge chipset on the KINO 9453 supports two DDR2 240 pin DIMMs with the following features m Two 240 pin DIMMs DDR2 only DO NOT install DDR DIMM m Single channel or dual channel m Capacities of 256 512 MB 1 or 2 GB m Transfer speeds of 400 MHz 533 MHz or 667 MHz The memory sockets are shown in Figure 2 4 Figure 2 4 240 pin DIMM Sockets 2 5 3 Intel 945GME Integrated Graphics The Intel 945GME Northbridge chipset has an Intel Gen 3 5 integrated graphics engine that supports the following display devices m Analog CRT m LVDS m S DVO interface DVI connector _ RITechnology Corp KINO 9453 Mini ITX Motherboard 2 5 3 1 Intel 945GME Analog CRT Support DB 15 connector on the external peripheral interface connector panel is interfaced to the Intel 945GME graphics engine The Intel 945GME internal graphics engine with an integrated 400 MHz RAM
113. maximum data transfer rate of 66 6MBps To use this mode it is required that an 80 conductor ATA cable is used gt UDMA5 Ultra DMA mode 5 selected with a maximum data transfer rate of 99 9MBps To use this mode it is required that an 80 conductor ATA cable is used gt S M A R T Auto Use the S M A R T option to auto detect disable or enable Self Monitoring Analysis and Reporting Technology SMART on the drive on the specified channel S M A R T predicts impending drive failures The S M A R T BIOS option enables or disables this function gt Auto DEFAULT BIOS auto detects HDD SMART support gt Disabled Prevents BIOS from using the HDD SMART feature gt Enabled Allows BIOS to use the HDD SMART feature 32BitData Transfer Enabled Use the 32Bit Data Transfer BIOS option to enables or disable 32 bit data transfers gt Disabled Prevents the BIOS from using 32 bit data transfers gt Enabled DEFAULT Allows BIOS to use 32 bit data transfers on supported hard disk drives 6 3 3 Super IO Configuration Use the Super IO Configuration menu BIOS Menu 6 to set or change the configurations for the FDD controllers parallel ports and serial ports Page 100 IC jm Corp KINO 9453 Mini ITX Motherboard NN BIOS SETUP UTILITY Configure ITE8712 Super I Chipset BIOS Menu 6 Super IO Configuration Serial Port1 Address 3F8 IRQ4 U
114. minal program to display and configure the BIOS settings Page 113 1 KINO 9453 Mini ITX Motherboard O O BIOS SETUP UTILITY Configure Remote ccess tupe and parameters BIOS Menu 11 Remote Access Configuration Advanced Remote Access Disabled Use the Remote Access option to enable or disable access to the remote functionalities of the system gt Disabled DEFAULT Remote access is disabled gt Enabled Remote access configuration options shown below appear Serial Port Number Serial Port Mode Flow Control Redirection after BIOS POST Page 114 _ RITechnology Corp KINO 9453 Mini ITX Motherboard gt Terminal Type VT UTF8 Combo Key Support Sredir Memory Display Delay These configuration options are discussed below gt Serial Port Number COM1 Use the Serial Port Number option allows to select the serial port used for remote access gt COM1 DEFAULT System is remotely accessed through COM1 gt COM2 System is remotely accessed through COM2 NOTE Make sure the selected COM port is enabled through the Super I O configuration menu gt Base Address IRQ 3F8h 4 The Base Address IRQ option cannot be configured and only shows the interrupt address of the serial port listed above gt Serial Port Mode 115200 8 n 1 Use the Serial Port Mode option to select baud rate through whi
115. n IDE connects to two Ultra ATA33 66 100 devices SATA Two 1 5 Gb s SATA drives supported Two PS 2 connectors support mouse and keyboard Keyboard mouse connectivity Humidity operating 5 05 non condensing IC RIechnology Corp KINO 9453 Mini ITX Motherboard Dimensions LxW 170 mm x 170 mm Weight GW NW 9009 3620 Table 1 1 Technical Specifications p KINO 9453 Mini ITX Motherboard Detailed Specifications RITechnology Corp KINO 9453 Mini ITX Motherboard 2 1 Overview This chapter describes the specifications and on board features of the KINO 9453 in detail 2 2 Dimensions 2 2 1 Board Dimensions The dimensions of the board are listed below m Length 170 mm m Width 170 mm NB_FAN1 USBS USB4 STINT TNT SVS TMS TI ST ST Te 0200200200200220220220220220 0990990990990090006900069000900090 09909909909900990006900069000900090 TUY 2008 0200 90909009900090090906900090029 Sy I ee ee ee eT ee ee 20000000058 DoODo0Do00000520220500000500 0900000 20020 0 TONS TI 505505 MINIPCI 50 OO OEP COIS oo0o60000600900000009900000220 abbad 90000000090009000990 99000 PCI2 i SPDIF1 Sb g bp KINO 9453 Mini ITX Motherboard 2
116. nectors Internal peripheral connectors are found on the motherboard and are only accessible when the motherboard is outside of the chassis This section has complete descriptions of all the internal peripheral connectors on the KINO 9453 4 2 1 Fan Connectors CN Label CPU_FAN1 NB FAN1 and SYS FAN1 CN Type 3 pin header CN Location See Figure 4 2 Page 32 2 6 RITechnology Corp KINO 9453 Mini ITX Motherboard CN Pinouts See Table 4 3 The cooling fan connectors on the KINO 9453 provide a 12 V 500 mA current to one CPU cooling fan one Northbridge cooling fan and one system cooling fan There is a sense pin in the fan connector which transfers the fan s sense signal to the system BIOS in order to recognize the fan speed Please note that only some specific types of fans offer a rotation signal wau 23 SYS_FAN1 cPU sys_ PAREN Figure 4 2 Fan Locations PIN NO DESCRIPTION 1 GND 2 12V 3 Sense Table 4 3 Fan Connector Pinouts 4 2 2 Front Panel Connector CN Label F_PANEL1 CN Type 14 pin header 2x7 CN Location See Figure 4 3 CN Pinouts See Table 4 4 IE KINO 9453 Mini ITX Motherboard The front panel connector connects to several external switches and indicators to monitor and control the motherboard These indicat
117. nstallation IN OU COS NEL 57 3 2 2 Installation Checklist 58 5 3 CPU CPU COOLING KIT AND DIMM INSTALLATION enne 59 5 3 1 Socket 479 CPU Installation 59 5 3 2 Cooling Kit CF 479B RS Installation 62 3 3 3 DIMM Installati n M 64 SA JUMPER SETTINSGS L nuqa E A E EEEE 65 5 4 1 AT ATX Power Select Jumper Settings 66 5 4 2 Clear CMOS 67 5 4 3 3 Function Select Jumper 69 _ IE 5 4 4 RS 422 or RS 486 Termination Resister 70 3 4 5 LVDS Screen Resolution Selection iie t aate rat arri easi edd veda 71 5 4 6 LVDS Voltage Selection 73 5 5 CHASSIS INSTALLATION 75 75 5 5 2 Motherboard Installation a a 75 5 6 INTERNAL PERIPHERAL DEVICE CONNECTIONS a 76 5 6 1 Peripheral Device Cables
