Operating Instructions
Contents
1. E y L Kiel H d sjndjno Page 11 Date 26 02 2015 Version 02 2015 eng ifc24 ba en operating instructions HAINKE Staubfilter GmbH phone 49 4408 8077 0 fax 49 4408 8077 10 HEINKE eS aT P O Box 12 48 An der Imbake 7 e mail info hainke de 27795 Hude 27798 Hude web www hainke de STAUBFILTER Operating Instructions electronic solenoid valve control type IFC 24 6 Commissioning ATTENTION For commissioning and maintenance work you must make sure that no explosive atmosphere of dust air mixture is present or could occur Otherwise the lid may be opened only if the power is switched off The control must not be operated outside of its electrical thermal and mechanical performance limits The following points are to be carried out in the sequence given for initial operation Refer to drawing 6 1 Set the ON OFF switch 6 to OFF Check with the type plate which supply voltage is suitable for the unit on hand 110 120VAC and 220 240VAC or 24VDC Set the mains voltage switch 4 to the correct setting for the available supply voltage 110 120V or 220 240V Ensure that the correct fuse is inserted Refer to the technical data Pre select the outputs to be controlled by setting multi position switch 7 as desired Set the potentiometers delay and impulse time2. s ndjno vT R 18 2 Oooooooo 2 e COCO OCOCO O TI Ze esl 9L GSLHL EL TLIL OL 6 oz S 91 6l g ZL OOOOOOOO OOOOOOOO Be Aojap Z ST T Le OZ 61 BILL Canal oe OQ 001 os O DL ooz Ov oe oz Jojoajeas s o o D Buiup o sod asnj pun 1Aolo s Uu O pou d asinduwi 10 99 S 10 99 S poiuad p p 10 D91pPUI asindwi Buiup o Jo1p21pu1 u wb s 13H 4 x U Page 14 Date 26 02 2015 Version 02 2015 eng ifc24 ba en operating instructions HAINKE Staubfilter GmbH phone 49 4408 8077 0 fax 49 4408 8077 10 HEINKE eS aT P O Box 12 48 27795 Hude An der Imbake 7 e mail info hainke de 27798 Hude web www hainke de STAUBFILTER Operating Instructions electronic solenoid valve control type IFC 24 7 Control and signal funtions 7 1 Remote control input R It is possible to control the controller remotely via input R on contact strip 3 The following switch types may be connected to input R 1 potential free contact switch or relay 2 switch with electronic output PNP 3 12 to 30 VDC against 0 V The input is reverse polarity safe The remote control function is activated by setting DIP switch 1 19 to ON and de activated if that switch is set to OFF The DIP switch position may be changed whilst the controller is in operation ON OFF remote control R CR
3. operating instructions ifc24 ba_eng Version 02 2015 Date 26 02 2015 Page 13 49 4408 8077 0 phone fax HAINKE Staubfilter GmbH HAINKE 49 4408 8077 10 ui B i m z Oo o EK x g E C D Os 2 ES T Q Eo os f lt o x O 23 E oe on lt N a D s sx M Q OR an Operating Instructions electronic solenoid valve control type IFC 24 sio o uuoo pyoa Ajddns N IAJ AO aued uoi4 9 Buiweiq uoo uogo uuoo A DA piou ljos CZ HZ ZZ LZ OT GL 8LAL9LGLHLIELICLILOLG 8 L 9 G v L OOOOOOOOOOOO OOOOOOOOOOOO s 20 W 1 ad 3d N 11 ad ad O OOO O O O E sz sz zz sz sz zwet 01 79809000 OA vZ IVNOVC OCC of GE VE SE arte OOOOOOO ae S A DA plouajos x l 6 S A DA plouajos x sy opluoo uono uuoo nd no pup indu D uono lj s apow buljpuado WI W d 4osues nnss id CR a onuoo eouei ye XDU o S DA p jo uuoo au pales ANO9D SI j ojuoo L an eae aint CH pa al CH JIO JO 9D u do si jndjno A DA 10 uayoiq auim J dn sub Li MO O JO Bulssiw SI snss sd ji dn sub KR amp u9yws 440 NO 9 aen aboueo L O sajoho 0 0 Buiup l o sod Buiup l o sod ou O
