Woodstock W1829 User's Manual
Contents
1. Figure 16 Installing the dust port Figure 17 Attaching the dust collection bag Ss OP FOX Model W1829 Mfg Since 9 11 H 5 Power Connection After you have completed all previous setup instructions and circuit requirements the machine is ready to be connected to the power supply To avoid unexpected startups or property damage use the following steps whenever connecting or disconnecting the machine Connecting Power 1 Turn the machine power switch OFF 2 Insert the power cord plug into a matching power supply receptacle as shown in Figure 18 The machine is now connected to the power source Disconnecting Power 1 Turn the machine power switch OFF 2 Grasp the molded plug and pull it completely out of the power supply receptacle as shown in Figure 19 DO NOT pull by the cord as this may damage the wires inside Figure 19 Disconnecting power 17 Model W1829 Mfg Since 9 11 Test Run Once the assembly is complete test run your machine to make sure it runs properly and is ready for regular operation The test run consists of verifying the following 1 The motor powers up and runs correctly and 2 the safety disabling mechanism on the switch works correctly If during the test run you cannot easily locate the source of an unusual noise or2. 16 AWG Plug ngiudeg u uk E M Yes Included Plug NEMA 5 15 Other Country Of ONGIR u AUT China Liga 2 Year Assembly TIME aac RET eR Ne e E Pe shia 30 Minutes Features 45 Degree Inward 90 and 45 Degree Outward Stops Jack Screw Knife Adjustment 2 1 2 Dust Port 2 Safety Push Blocks Dust Collection Fan Chute and Bag Model W1829 Mfg Since 9 11 Controls amp Features NOILOINGOULNI Fence Cutterhead Guard Outfeed Table emt I Infeed Table Dust Collection Chute Depth of Cut ON OFF Switch Adjusting Knob Figure 1 W1829 identification front view Fence Tilting Handle Fence Bracket Assembly Fence Tilting Handle Figure 2 W1829 identification rear view Model W1829 Mfg Since 9 11 SAFETY For Your Own Safety Read Manual Before Operating Machine The purpose of safety symbols is to attract your attention to possible hazardous conditions This manual uses a series of symbols and signal words intended to convey the level of importance of the safety messages The progression of symbols is described below Remember that safety messages by themselves do not eliminate danger and are not a substitute for proper accident prevention mea sures this responsibility is ultimately up to the operator Indica
3. SNOILVYsAdO ome Model W1829 Mfg Since 9 11 INTRODUCTION Woodstock Technical Support This machine has been specially designed to provide many years of trouble free service Close attention to detail ruggedly built parts and a rigid quality control program assure safe and reliable operation 2 gt Woodstock International Inc is committed to customer satisfaction Our intent with this manual is to include the basic information for safety setup operation maintenance and service of this product We stand behind our machines In the event that questions arise about your machine please contact Woodstock International Technical Support at 360 734 3482 or send e mail to tech support shopfox biz Our knowledgeable staff will help you troubleshoot problems and process warranty claims If you need the latest edition of this manual you can download it from http www shopfox biz If you have comments about this manual please contact us at Woodstock International Inc Attn Technical Documentation Manager P O Box 2309 Bellingham WA 98227 Email manualsewoodstockint com About Your Machine The W1829 6 Jointer is a benchtop machine its compact size makes for convenient placement in any shop It mounts and dismounts quickly to a workbench making it portable when necessary It is primarily used to produce straight flat faces on a wo
4. HR Pre formed Steel oM Cro RP Pre formed Steel Fence Assembly u seen cese eene te ioni do vUa es Ue Cast Iron 8020222220 ss Ue OIN LA DU pankasa PLE Aluminum 6 eS Precision Ground Cast Iron PAIN ees csc Powder Coated Other Information oia koe eue eeu eu ehe SM Su Tua Sulka u a Uv dex vu de 1 Dust Port 5176 2 l aaa anh nies PIT a Pee u as 2 1 2 in Product Dimensions lee w M M 76 lbs Width side to side x Depth front to back x Height 24 x 6x 7 3 4 in Footprint Length x Width 18 7 8 x 11 in Shipping Dimensions IBI Cardboard CONTEM HU RREEUMUTUTMUIMTT Machine Pee H ted 80 lbs Length x Width x Height cese eit tert rn Ge 26x8x 10 in Electrical Power Requirement u u es u s eer ran to nr neo s e eaa ep E ATRE 110V Single Phase 60 Hz MINIMUM Circuit SIZe acces u UA a ee nee rete ne rh nee ER e e use ER er Ee 15 Amp Cord M P 8 ft Cord GaUSC P
5. m If the motor does not start either the brushes are not correctly aligned in the sockets or there is another problem with the motor or wiring Refer to the Troubleshooting section for assistance 237 Model W1829 Mfg Since 9 11 Electrical Safety Instructions These pages are current at the time of printing However in the spirit of improvement we may make changes to the electrical systems of future machines Study this diagram carefully If you notice differences between your machine and these wiring diagrams call Woodstock International Technical Support at 360 734 3482 AWARNING SHOCK HAZARD Working on wiring that is connected to a power source is extremely dangerous Touching electrified parts will result in personal injury including but not limited to severe burns electrocution or death Disconnect the power from the machine before servicing electrical components QUALIFIED ELECTRICIAN Due to the inherent hazards of electricity only a qualified electrician should perform wiring tasks on this machine If you are not a qualified electrician get help from one before attempting any kind of wiring job WIRE CONNECTIONS All connections must be tight to prevent wires from loosening during machine operation Double check all wires disconnected or connected during any wiring task to ensure tight connections WIRE COMPONENT DAMAGE Damaged wires or components increase the risk of seri