118. nt Configuration gt Power Management APM Enabled Use the Power Management APM BIOS option to enable access to the advanced power management features If this option is disabled the only other option on the screen is the Power Button Mode gt Disabled Disables the Advanced Power Management APM feature gt Enabled DEFAULT Enables the APM feature Page 111 _ IE IT echnology Gorp gt Power Supply Mode ATX KINO 9453 Mini ITX Motherboard Use the Power Supply Mode BIOS option to to select the power supply that is connected to the system gt AT An AT power supply is connected to the system gt ATX DEFAULT AnATX power supply is connected to the system gt Restore on AC Power Loss by IO Power Off Use the Restore on AC Power Loss by IO BIOS option to specify what state the system returns to if there is a sudden loss of power to the system gt Power Off DEFAULT The system remains turned off gt Power On The system turns on gt Last State The system returns to its previous state If it was on it turns itself on If it was off it remains off Resume on Ring Disabled Use the Resume on Ring BIOS option to enable activity on the RI ring in modem line to rouse the system from a suspend or standby state That is the system will be roused by an incoming call on a modem gt Disabled DEFAULT Wake event not generated by an incoming call gt Enabled Wake event generated by an incomin
119. o the ICH7 M The RTC operates on a 3V battery and 32 768 KHz crystal The RTC keeps track of the time and stores system data even when the system is turned off 2 6 7 Intel ICH7 M SATA Controller The integrated SATA controller on the ICH7 M Southbridge supports two SATA drives on the KINO 9453 with independent DMA operations SATA controller specifications are listed below m Supports two SATA drives m Supports 1 5 Gb s data transfer speeds m Supports Serial ATA Specification Revision 1 0a 2 6 8 Intel ICH7 M USB Controller Up to eight high speed full speed or low speed USB devices are supported by the ICH7 M on the KINO 9453 High speed USB 2 0 with data transfers of up to 480 MB s is enabled with the ICH7 M integrated Enhanced Host Controller Interface EHCI compliant host controller USB full speed and low speed signaling is supported by the ICH7 M integrated Universal Host Controller Interface UHCI controllers KINO 9453 Mini ITX Motherboard _ RITechnology Corp 2 7 PCle Bus Components 2 7 1 PCle Bus Overview The PCle bus is connected to components listed below Two PCle GbE Broadcom LAN controllers 2 7 2 Broadcom PCI Express GbE interface The Broadcom BCM5787M PCI Express PCle GbE controller is a 10 100 1000 Ethernet LAN controller The BCM5787M combines a triple speed IEEE 802 3 compliant Media Access Controller MAC with a triple speed Ethernet transceiver a PCle b
120. omplete Y ou must restart this computer for the changes to take effect Would you like to restart the computer now 6 Yes want to restart my computer now C 1 will restart my computer later Remove any disks from their drives and then click Finish Intel H Installation Frameworks Figure 7 14 GMA Driver Installation Complete Step 14 After selecting when to restart the computer in Figure 7 14 click FINISH 7 5 Broadcom LAN Driver for GbE LAN Installation To install the Broadcom LAN driver please follow the steps below Step 1 Open Windows Control Panel Figure 7 15 Page 157 IE KINO 9453 Mini ITX Motherboard New Office Document Open Office Document Set Program Access and Defaults Windows Update Program Updates Programs E Documents control Panel Settings 28 Network and Dial up Connections Printers m Taskbar amp Start Menu Search Help Run amp Log Off paulsharpe Shut Down Asta 0690 gt Figure 7 15 Access Windows Control Panel Step2 Double click the System icon Figure 7 16 Page 158 pm fe RiIechnology Corp KINO 9453 Mini ITX Motherboard Control Panel File Edit Favorites Tools Help Back gt Qsearch Folders 58 Address Control Panel dG a amp Q M Autodesk Plot A
121. on 8 1 1 1010 Target Chipset s Q953 0965 P365 G355 and 3000 3010 3100 and 5000 Series Date November 08 2006 NOTE For the list of supported chipsets please refer to the Release Notes CONTENTS OF THIS DOCUMENT lt Back Installation Frameworks Figure 7 5 Chipset Driver Readme File Information Step 9 Click NExT in Figure 7 5 to start the driver installation Step 10 After the driver installation process is complete a confirmation screen Figure 7 6 appears Page 150 EC 9 lt _ e RITechnology Corp KINO 9453 Mini ITX Motherboard Intel R Chipset Software Installation Utility 8 1 1 1010 The Intel R Chipset Software Installation Utility is complete The setup program successfully installed Plug and Play components onto the system Click Finish to exit setup Intel R Installation Frameworks Figure 7 6 Chipset Driver Installation Complete 7 4 Intel Graphics Media Accelerator Driver To install the chipset driver please follow the steps below Step 1 Select the VGA
122. onfiguration The ACPI Configuration menu BIOS Menu 8 configures the Advanced Configuration and Power Interface ACPI and Power Management APM options BIOS SETUP UTILITY ACPI Settings BIOS Menu 8 ACPI Configuration 6 3 5 1 General ACPI Configuration Use the General ACPI Configuration menu BIOS Menu 9 to select the ACPI state when the system is suspended Page 109 1 KINO 9453 Mini ITX Motherboard BIOS SETUP UTILITY General ACPI Configuration BIOS Menu 9 General ACPI Configuration Advanced ACPI Configuration Suspend Mode S3 STR Use the Suspend Mode option to specify the sleep state the system enters when it is not being used gt S1 POS The system enters S1 POS sleep state The system appears off The CPU is stopped RAM is refreshed the system is running in a low power mode gt S3 STR DEFAULT The system enters a S3 STR sleep state The CPU has no power RAM is in slow refresh the power supply is in a reduced power mode Auto The BIOS automatically selects a sleep state for the system Page 110 jm KINO 9453 Mini ITX Motherboard 6 3 6 APM Configuration The APM Configuration menu BIOS Menu 10 allows the advanced power management options to be configured PH Configuration duanced Resume Euent Controls BIOS Menu 10 Advanced Power Manageme