4. 40 C Not explosion hazardous area 20 C to 40 C x Conformity e Low voltage directive 2006 95 EC EN 60204 1 e Electromagnetic compatibility directive 2004 108 EC t I EN 61000 6 1 EN 61000 6 2 EN 55014 1 e ATEX directive 94 9 EC EN 60079 0 EN60079 31 operating instructions ifc24 ba_eng Version 02 2015 Date 26 02 2015 Page 6 HAINKE Staubfilter GmbH phone 49 4408 8077 0 fax 49 4408 8077 10 HEINKE eS aT P O Box 12 48 27795 Hude An der Imbake 7 e mail info hainke de 27798 Hude web www hainke de STAUBFILTER Operating Instructions electronic solenoid valve control type IFC 24 4 Installation In general Add on housing polyester ATTENTION Observe relevant regulations For use in Ex Area you have to check whether the unit is suitable for the application refer to type plate and technical data The control is suitable for the installation in an industry plant To be used in explosion hazardous area Ex Area Zone 22 not conductive dust and in not Ex Area After removal the lid the mounting holes are accessible The control is to be installed in a vibration free location The polyester add on housing can be installed indoors and outdoors under hard conditions The mechanical resistance is high Polyester is absolutely corrosion proof and high resistant against aggressive chemical mediums It has to be installed within the visual range and must b
5. HAINKE Staubfilter GmbH phone fax P O Box 12 48 An der Imb ke 7 e mail 27795 Hude 27798 Hude web 49 4408 8077 0 H 49 4408 8077 10 HAINKE aS info hainke de STAUBFILTER www hainke de Operating Instructions electronic solenoid valve control type IFC 24 Driftinstruktion Bedrijfshandleiding Instru es de servi o Instrucciones de servicio Istruzioni per l sercizio Instruction de service Betriebsanleitung Operating Instructions electronic solenoid valve control type IFC 24 HAINKE Staubfilter GmbH phone 49 4408 8077 0 fax 49 4408 8077 10 HAINKE P O Box 12 48 An der Imb ke 7 e mail info hainke de EF 27795 Hude 27798 Hude web www hainke de S AUBFILTER Operating Instructions electronic solenoid valve control type IFC 24 Table of content 1 Safety precautions ANd warnings I U U U u uuu uu uu u u u T 1 2 1 1 Designation of electrical apparatus for explosion hazardous areas a 3 1 2 Operation OF the UN EE 4 1 3 Remarks for special conditions for safe use in explosion hazardous areas zone 22 4 LU Sr CBr ele E 4 Technical Calta ois l u ESA AAN RENE CEC EOC RAAR NA ARORA GG AAC CA Ce ed 5 stalan esen EA eS ae cada nine u 7 4 1 Safety notes for the installation U L S S 8 4 2 Safety notes for the installation of the add on housing U n 8 5 Electrical COMMCCUOMN LLULLU III TAA
6. 10 11 according to the specifications of the filter manufacturers Select the operating mode by means of the DIP switches 19 DIP switch 1 ON gt start the controller either via remote control or pressure difference switch refer to section 7 1 DIP switch 1 OFF gt controller direct start at connecting supply voltage DIP switch 2 ON gt nominal operating pressure test refer to section 7 3 Pressure switch on storage column must be in place DIP switch 2 OFF gt nominal operating pressure is not tested DIP switch 3 gt no function Pre select the number of post cleaning cycles required via multi position switch 12 refer to Section 7 4 Post cleaning is only available when the remote control function is used DIP switch 1 ON Re check that the controller is correctly connected in accordance with the connection diagram drawing 5 1 Connect the supply voltage according to the type plate and activate the controller by using the ON OFF switch 6 operating instructions ifc24 ba_eng Version 02 2015 Date 26 02 2015 Page 12 HAINKE Staubfilter GmbH P O Box 12 48 An der Imb ke 7 27795 Hude 27798 Hude phone 49 4408 8077 0 fax 49 4408 8077 10 HAINKE e mail info hainke de STAUBFILTER web www hainke de Operating Instructions electronic solenoid valve control type IFC 24 x The following LED s will come on after the controller has been switched x x Signalling Bee x x if remote contr
7. Hude 27798 Hude web www hainke de SIAUBFILTER Operating Instructions electronic solenoid valve control type IFC 24 8 Fault messages The fault indication wire break is assigned to the disturbed output This indicator will go off when the next non faulty impulse is received Example The message wire break occurs after the output 5 was controlled After controlling the output 6 the LED wire break goes off again From this results that the wire break fault was causes from the solenoid valve 5 8 1 Causes of fault and elimination Messages Indication Causes of fault limination Le e eE EE EEE EE EELEE EEE EELEE EELEE a Wire break LED red x No output load during the Check the settings of the multi i i control impulse or short position switch 7 The number of t circuited valve output connected valves must agree with This indicator the adjusting of the multi position will go off I i switch when the next non faulty Check the valve connection impulse is Check the valve received x Lack of air x LED red The pressure switch input Check the compressed air and the P indicates no signal at th _end of the delay time pressure switch If no monitoring of the compressed air shall be carried out switch the DIP switches 2 19 to the OFF position operating instructions ifc24 ba_eng Version 02 2015 Date 26 02 2015 Page 18 HAINKE Staubfilter GmbH phone 49 4408 8077 0
8. and wire is allowed A corresponding strain relief must be ensured operating instructions ifc24 ba_eng Version 02 2015 Date 26 02 2015 Page 8 HAINKE Staubfilter GmbH phone 49 4408 8077 0 fax 49 4408 8077 10 HAINKE P O Box 12 48 An der Imb ke 7 e mail info hainke de E 27795 Hude 27798 Hude web www hainke de SIAUBFILTER Operating Instructions electronic solenoid valve control type IFC 24 A gt M16x1 5 121 v d Z i gt CO D Oo 3 F 255 5 F 235 5 xe lt lt D z E a K Ki S x di iS length of mounting screws 4 piece M6x30 mm minimum operating instructions ifc24 ba_eng Version 02 2015 Date 26 02 2015 Page 9 HAINKE Staubfilter GmbH phone 49 4408 8077 0 fax 49 4408 8077 10 HEINKE eS ST P O Box 12 48 27795 Hude An der Imbake 7 e mail info hainke de 27798 Hude web www hainke de STAUBFILTER Operating Instructions electronic solenoid valve control type IFC 24 5 Electrical connection In general Supply voltage Solenoid valves Operating signal output Remote control input F Pressure switch input IMPORTANT NOTICE The unit may only be connected to the supply voltage as indicated on the type plate The connection of 115 VAC or 230 VAC to a control for 24 VDC will lead to destructi
9. remote control R pressure sensor P OO Rok achive ON OFF remote control R mr remote control R pressure sensor P activated Illustration 7 1 Possible settings of DIP switch 1 If the remote control function is activated the dedusting process commences as soon as 1 signal is detected at input R LED 22 lights up If the remote control function is not active then dedusting commences as soon as the supply voltage is connected Input R may alternatively be used for connection of a differential pressure regulator This starts the dedusting process in dependence to the filter resistance If a differential pressure regulator is to be connected to input R as well as the remote control then the remote control start signal must be wired in series with the differential pressure regulator contact operating instructions ifc24 ba_eng Version 02 2015 Date 26 02 2015 Page 15 HAINKE Staubfilter GmbH phone 49 4408 8077 0 fax 49 4408 8077 10 HEINKE aS ST P O Box 12 48 27795 Hude An der Imbake 7 e mail info hainke de 27798 Hude web www hainke de STAUBFILTER Operating Instructions electronic solenoid valve control type IFC 24 7 2 Operational message A potential free normally open relay contact is available on contact strip 3 for indicating the operational status The operating relay only closes if the controller is switched to ACTIVE If a fault occurs such as wire b