123. onfigure the new software as shown in Figure 7 30 Next gt Cancel Figure 7 29 AC 97 Audio Driver Welcome Screen Page 169 _ IE KINO 9453 Mini ITX Motherboard Realtek AC 97 Audio Setup 5 18 Setup Status Realtek AC 97 Audio is configuring y vare installation a 11910119780 Figure 7 30 AC 97 Audio Driver Software Configuration Page 170 Corp KINO 9453 Mini ITX Motherboard Step 7 At this stage the Digital Signal Not Found screen appears Figure 7 31 continue the installation process click the YES button Digital Signature Not Found The Microsoft digital signature affirms that software has been tested with Windows and that the software has not been altered since it was tested The software you are about to install does not contain a Microsoft digital signature Therefore there is no quarantee that this software works correctly with Windows Realtek AC 37 Audio If you want to search for Microsoft digitally signed software visit the Windows Update Web site at http windowsupdate microsoft com to see if one is available Do you want to continue the installation Monts Figure 7 31 AC 97 Audio Driver Digital Signal Page 171 _ IE IT echnology Gorp KINO 9453 Mini ITX Motherboard Step 8 After clicking the YES
124. onnector Pinouts 4 3 6 Serial Port Connectors CN Label COM1 2 CN Type DB 9 CN Location See Figure 4 15 CN Pinouts See Table 4 21 and Figure 4 21 The serial ports can be connected to a serial communications device directly _ RITechnology Corp KINO 9453 Mini ITX Motherboard Figure 4 21 External Serial Port Connector 2 revom rroma 2 s emas Table 4 21 External Serial 4 3 7 USB Connector CN Label LAN USB1 and LAN USB2 CN Type USB port CN Location See Figure 4 15 CN Pinouts See Table 4 22 USB devices can be connected directly to the USB connectors on the rear panel IT echnology Gorp z wee um Table 4 22 External USB Connector Pinouts 842 54 lt lt RIechnology Corp KINO 9453 Mini ITX Motherboard Chapter 5 Installation Page 55 _ KINO 9453 Mini ITX Motherboard 5 1 Anti static Precautions WARNING Failure to take ESD precautions during the installation of the KINO 9453 may result in permanent damage to the KINO 9453 and severe injury to the user Electrostatic discharge ESD can cause serious damage to electronic components including the KINO 9453 Dry climates are
125. or contact an IEI sales representative directly To contact an IEI sales representative please send an email to sales iei com tw 3 3 1 Package Contents The KINO 9453 is shipped with the following components Quantity Item and Part Number 1 KINO 9453 Dual RS 232 Cable P N 32200 028401 RS IDE cable P N 32200 008800 RS SATA cables P N 32000 0628000 RS _ 0 RTechnology Corp KINO 9453 Mini ITX Motherboard 1 SATA power cable P N 32100 088600 RS 1 Mini jumper Pack 1 Quick installation guide CC 1 Utility CD Ke iEi 1 I O shielding Table 3 1 Package List Contents 3 3 2 Optional Items IN NOTE The items listed in this section are optional items that must be ordered separately Please contact your KINO 9453 vendor distributor or reseller for more information or contact IEI directly by sending an email to sales iei com tw The following optional items are available for the KINO 9453 _ IE KINO 9453 Mini ITX Motherboard Quantity Item and Part Number Image 1 Dual port USB cable b PIN CB USB02 RS a N 1 Four port USB cable PIN CB USB14 RS 58 1 RS 232 422 485 cable P h lt P N 32200 000077 RS CPU Cooler P N CF 479B RS Table 3 2 Optional Items
126. ors and switches include m Power Power button m Reset button m Speaker m HDD PANEL1 ACPILED BEEP PWR ACPILED PC BEEP PM SYSRST 13 14 F PANEL1 IDELED IDELED z PIN NO DESCRIPTION PIN NO DESCRIPTION 1 Power LED 2 Speaker 3 NC 4 NC 5 Power LED 6 NC 7 Power Button 8 Speaker 9 Power Button 10 NC 11 IDE LED 12 Reset Button 13 IDE LED 14 Reset Button Table 4 4 Front Panel Connector Pinouts 4 2 3 Digital Input Output Connector CN Label DIO1 CN Type 10 pin header 2x5 Page 34 KINO 9453 Mini ITX Motherboard CN Location CN Pinouts See Figure 4 4 See Table 4 5 RITechnology Corp The DIO connector is managed through a Super I O chip The DIO connector pins are user programmable The digital IO port of KINO 9453 is 5 V CMOS level EEO eo Esse PIN DESCRIPTION PIN NO DESCRIPTION 1 GND 2 5V 3 I NPUTO 4 OUTPUTO 5 INPUT1 6 OUTPUT1 7 INPUT2 8 OUTPUT2 9 INPUT3 10 OUTPUT3 Table 4 5 GPIO Connector Pinouts 4 2 4 IDE Connector CN Label CN Type CN Location CN Pinouts IDE1 40 pin header 2x20 See Figure 4 5 See Table 4 6 One primary 40 pin IDE device connector
127. out Locations pen pen Table 4 17 DVI I Connector Pinouts 4 3 4 Ethernet Connectors CN Label LAN USB1 and LAN USB2 CN Type RJ 45 CN Location See Figure 4 15 CN Pinouts See Table 4 18 The KINO 9453 is equipped with two built in GbE Ethernet controllers The controllers can connect to the LAN through two RJ 45 LAN connectors There are two LEDs on the connector indicating the status of LAN The pin assignments are listed in the following table Page 50 IC _ 0 RITechnology Corp Table 4 18 LAN1 and LAN2 Pinouts SPEED ACT LINK LED LED Figure 4 19 RJ 45 Ethernet Connector The RJ 45 Ethernet connector has two status LEDs one green and one yellow The green LED indicates activity on the port and the yellow LED indicates the port is linked See Table 4 19 SPEED LED ACT LINK LED STATUS DESCRIPTION STATUS DESCRIPTION 10Mbps connection OFF No link 100Mbps connection YELLOW Linked 1Gbps connection BLI NKI NG Data Activity Table 4 19 RJ 45 Ethernet Connector LEDs 4 3 5 Keyboard Mouse Connector CN Label KBMS1 CN Type PS 2 connector CN Location See Figure 4 15 CN Pinouts See Table 4 20 and Figure 4 20 _ IE KINO 9453 Mini ITX Motherboard The KINO 9453 keyboard and mouse connectors are standard PS 2 connectors Mouse Keyboard Table 4 20 PS 2 C
128. p KINO 9453 Mini ITX Motherboard Figure 5 19 RJ 45 Ethernet Connector 5 7 3 USB Connection The external USB Series A receptacle connectors provide easier and quicker access to external USB devices Follow the steps below to connect USB devices to the KINO 9453 Step 1 Locate the USB Series A receptacle connectors The location of the USB Series A receptacle connectors are shown in Chapter 3 Step 2 Insert a USB Series A plug Insert the USB Series plug of a device into the USB Series A receptacle on the external peripheral interface See Figure 5 20 RIechnology Corp KINO 9453 Mini ITX Motherboard Figure 5 20 USB Connector 5 7 4 VGA Monitor Connection The KINO 9453 has a single female DB 15 connector on the external peripheral interface panel The DB 15 connector is connected to a CRT or VGA monitor To connect a monitor to the KINO 9453 please follow the instructions below Step 1 Locate the female DB 15 connector The location of the female DB 15 connector is shown in Chapter 3 Step 2 Align the VGA connector Align the male DB 15 connector on the VGA screen cable with the female DB 15 connector on the external peripheral interface Step 3 Insert the VGA connector Once the connectors are properly aligned with the insert the male connector from the VGA screen into the female connector on the KINO 9453 See Figure 5 21 _ IE
129. p 3 Insert the DIMM Once properly aligned the DIMM can be inserted into the socket As the DIMM is inserted the white handles on the side of the socket will close automatically and secure the DIMM to the socket See Figure 5 6 Step 4 Removing a DIMM To remove a DIMM push both handles outward The memory module is ejected by a mechanism in the socket 5 4 Jumper Settings A NOTE A jumper is a metal bridge used to close an PLASTIC CLIP OPEN CLOSED electrical circuit It consists of two or three metal LJ pins and a small metal clip often protected by a plastic cover that slides over the pins to connect them To CLOSE SHORT a jumper means connecting the pins of the jumper with the plastic 1 and to OPEN a jumper means removing the plastic clip from a jumper 1 2 3 OPEN 2 3CLOSED Figure 5 7 Jumper Locations Before the KINO 9453 is installed in the system the jumpers must be set in accordance with the desired configuration The jumpers on the KINO 9453 are listed in Table 5 1 Description Label Type AT ATX power mode selection JP5 JP6 2 pin header Clear CMOS JP3 3 pin header mode selection JP1 JP7 6 pin header LVDS LCD voltage selection JP4 4 pin header _ IE KINO 9453 Mini ITX Motherboard LVDS screen resolution selection JP2 8 pin header RS 422 Termination Resister JP8 2 pin header RS 485
130. pe 128KB 298 0GB Yes Phusical Disks Port Drive Model Serial Type Status Vol ID 2 Maxtor 6 145 WDC UD1600 75H WD WCAL 1111 1 ESCI Exit ENTER1 Select Menu Figure E 12 Reset Disk to Non RAID Menu Step 2 Select Disks to Reset Use the arrow keys to scroll through the disk drives and press SPACE to select which drives are to be reset as non RAID After all the disks to be reset have been chosen press ENTER See Figure E 13 Intel R Matrix Storage Manager option ROM 5 0 0 1032 ICH R uR ID5 Copyright C 2003 05 Intel Corporation All Rights Reserved 1 1 Create R ID Uolume 1 Resettimg R ID data uill remoue internal R ID structures from the selected R ID disks Bu remouimg these structures the drive will revert back to a non RAID disk Port Drive Model Serial Size Status 2 Maxtor 6 160 0 Y4S5 TDYSE 152 7GB Member Disk 3 WDC UD1600JD 5H WD WCAL9Z 33 149 0GB Select the disks that should be reset CtJ Previous Next SPACE Selects ENTER1 Selection Complete T 1 Select ENTER1 Select Menu Figure 13 Select Disk to Reset Page 204 Srdo Corp KINO 9453 Mini ITX Motherboard Step 3 Reset Disk Verification After reading the warning press Y to reset the selected disks as non RAID or N to return to the Reset RAID Data menu See Figure E 14 Figure E 14 Reset Disk Ver
131. raction uu u 154 Figure 7 11 GMA Driver Installation Welcome Screen 155 Figure 7 12 GMA Driver License 156 Figure 7 13 GMA Driver Installing Notice 156 Figure 7 14 GMA Driver Installation Complete eene 157 Figure 7 15 Access Windows Control Panel 158 Page XIV dii E lt KINO 9453 Mini ITX Motherboard _ RITechnology Corp Figure 7 16 Double Click the System lcon eres einen u u u u 159 Figure 7 17 Double Click the Device Manager Tab 159 Figure 7 18 Device Manager List U u u u uu u 160 Figure 7 19 Search for Suitable Driver u u u nennen nnne nnne 161 Figure 7 20 Locate Driver 162 Figure 7 21 Location Browsing Window eese eene u u u u 162 Figure 7 22 4 AUDIO AC KIT883HD Windows Folder 163 Figure 7 23 HD Audio Driver Setup Extracting Files serene 164 Figure 7 24 HD Audio D
132. rap Um Ee 98 DMA 99 S M A R T Auto 100 32Bit Data Transfer Enabled U u u u u 100 Serial Porti Address 3F8 IRQMA eese u u u u u u u 101 Serial Port1 Mode Normal 102 Serial Port2 Address 2F8 IRQ3 J J 102 Serial Port2 Mode Normal u u uuu 102 Serial Port3 Address 8E8 rien ecce rni Leere inicie enam ads 102 Serial Port3 IRQ 11 LI l crue sc 103 Serial Port4 Address 2 8 u u u u 103 Serial Port IRQ 10 lll l i une i li AAA 103 CPU FAN Mode Setting Full On Mode T 104 CPU Temp Limit of OFF 000 J U uuu u u u 105 CPU Temp Limit of Start 020 u u u u u u T 105 CPU Temp Limit ot Full 080 106 CPU Fan Start PWM 070 II u au a a Sua assqa asa 107
133. re gt Disabled USB function support disabled gt 2 USB Ports Two USB ports are enabled gt 4 USB Ports Four USB ports are enabled gt 6 USB Ports Six USB ports are enabled gt 8 USB Ports DEFAULT Eight USB ports are enabled Page 118 _ RITechnology Corp KINO 9453 Mini ITX Motherboard gt USB 2 0 Controller Enabled Use the USB 2 0 Coniroller BIOS option to enable or disable the USB 2 0 controller gt Disabled USB 2 0 controller disabled gt Enabled DEFAULT USB 2 0 controller enabled Legacy USB Support Enabled Use the Legacy USB Support BIOS option to enable USB mouse and USB keyboard support Normally if this option is not enabled any attached USB mouse or USB keyboard does not become available until a USB compatible operating system is fully booted with all USB drivers loaded When this option is enabled any attached USB mouse or USB keyboard can control the system even when there is no USB driver loaded onto the system gt Disabled Legacy USB support disabled gt Enabled DEFAULT Legacy USB support enabled gt Auto Legacy USB support disabled if no USB devices are connected USB2 0 Controller Mode HiSpeed Use the USB2 0 Controller Mode option to set the speed of the USB2 0 controller gt FullSpeed The controller is capable of operating at 12Mb s gt HiSpeed DEFAULT The controller is capable of operating at 480Mb s BIOS EHCI Handoff Use the BIOS EHCI