10. AA Tee CASCA lan 10 6 Co omimiSSIQnihgur yu aa ARS LAA s aaa tive 12 f Control and signal f nti igi Uu aS aS aaa aa eaaa annaa 15 Li Remote contol INDUL esssS SS mA A SAAD NOSA 15 7 2 Operational Message u u u ai Paid ellagedee stat desde eevee a a aS 16 To Pressure Swich MOU EE 16 TA POSTCIOAMING EE 17 3 TUE IT 18 8 1 Causes of fault and elimination s sss 18 Appendix A Declaration of conformity operating instructions ifc24 ba_eng Version 02 2015 Date 26 02 2015 Page 1 HAINKE Staubfilter GmbH phone fax P O Box 12 48 An der Imb ke 7 e mail 27795 Hude 27798 Hude web 49 4408 8077 0 49 4408 8077 10 HeEINKE info hainke de SS ST www hainke de STAUBFILTER Operating Instructions electronic solenoid valve control type IFC 24 1 Safety precautions and warnings IMPORTANT NOTICE property damage Non observance of the safety instructions can result in severe personal injury or This equipment may be installed connected commissioned operated and maintained by qualified and authorised personnel only under strict observance of these operating instructions any relevant standards and legal requirements Take particular note of the general and regional installation and safety regulations regarding work on high voltage installations e g VDE as well as the relevant regulations regarding the correct use of tools and personal protective gear Hazardous voltages are present in this electrical equ
11. e 26 02 2015 Page 3 HAINKE Staubfilter GmbH phone 49 4408 8077 0 fax 49 4408 8077 10 HAINKE P O Box 12 48 An der Imb ke 7 e mail info hainke de EF E Z 27795 Hude 27798 Hude web www hainke de SIAUBFILTER Operating Instructions electronic solenoid valve control type IFC 24 1 2 Operation of the unit ATTENTION The control may be used in normal operation only with closed lid For commissioning and maintenance work with power on you must make sure that no explosive atmosphere of dust air mixture is present or could occur Otherwise the lid may be opened only if the power is switched off At least the ingress protection IP54 must be guaranteed 1 3 Remarks for special conditions for safe use in explosion hazardous areas zone 22 ATTENTION 1 Permissible operating temperature range Ta 10 C to 40 C 2 The control has to be installed within the visual range and must be protected from any mechanical damage 3 The control must be protected from ultraviolet light daylight or ultraviolet light from lamps respectively be mounted in a protected place 4 Avoid dust deposits on the unit 5 To avoid electrostatic charging clean the unit with a damp cloth only Rubbing with nonconductive materials must be strictly avoided 2 Use as agreed NOTE If used incorrectly application related dangers may arise The control was developed for the cyclic dedusting of filtere
12. e protected from a mechanical damage For the installation outdoors the housing must be protect for weather influences with a roof or similar For use in explosion hazardous area the remarks in chapter 1 3 must be observe Refer to drawing 4 1 for mounting dimensions operating instructions ifc24 ba_eng Version 02 2015 Date 26 02 2015 Page 7 HAINKE Staubfilter GmbH phone 49 4408 8077 0 fax 49 4408 8077 10 HEINKE ES ST P O Box 12 48 27795 Hude An der Imbake 7 e mail info hainke de 27798 Hude web www hainke de STAUBFILTER Operating Instructions electronic solenoid valve control type IFC 24 4 1 Safety notes for the installation IMPORTANT NOTICE e Install according to the manufacturer s instructions and the respective national regulations and provisions as well as the relevant installation regulations e Connect and carry the ground wire 4 2 Safety notes for the installation of the add on housing IMPORTANT NOTICE The unit must be installed such that the degree of protection IP 65 to EN 60529 is guaranteed state of delivery Therefore it is important e to fix all screws of the lid e to mount the cable entries competently e to close unnecessary cable entries with stoppers e to use in the ex area only cable glands and stoppers approved for this area e The requirements of the EN 60079 14 must be met In addition only the connection of permanently installed cable
13. essed with a recovery diode EN x impulse period djustable from 60 to 600 ms indicated by red LED EN djustable from 6 to 60 ms indicated by green LED EN indication by LED delay period red lack of air wire breakage green operational signal active EN x signal output perational signal LED green potential free relay contact normally open contact load max 0 5A U 230VAC control inputs remote control input yellow LED l input for pressure switch yellow LED x urrent consumption approx 15mA supply voltage for external triggers EN housing material 4VDC 50mA max EN colour EN installation all installation operating instructions ifc24 ba_eng Version 02 2015 Date 26 02 2015 Page 5 HAINKE Staubfilter GmbH phone 49 4408 8077 0 fax 49 4408 8077 10 HAINKE P O Box 12 48 An der Imb ke 7 e mail info hainke de 27795 Hude 27798 Hude web www hainke de STAUBEILTER Operating Instructions electronic solenoid valve control type IFC 24 a e T ss a T ss a T T ss a T T T ss clamp range of cable M16 for 4 0 to 8 0 mm or 5 0 to 10mm entries _M20 for 6 5 to 12 0 mm or 10 0 to 14mm connection cross section u ss u ss maximum surface temperature Tofthe housing category 3D 80 C at 40 C ambient i temperature Permissible ambient explosion hazardous area zone 22 _temperature Ta 10 C to
14. fax 49 4408 8077 10 HIG INIKE REE a P O Box 12 48 An der Imb ke 7 e mail info hainke de STAUBFILTER 27795 Hude 27798 Hude web www hainke de EC Declaration of Conformity electronic solenoid valve control type FC 10 Herewith we declare that the electronic solenoid valve control IFC 24 in add on housing polycarbonate IP65 comply with following relevant regulations EC directive 2004 108 EG on electromagnetic compatibility EC low voltage directive 2006 95 EG EC directive 94 9 EG Equipment and protective systems intended for use in potentially explosive atmospheres Applied standards EN 61000 6 1 EN 61000 6 2 EN 55014 1 EN 60204 1 EN 60079 0 EN 60079 31 e HAINKE SES Hude 26 02 2015 K Haink General Manager
15. ipment during operation operating instructions ifc24 ba_eng Version 02 2015 Date 26 02 2015 Page 2 HAINKE Staubfilter GmbH phone 49 4408 8077 0 fax 49 4408 8077 10 HEINKE mS a P O Box 12 48 An der Imbake 7 e mail info hainke de 27795 Hude 27798 Hude web www hainke de STAUBFILTER Operating Instructions electronic solenoid valve control type IFC 24 1 1 Designation of electrical apparatus for explosion hazardous areas Designation l _ _ _ _ MUU UU UUU Z according to _ Directive 94 9 EC Particular addition to EN 60079 0 Ex tc IIIB T80 C Dc X IP65 Ta 10 40 C IP 65 A AEE Ta 10 C H Equipment category _Explosive dust air mixtures D AAA A AAA NA na Category 1 Zone 20 21 or 22 Stich ty hed SER eee ee eS th S ee Equipments that are constructively arranged to operate in agreement with Category 3D the characteristic quantities given by the manufacturer and ensure a normal i _measure of safety i Equipments of this category are intended for the use in areas where you have not to calculate with an explosive atmosphere of dust whirled up If an explosive atmosphere appears nevertheless in all probability it will be only rare and during a short time period Electrical apparatus for use in the presence of combustible dust operating instructions ifc24 ba_eng Version 02 2015 Dat