134. river Setup Welcome Screen eene 165 Figure 7 25 HD Audio Driver Installation Complete u u 166 Figure 7 26 CD 4 AUDIO AC KITOSRWindows Folder 168 Figure 7 27 AC 97 Audio Driver Install Shield Wizard Starting 168 Figure 7 28 97 Audio Driver Setup Preparation 169 Figure 7 29 AC 97 Audio Driver Welcome Screen 169 Figure 7 30 AC 97 Audio Driver Software Configuration 170 Figure 7 31 AC 97 Audio Driver Digital 5 171 Figure 7 32 AC 97 Audio Driver Installation Begins 172 Figure 7 33 97 Audio Driver Installation 173 Figure 7 34 SATA RAID Driver Installation Program u u 174 Figure 7 35 SATA RAID Setup Program ICOM u u u 175 Figure 7 36 InstallShield Wizard Setup Screen eese 175 Figure 7 37 Matrix Storage Manager Setup Screen
135. rs 81 Figure 5 19 RJ 45 Ethernet Connector 82 5 20 05 c Ss 83 Figure 5 21 VGA rere Sa au aqakusun uqu apunte c 84 Figure 5 22 Serial Device Connector 85 Figure 5 23 PS 2 Keyboard Mouse 86 Figure 6 1 Video Function 138 Figure 7 1 Available Drivers U U u u u u uu u u u u 146 Figure 7 2 Chipset Driver Installation Program l u u u u 147 Figure 7 3 Chipset Driver Installation Welcome Screen 148 Figure 7 4 Chipset Driver Installation License Agreement 149 Figure 7 5 Chipset Driver Readme File Information ceres 150 Figure 7 6 Chipset Driver Installation Complete 151 Figure 7 7 Select the Operating System u u u uuu u 152 Fig r 7 8 gli 153 Figure 7 9 GMA Driver Readme File uu u u 154 Figure 7 10 GMA Driver File Ext
136. s PIO IDE transfers up to 16 MB s and Ultra ATA transfers of 100 MB s The integrated IDE interface is able to support the following IDE HDDs m Ultra ATA 100 with data transfer rates up to 100 MB s m Ultra ATA 66 with data transfer rates up to 66 MB s m Ultra ATA 33 with data transfer rates up to 33 MB s Specification Ultra ATA 100 Ultra ATA 66 Ultra ATA 100 IDE devices 2 2 2 PIO Mode 0 4 0 4 0 4 PIO Max Transfer Rate 16 6 MB s 16 6 MB s 16 6 MB s DMA UDMA designation UDMA3 4 UDMA 3 4 UDMA2 DMA UDMA Max Transfer 100 MB s 66 MB s 33 MB s Controller Interface 5V 5V 5V Table 2 3 Supported HDD Specifications 2 6 4 Intel ICH7 M Low Pin Count LPC Interface The ICH7 M LPC interface complies with the LPC 1 1 specifications the ICH7 M is connected to the following components m BIOS chipset m Super chipset The LPC bus from _ IE 2 6 5 Intel ICH7 M PCI Interface KINO 9453 Mini ITX Motherboard The PCI interface on the ICH7 M is compliant with the PCI Revision 2 3 implementation Some of the features of the PCI interface are listed below m PCI Revision 2 3 compliant m 33 MHz m 5V tolerant PCI signals except PME m Integrated PCI arbiter supports up to seven PCI bus masters 2 6 6 Intel ICH7 M Real Time Clock 256 bytes of battery backed RAM is provided by the Motorola MC 14681 8A real time clock RTC integrated int
137. se the Serial Port1 Address option to select the Serial Port 1 base address gt Disabled No base address is assigned to Serial Port 1 gt 3F8 IRQ4 DEFAULT Serial Port 1 port address is 3F8 and the interrupt address is IRQ4 gt 3E8 IRQ4 Serial Port 1 I O port address is 3E8 and the interrupt address is IRQ4 gt 2E8 IRQ3 Serial Port 1 I O port address is 2E8 and the interrupt address is IRQ3 Page 101 _ IE Serial Port Mode Normal KINO 9453 Mini ITX Motherboard Use the Serial Port1 Mode option to select the transmitting and receiving mode for the first serial port gt Normal Default Serial Port 1 mode is normal gt Serial Port 1 mode is IrDA askir Serial Port 1 mode is ASK IR gt Serial Port2 Address 2F8 IRQ3 Use the Serial Port2 Address option to select the Serial Port 2 base address gt Disabled No base address is assigned to Serial Port 2 gt 2F8 IRQ3 DEFAULT Serial Port 2 port address is 3F8 and the interrupt address is IRQ3 gt 3E8 IRQ4 Serial Port 2 I O port address is 3E8 and the interrupt address is IRQ4 gt 2E8 IRQ3 Serial Port 2 I O port address is 2E8 and the interrupt address is IRQ3 Serial Port2 Mode Normal Use the Serial Port2 Mode option to select the Serial Port2 operational mode gt Normal DEFAULT Serial Port 2 mode is normal gt IrDA Serial Port 2 mode is IrDA gt ASKIR Serial Port 2 mode is ASK IR
138. se the VT UFT8 Combo Key Support option to enable additional keys that are not provided by VT100 for the PC 101 keyboard The VT100 Terminal Definition is the standard convention used to configure and conduct emergency management tasks with UNIX based servers VT100 does not support all keys on the standard PC 101 key layout however The VT UTF8 convention makes available additional keys that are not provided by VT100 for the PC 101 keyboard gt Disabled DEFAULT Disables the VT UTF8 terminal keys gt Enabled Enables the VT UTF8 combination key Support for ANSI VT100 terminals Sredir Memory Display Delay Disabled Use the Sredir Memory Display Delay option to select the delay before memory information is displayed Configuration options are listed below m No Delay DEFAULT m Delay 1 sec m Delay 2 sec m Delay 4 sec 6 3 8 USB Configuration Use the USB Configuration menu BIOS Menu 12 to read USB configuration information and configure the USB settings Page 117 KINO 9453 Mini ITX Motherboard USB Configuration Module Version 2 24 0 11 4 USB Devices Enabled 1 Drive BIOS Menu 12 USB Configuration USB Function 8 USB ports Use the USB Function BIOS option to enable or disable a specified number of USB ports If only two USB ports are being used disabling the remaining six USB frees up system resources that can be redirected elsewehe
139. sed AC3 data to an external Dolby Digital Decoder via a coaxial cable m VCC5_AUDIO E 1 Q i SPDIF1 s 1 Figure 4 13 SPDIF Connector Locations em 5 PIN NO DESCRIPTION 1 5V 2 KEY 3 SPDIF_OUT 4 GND 5 SPDIF_IN Table 4 14 SPDIF Pinouts 4 2 13 Internal USB Connectors CN Label USB4 and USB5 CN Type 8 pin header 2x4 CN Location See Figure 4 14 CN Pinouts See Table 4 15 One 2x4 pin connector provides connectivity to two USB 2 0 ports The USB ports are used for I O bus expansion KINO 9453 Mini ITX Motherboard RTechnology Corp USB5 5V 7 7 USB USB DTO USB DT1 USB DTt1 PIN DESCRIPTION PIN NO DESCRIPTION 1 vcc 2 GND 3 DATAO 4 DATA1 5 DATAO 6 DATA1 7 GND 8 VCC Table 4 15 USB3 and USB4 Pinouts 4 3 External Interface Connectors The peripheral connectors on the back panel are connected to devices externally when the KINO 9453 is installed in a chassis The peripheral connectors on the rear panel are 2 x Audio jacks 1 x VGA connector 2 x RJ 45 Ethernet connectors 2 x Keyboard mouse connectors 2 x Serial port connectors 1 x DVI connector 4 x USB 2 0 connectors KINO 9453 Mini ITX Motherboard COM1 2 12 VIDE