16. lements with compressed air impulses Up to 24 solenoid valves can be controlled in rotation with adjustable impulse and delay timing periods A 24VDC Remote control input is available for an external start A potential free relay contact is availabe to give an operatinal message to a host system The control must not be operated outside of its electrical thermal and mechanical performance limits operating instructions ifc24 ba_eng Version 02 2015 Date 26 02 2015 Page 4 HAINKE Staubfilter GmbH phone 49 4408 8077 0 e fax 49 4408 8077 10 HEINKE eS aT P O Box 12 48 An der Imbake 7 e mail info hainke de 27795 Hude 27798 Hude web www hainke de STAUBFILTER Operating Instructions electronic solenoid valve control type IFC 24 3 Technical data Supply voltage 220 to 240VAC 110 to 120VAC see type plate _50 60Hz voltage tolerance 5 C E22 eE T T E E AT E A T AT T T TT A T TT AT T T T T TA TT T ATA ATT TAT T T TAT TAT T T AT TT TT T T TAT T TAT T T T T T A A O A O O AT A T TT A A T T AT A T T T TT T R TA T T T T TAT T RR TA A R T TT TA T TA TA T T TA TAA AA eeen switchable with mains switch assasauausaawaqtaakassasiawiaaqasayasqanaasaassaaaqkasaawaqawqaskaywakassqass a FC 24 in add on housing polyester 24 solenoid valve outputs 24VDC output power max 24W 1A 13 to 24 outputs are activated manually by means of a multi contact switch All outputs are suppr
17. ns ifc24 ba_eng Version 02 2015 Date 26 02 2015 Page 16 HAINKE Staubfilter GmbH phone fax P O Box 12 48 An der Imb ke 7 e mail 27795 Hude 27798 Hude web 49 4408 8077 0 49 4408 8077 10 HEINKE info hainke de El www hainke de STAUBFILTER Operating Instructions electronic solenoid valve control type IFC 24 7 4 Post cleaning The post cleaning selector switch 12 may be set to values between 0 and 5 and enables post cleaning of the filter after the controller has been switched off via input R with reduced delay period Refer to Section 3 Technical Data The number of cleaning cycles can be set to between 0 and 5 via the selector switch If this switch is set to 0 there will be no post cleaning After the controller has been switched off via input R it will come to a standstill immediately following the end of any dedusting impulse operating mode STANDBY If the selector switch is set to values between 1 and 5 the controller will switch over to post cleaning after it has been switched off via input R Any sequence which has already commenced will be further processed using the shortened delay period Post cleaning itself commences with the beginning of the next cycle operating instructions ifc24 ba_eng Version 02 2015 Date 26 02 2015 Page 17 HAINKE Staubfilter GmbH phone 49 4408 8077 0 fax 49 4408 8077 10 HAINKE P O Box 12 48 An der Imb ke 7 e mail info hainke de Ess 27795
18. nstructions electronic solenoid valve control type IFC 24 uolo uuoo 29119913 S Buimeiq OGAPZ S A DA plouajos OGAPZ S A DA plouajos S A DA Z JO xoq AIDA S A DA ZL 404 xoq A DA l l y p d oda oi Jae 3 5 839 3 g g vwos9 I 2 s OVNOZL 01L1L gt az ageet LU oy 6 8 9 S v T L diez LU jou 16 8 9 S 2 Jo gizi ul ol s ai Aal s sizi tty ol si ai z o s ve vusie Z OdAPZ QWAOPZ OZZ g 2 ajqoo jo Uyjbuaj uo Buipusd p j q0 jo y 6ua uo bulpuedap abojjon Ajddns jO 6pyoA Addns z MG L WWSZ 0 UWS L HUSZ 0 6 uono s ssoi5 811M UO Oa aS SSO1D AIIM o d uW G LXGL UW G XG Aiddns A ddns C i zieforley z a s r e z e Tequjoysyelz s s gt oto oto dapo WE dad S N 1ladlad 9efse fre cc egs Ogle IB cz 79 cS e r eje cle ll CIOS 118 LZ H9 HS Uy HE LI cy Lou461 81 z1 91 S v
19. ol function is active active green 17 start via 1 signal on input R refer x i I to Section 7 1 x next output green 8 I me EES 20 only if controller is ACTIVE x x signal P yellow x 21 x depends on switch status of pressure switch control _connected trigger signal R yellow x 22 x depends on switch status of remote control connected trigger Vosti dns naaa dindin Start with remote control Kees x Remote control OFF epaqasaqwsaswasasaaqdawasaawqanpapanaphiyqanapkhpananaphppapapuanpasppai nta m n l nnm n ee n i 2290400022242000 NBBST SNS AAAA AO AA AAAA OONAN OA AANE AAAA AAAA AEAN ANAA The dedusting process commences as soon as 1 signal is detected at _ input R The connected solenoid vales will be controlled with the selected impuls delay periode x 0 signal at input R stops the valve control The control continues with a renewed star The dedusting commences as soon as the supply voltage is connected The connected solenoid vales will be controlled with the selected _impuls delay periode x e Check that the solenoid valves are working correctly At a fault free drive the operational message contact remains closed for the complete run LED 17 lights without interruption e After completing the commissioning Screw the lid on again and check the cable entries Not needed cable entries must be closed with stoppers Only relevant for the control in add on housing
20. on of the entire control unit The control is to be connected according to drawing 5 1 The values given in the technical specification are to be observed refer to section 3 The supply voltage is to be connected to contact strip 1 L and N or L and M refer to drawing 6 1 The solenoid valves are to be connected to contacts 1 to 24 on the contact strip 2 The plus poles of the solenoid valves must be bound together and connected to contacts 25 and 30 Connect the ground wire to PE on contact strip 1 The power of the connected solenoid vales may not exceed the maximum output power The operating signal output is available at contacts 31 and 32 on the contact strip 3 It s a potential free normally open relay contact refer to Section 7 2 The remote control signal is to be connected on contact 34 on the contact strip 3 Refer also to Section 7 1 The pressure switch signal is to be connected on contact 33 on contact strip 3 Refer also to Section 7 3 Supply of power to the triggers is available at contact 35 24VDC and contact 36 OV potential operating instructions ifc24 ba_eng Version 02 2015 Date 26 02 2015 Page 10 49 4408 8077 0 phone fax HAINKE Staubfilter GmbH 49 4408 8077 10 ui B i m z Be o EK x g E C D Os 2 ES T Q Eo os f lt o x O 23 E oe on lt a D s sx M Q OR an Operating I
21. reak or lack of air the operating relay will open The controller will continue operation without interruption The relay will close again as soon as no further faults are detected The green LED 20 above contact strip 3 will light up 7 3 Pressure switch Input P The nominal operating pressure in the pressure storage column can be monitored by connecting a pressure sensitive switch to input P contact strip 3 The following switch types may be connected to input P 1 Potential free contact normal pressure switch 2 Switch with electronic output PNP 3 Direct current between 12 and 30VDC against OV The input is reverse polarity proof The nominal operating pressure test function is activated by setting DIP switch 2 19 to ON it is de activated by setting this same DIP switch to the OFF position The DIP switch position may be changed whilst the controller is in operation ON OFF remote control R CO nominal operating pressure sensor P MIL I pressure test active Illustration 7 2 DIP switch 2 settings The nominal operating pressure test occurs at the end of the delay If a signal is not detected at input P the LED lack of air 14 will light up This indicator goes off if a 1 signal is detected at input P when the test is repeated at the end of the following delay If a 1 signal is detected at input P yellow LED 21 will light up operating instructio
Download Pdf Manuals
Related Search