140. t m RS 232 422 485 cable 5 6 2 IDE Cable Connection The IDE flat cable connects to the KINO 9453 to one or two IDE devices To connect an IDE HDD to the KINO 9453 please follow the instructions below Step 1 Locate the IDE connector The location s of the IDE device connector s is are shown in Chapter 3 Step 2 Insert the connector Connect the IDE cable connector to the onboard connector See Figure 5 14 A key on the front of the cable connector ensures it can only be inserted in one direction IC RIechnology Corp KINO 9453 Mini ITX Motherboard Figure 5 14 IDE Cable Connection Step 3 Connect the cable to an IDE device Connect the two connectors on the other side of the cable to one or two IDE devices Make sure that pin 1 on the cable corresponds to pin 1 on the connector 5 6 3 Dual RS 232 Cable Connection The dual RS 232 cable consists of two connectors attached to two independent cables Each cable is then attached to a D sub 9 male connector that is mounted onto a bracket To install the dual RS 232 cable please follow the steps below Step 1 Locate the connectors The locations of the RS 232 connectors are shown in Chapter 3 Step 2 Insert the cable connectors Insert one connector into each serial port box headers See Figure 5 15 A key on the front of the cable connectors ensures the connector can only be installed in one direction
141. t Auto The on board LAN2 controller is automatically detected Page 141 KINO 9453 Mini ITX Motherboard and enabled gt Enabled DEFAULT The on board LAN controller is manually enabled gt Disabled The on board LAN2 controller is manually disabled 6 8 Exit Use the Exit menu BIOS Menu 23 to load default BIOS values optimal failsafe values and to save configuration changes Exit Options BIOS Menu 23 Exit Save Changes and Exit Use the Save Changes and Exit option to save the changes made to the BIOS options and to exit the BIOS configuration setup program gt Discard Changes and Exit Page 142 t RiIechnology Corp KINO 9453 Mini ITX Motherboard Use the Discard Changes and Exit option to exit the BIOS configuration setup program without saving the changes made to the system Discard Changes Use the Discard Changes option to discard the changes and remain in the BIOS configuration setup program Load Optimal Defaults Use the Load Optimal Defaults option to load the optimal default values for each of the parameters on the Setup menus F9 key can be used for this operation Load Failsafe Defaults Use the Load Failsafe Defaults option to load failsafe default values for each of the parameters on the Setup menus F8 key can be used for this operation Page 143
142. t Back Next gt Cancel Figure 7 19 Search for Suitable Driver Step 7 Select Specify a Location in the Locate Driver Files window Figure 7 20 Click NEXT to continue Page 161 e IE Upgrade Device Driver Wizard Locate Driver Files ST Where do you want Windows to search for driver files ey Search for driver files for the following hardware device mj 532DD38TA0378HannStar U171 The wizard searches for suitable drivers in its driver database on your computer and in any of the following optional search locations that you specify To start the search click Next If you are searching on a floppy disk or CD ROM drive insert the floppy disk or CD before clicking Next Optional search locations Floppy disk drives Specify a location Microsoft Windows Update lt Back Cancel Figure 7 20 Locate Driver Files Step 8 Select the proper OS folder under the X 3 LAN BROADCOM BCM57xx Drivers directory Figure 7 21 in the location browsing window where is the system CD drive CDOS 8 28 ar e C Linux t3 3 43f BROADCOM 57 2 Netware ODI16 8 27 Drivers 2082 NDIS2 8 28 OpenServer 8 3 2 SCO UnixWare 8 3 2 Solaris x86 86 64 EM64T 8 3 1 1 Windows 2000 8 48 Windows ME 98 8 48 1 Windows Server 2003 32 bit 8 48e C Windows Server 20
143. t in Figure 7 1 Step 2 Anew window opens Figure 7 2 Page 146 KINO 9453 Mini ITX Motherboard 2 6 RIechnology Corp Edit View Favorites Tools Help 4 E search Folders eu A infinst_autol readme relnotes Select an item to view its description See also My Documents My Network Places My Computer 3 object s 764 KB ig My Computer 2 Figure 7 2 Chipset Driver Installation Program Step 3 Double click the infinst_ Autol icon in Figure 7 2 Step 4 The welcome screen in Figure 7 3 appears Page 147 _ IE KINO 9453 Mini ITX Motherboard Intel R Chipset Software Installation Utility 8 1 1 1010 Welcome to the Intel R Chipset Software Installation Utility This program will install the Plug and Play components for the Intel R chipset that is on this system It is strongly recommended that you exit all Windows programs before continuing Cancel Installation Frameworks Figure 7 3 Chipset Driver Installation Welcome Screen Step 5 Click NEXT in Figure 7 3 to continue the installation process Step 6 The license agreement in Figure 7 4 appears Page 148 EC 9 lt 1 RiIechnology Corp KINO 9453 Mini ITX Motherboard Intel R Chipset Software Installation Utility 8 1 1 1010 License Agreement Please read the following license agre
144. ted according to the system and graphics needs _ RITechnology Corp KINO 9453 Mini ITX Motherboard DVMT FIXED Memory 128MB Use the DVMT FIXED Memory option to specify the maximum amount of memory that can be allocated as graphics memory This option can only be configured for if DVMT Mode or Fixed Mode is selected in the DVMT Mode Select option If Combo Mode is selected the maximum amount of graphics memory is 128MB Configuration options are listed below 64MB m 128MB DEFAULT m Maximum DVMT Boot Display Device Auto Use the Boot Display Device option to select the display device used by the system when it boots Configuration options are listed below m Auto DEFAULT Flat Panel Type 1024 768 Use the Flat Panel Type option to select the type of flat panel connected to the system Configuration options are listed below m 640 480 800x600 m 1024x768 m 1280x1024 36bits m 1400x1050 36bits m 1600x1200 36bits m 1280x768 m 1680x1050 36bits m 1920x1200 36bits m 1024x768 48bits m 1400 900 36bits m 1440x900 48bits m 1280x800 Page 139 KINO 9453 Mini ITX Motherboard m 1280x600 m 2048x1536 36bits gt Local Flat Panel Scaling Auto Use the Local Flat Panel Scaling option to select the method of scaling for the flat panel screen attached to the system gt Auto DEFAULT Scaling is automatic
145. tem hardware devices appears Figure 7 18 Page 159 _ IT echnology Gorp KINO 9453 Mini ITX Motherboard Action View m Computer Disk drives Display adapters DVD CD ROM drives Floppy disk controllers Human Interface Devices amp 2 IDE ATA ATAPI controllers 8 Keyboards TA Mice and other pointing devices 8 Monitors 9 Network adapters 7 Ports COM amp LPT 4 Sound video and game controllers System devices Universal Serial Bus controllers Figure 7 18 Device Manager List Step 5 Double click the listed device that has question marks next to it This means Windows does not recognize the device Step 6 The Device Driver Wizard appears Figure 7 19 Click NEXT to continue Page 160 21 RIechnology Corp KINO 9453 Mini ITX Motherboard Upgrade Device Driver Wizard Install Hardware Device Drivers a w device driver is a software program that enables a hardware device to work with ey an operating system This wizard upgrades drivers for the following hardware device E 532DD35TA0378HannStar U171 Upgrading to a newer version of a device driver may add functionality to or improve the performance of this device What do you want the wizard to do Search for a suitable driver for my device recommended Display a list of the known drivers for this device so that can choose a specific driver l
146. to GIO ports on the iTE Super I O chipset The DIO has both 4 bit digital inputs and 4 bit digital outputs The digital inputs and digital outputs are generally control signals that control the on off circuit of external devices or TTL devices Data can be read or written to the selected address to enable the DIO functions IN NOTE For further information please refer to the datasheet for the iTE Super chipset B 2 DIO Connector Pinouts The following table describes how the DIO connector pins are connected to the Super I O GPIO port 1 Pin No Description Super I O Pin Super I O Pin Descripton 1 Ground N A N A 2 vcc N A N A 3 Output 0 GP14 General purpose 1 port 1 bit 4 4 Output 1 GP15 General purpose 1 port 1 bit 5 5 Output 2 GP16 General purpose 1 port 1 bit 6 6 Output 3 GP17 General purpose 1 port 1 bit 7 7 Input O GP10 General purpose 1 port 1 bit 0 8 Input 1 GP11 General purpose 1 port 1 bit 1 9 Input 2 GP12 General purpose 1 port 1 bit 2 10 Input 3 GP13 General purpose 1 O port 1 bit 3 Page 185 KINO 9453 Mini ITX Motherboard B 3 Assembly Language Samples B 3 1 Enable the DIO Input Function The BIOS interrupt call INT 15H controls the digital An assembly program to enable digital input functions is listed below MOV AX 6F08H Sets the digital port as input
147. ture A list of available options is shown below m m 1PWM m 2PWM m 4PWM m 8 PWM m 16 PWM m 32 PWM m 64 PWM Page 107 _ IE IT echnology Gorp CPU Fan PWM Control 100 KINO 9453 Mini ITX Motherboard The CPU Fan PWM Control option can only be set if the CPU FAN Mode Setting option is set to Manual Mode Use the CPU Fan PWM Control option to select PWM duty cycle control The PWM duty cycle specifies the width of the modulated pulse A high value ensures a wide pulse and a low value ensures a narrow pulse To select a value select the CPU Fan PWM Control option and enter a decimal number between 000 and 127 The PWM Duty Cycle control range is specified below PWM Minimum Mode 0 PWM Maximum Mode 127 Hardware Health Monitoring Use the Hardware Health Configuration menu BIOS Menu 7 monitor system environmental parameters The following health parameters are monitored Temperature monitoring The following system temperatures are monitored O CPU Temperature O System Temperature 1 O System Temperature 2 m Fan Speed Monitoring The following system fan speeds are monitored O CPU FAN Speed O System FAN Speed m Voltage Monitoring The following system voltages are monitored CPU Core 2 5V 3 30V 5 00V 12 0V GMCH 1 5V 1 05V 5VSB VBAT O O O O O O O O O Page 108 jm KINO 9453 Mini ITX Motherboard 6 3 5 ACPI C
148. us interface and an on chip buffer memory Some of the BCM5787 controller features are listed below Integrated 10 100 1000BASE T transceiver Automatic MDI crossover function PCle v1 0a 10 100 1000BASE T full half duplex MAC Wake on LAN support meeting the ACPI requirements Statistics for SNMP MIB II Ethernet like MIB and Ethernet 802 32 clause 30 Serial EEPROM or serial flash support JTAG support 2 8 LPC Bus Components 2 8 1 LPC Bus Overview The LPC bus is connected to components listed below BIOS chipset Super I O chipset _ IE T echnology Gorp KINO 9453 Mini ITX Motherboard 2 8 2 BIOS Chipset The BIOS chipset has a licensed copy of AMI BIOS installed on the chipset Some of the BIOS features are listed below wm AMI Flash BIOS m SMIBIOS DMI compliant m Console redirection function support m PXE Pre boot Execution Environment support USB booting support 2 8 3 Super I O chipset The IT8712F Super chipset is connected to the ICH7 M Southbridge through the LPC bus The IT8712F is an LPC interface based Super I O device that comes with Environment Controller integration Some of the features of the iTE IT8712F chipset are listed below LPC Interface m 98 99 2001 ACPI and LANDesk Compliant m Enhanced Hardware Monitor m Fan Speed Controller m SmartGuardian Controller m Single 5V Power Supply m Two 16C550 UARTS for serial port control m On
149. utes and seconds System Date xx xx xx Use the System Date option to set the system date Manually enter the day month and year 6 3 Advanced Use the Advanced menu BIOS Menu 2 to configure the CPU and peripheral devices through the following sub menus WARNING Setting the wrong values in the sections below may cause the system to malfunction Make sure that the settings made are compatible with the hardware m CPU Configuration see Section 6 3 1 m IDE Configuration see Section 6 3 2 m SuperlO Configuration see Section 6 3 3 Hardware Health Configuration see Section 6 3 4 m ACPI Configuration see Section 6 3 5 APM Configuration See Section 6 3 6 KINO 9453 Mini ITX Motherboard m Remote Access Configuration see Section 6 3 7 m USB Configuration see Section 6 3 8 Advanced Settings WARNING Setting wrong values in below sections may cause system to malfunction BIOS Menu 2 Advanced 6 3 1 CPU Configuration Use the CPU Configuration menu BIOS Menu 3 to view detailed CPU specifications and configure the CPU RTechnology KINO 9453 Mini ITX Motherboard Configure advanced CPU settings Module Version 13 03 Manufacturer Intel Brand String Frequency 255 2 FSB Speed 667HHz Cache L1 0 KB Cache L2 0 KB BIOS Menu 3 CPU Configuration The CPU Configuration menu BIO
150. utodesk Automatic Date Time Display Control Panel Style Manager Plotter Updates Use the settings in Control Panel to E 24 A amp personalize your computer Folder Options Fonts Game Intel R Internet Controllers Extreme Options Select an item to view its description Windows Update 4 3 Windows 2000 Support E Java Keyboard Mail Network and Dial up Co Phone and Power Options Printers Program Regional Modem Updates Options 4 Scanners and Scheduled Sounds and System Users and Cameras Tasks Multimedia Passwords 30 object s E My Computer Figure 7 16 Double Click the System Icon Step 3 Double click the Device Manager tab Figure 7 17 System Properties b xl General Network Identification Hardware User Profiles Advanced Hardware Wizard The Hardware wizard helps you install uninstall repair unplug eject and configure your hardware Hardware Wizard Device Manager The Device Manager lists all the hardware devices installed on your computer Use the Device Manager to change the properties of any device Driver Signing r Hardware Profiles Hardware profiles provide way you to set up and store different hardware configurations Hardware Profiles OK Cancel Apply Figure 7 17 Double Click the Device Manager Tab Step 4 Alist of sys
151. uts 4 2 10 10 Pin Serial Port Connectors CN Label COM4 CN Type 10 pin header 2x5 CN Location See Figure 4 11 CN Pinouts See Table 4 12 The serial ports connectors connect to RS 232 serial port device IE I Technnology Gorp KINO 9453 Mini ITX Motherboard Table 4 12 COM4 Pinouts 4 2 11 SATA Drive Connectors CN Label SATA1 and SATA2 CN Type 7 pin SATA drive connector 1x7 CN Location See Figure 4 12 CN Pinouts See Table 4 13 The two SATA drive connectors are connected to four SATA drives SATA drives transfer data at speeds as high as 1 5 Gb s 1 Corp KINO 9453 Mini ITX Motherboard SATA2 Figure 4 12 SATA Drive Connector Locations PIN NO DESCRIPTION GND TXP TXN GND RXN RXP BP U N GND Table 4 13 SATA Drive Connector Pinouts 4 2 12 SPDIF Connector CN Label SPDIF1 CN Type 5 pin header 1x5 CN Location See Figure 4 13 CN Pinouts See Table 4 14 The SPDIF connector connects to the S PDIF audio module which bears S PDIF digital output S PDIF Sony Philips Digital Interface is a newest audio transfer file format which IE I Technology Gorp allows the user to enjoy digital audio The SPDIF1 port provides digital audio to external KINO 9453 Mini ITX Motherboard speaker or compres
152. y describe the configuration options found in the menu items at the top of the BIOS screen and listed above 1 KINO 9453 Mini ITX Motherboard 6 2 Main The Main BIOS menu BIOS Menu 1 appears when the BIOS Setup program is entered The Main menu gives an overview of the basic system information NN BIOS SETUP UTILITY System vervieu AMIBIOS Version 08 00 13 Build Date 04 11 07 ID E101MR12 Processor Type Speed 255HHz Count 7255 System Memory Size 504 BIOS Menu 1 Main System Overview The System Overview lists a brief summary of different system components The fields in System Overview cannot be changed The items shown in the system overview include AMI BIOS Displays auto detected BIOS information O Version Current BIOS version Build Date Date the current BIOS version was made ID Installed BIOS ID m Processor Displays auto detected CPU specifications O Type Names the currently installed processor _ RTechnology Corp KINO 9453 Mini ITX Motherboard O Speed Lists the processor speed O Count The number of CPUs on the motherboard m System Memory Displays the auto detected system memory O Size Lists memory size The System Overview field also has two user configurable fields gt System Time xx xx xx Use the System Time option to set the system time Manually enter the hours min
153. y module is properly inserted into the slot The CF Type or CF Type Il card is properly installed into the CF socket The jumpers have been properly configured The KINO 9453 is inserted into a chassis with adequate ventilation The correct power supply is being used The following devices are properly connected IDE device SATA drives Keyboard and mouse cable Audio kit Power supply USB cable Serial port cable O O O O O O O O Parallel port cable The following external peripheral devices are properly connected to the chassis O VGA screen _ 0 RITechnology Corp KINO 9453 Mini ITX Motherboard O Keyboard O Mouse RS 232 serial communications device 5 3 CPU CPU Cooling Kit and DIMM Installation WARNING A CPU should never be turned on without the specified cooling kit being installed If the cooling kit heat sink and fan is not properly installed and the system turned on permanent damage to the CPU KINO 9453 and other electronic components attached to the system may be incurred Running a CPU without a cooling kit may also result in injury to the user The CPU CPU cooling kit and DIMM are the most critical components of the KINO 9453 If one of these component is not installed the KINO 9453 cannot run 5 3 1 Socket 479 CPU Installation WARNING CPUs are expensive and sensitive components When installing the CPU please be careful not to damage it in anyway Make sure th

Download Pdf Manuals

image

Related Search

Related Contents

TéléCHARgEZ lE DOSSIER DE PRESSE  User Guide  User Manual for inkWIZE 2  Produit: U580 Module de balayage Superbe De  

Copyright © All rights reserved.
Failed to retrieve file