6. H I 5 Model W1829 Mfg Since 9 11 Wiring Diagram Neutral Hot Ground 5 15 Plus As Recommended PADDLE SWITCH viewed from behind NOTICE These motor wiring diagrams are current at the time of printing how ever always default to the diagram on the inside of the junction box cover if it does not match this diagram as it will reflect any changes since this manual was printed Read Page 38 STOP Before Wiring 39 lt o RE e A x D 40 SLYVd Model W1829 Mfg Since 9 11 Parts List REF PART DESCRIPTION REF PART DESCRIPTION 1 X1829001 TABLE 49 X1829049 ALIGNMENT PIN 2 50 3 X1829003 FENCE PLATE 52 XP6000ZZ BALL BEARING 6000ZZ 4 53 5 54 6 55 7 56 8 57 9 58 10 59 60 12 61 13 62 14 63 15 64 16 65 17 66 E 67 19 68 20 69 7 70 2 71 23 72 23 1 73 24 74 247 75 XPSS2M SET SCREW M6 1 X 30 242 76 243 7 244 78 25 79 26 PHLP HD SCR M4 7 X 10 27 82 28 83 29 84 30 X1829030 TORSION SPRING 86 XP6201ZZ BALL BEARING 6201ZZ 31 87 33 89 34 90 35 91 36 92 x1829092 FAN RIBBED V BELT V1 25 7A 37 93 39 94 40 95 4 96 2 97 43 98 24 99 DE 100 45 102 46 103 47 104 48 105 41 Model W1829 Mfg Since 9 11 Parts List continued REF
7. Workbench m Flat Washer Lock Washer Hex Nut working surface before operating Failure to do so will produce unsafe operating conditions Figure 7 Example of a through mount Lag Screw Flat Washer Machine Base oH Workbench m W ce EL nl Figure 8 Example of a direct mount 13 Model W1829 Mfg Since 9 11 Assembly To assemble the jointer do these steps 1 DISCONNECT JOINTER FROM POWER 2 Use two of the included M8 1 25 x 20 cap screws and lock washers 8mm to attach the fence support to the jointer bed as shown in Figure 9 3 Insert the locking plate assembly into the fence support positioning it so the two pins are against the bottom edge of the fence support as shown in Figure 10 4 Secure the locking plate in position with the fence sliding handle as shown in Figure 11 5 Use the remaining four M8 1 25 x 20 cap screws and 8mm lock washers to attach the fence to the fence bracket assembly as shown in Figure 12 14 Cap Screws Fence Support Locking Plate Assembly Locking Plate Assembly Fence Sliding Bracket Assembly Figure
8. 22 Figure 30 Typical surface planing operation Portion Removed With Jointer Figure 31 Illustration of surface planing results AWARNING Failure to use push blocks when sur face planing may result in cutterhead contact which will cause serious per sonal injury Always use push blocks to protect your hands when surface planing on the jointer e H I 5 Model W1829 Mfg Since 9 11 Edge Jointing The purpose of edge jointing is to produce a finished flat edged surface that is suitable for joinery or finishing NO TICE If you are not experienced with a jointer set the depth of cut to 0 and practice feeding the workpiece across the tables as described below This procedure will better prepare you for the actual operation see Figure 32 It is also a necessary step when squaring rough or warped stock To edge joint on the jointer do these steps 1 Read and understand SAFETY on Page 6 2 Inspect your stock for dangerous conditions as described in the Stock Inspection amp Requirements instructions on Page 20 3 Set the cutting depth for your operation Note Between 16 and s for edge jointing using a more shallow depth for certain species or for wide stock 4 Make sure the fence is set to 90 5 If your workpiece is bowed warped place it so the concave side is
9. 1 K Dust Collection Bag Clamp 1 Hardware and Tools Not shown Screws M8 1 25 X 20 uuu epa Qua ERE TEX uS 6 Lock Washers 8mm 6 Hex Wrench 4mm 1 Hex Wrench 6mm 1 Figure 5 Small components 11 Model W1829 Mfg Since 9 11 Machine Placement Workbench Load Refer to the Machine Specifications on Page 3 for the weight and footprint specifications of your machine Some workbenches may require additional reinforcement to support both the weight of the machine and materials Working Clearances Consider the size of material to be processed through the machine space for auxiliary stands work tables and other machinery when establishing a location for your Jointer See Figure 6 for the overall machine measurements USE helpers or power lift ing equipment to lift this Otherwise serious personal injury 6 Jointer may occur CAUTION MAKE your shop child safe Close and lock all entrances when you are away NEVER allow untrained visitors in your shop when assembling adjusting operating equipment 12 Cleaning Machine The tables and other unpainted parts of your jointer are coated
10. The maximum cutting depth for one pass is s Never attempt any single cut deeper than this JOINTING WITH THE GRAIN Jointing against the grain or jointing end grain is dangerous and could pro duce chatter or excessive chip out Always joint with the grain CUTTERHEAD GUARD All operations must be performed with the cutterhead guard in place Always ensure that the cutterhead guard is in proper working condition before operating the jointer PROPER CUTTING When cutting always keep the workpiece moving toward the outfeed table until the workpiece has passed completely over the cutterhead Never back the work toward the infeed table USING GOOD STOCK Jointing safety begins with the choice of stock Inspect your stock carefully before feeding it over the cutterhead Never joint a board that has loose knots nails or staples If you have any doubts about the stability or structural integrity of your stock DO NOT joint it EXPERIENCING DIFFICULTIES If at any time you are experiencing difficulties performing the intended operation stop using the machine Contact Tech Support at 360 734 3482 Model W1829 Mfg Since 9 11 e H I 5 ELECTRICAL Circuit Requirements This machine must be connected to the correct size and type of power supply circuit or fire or electrical damage may occur Read through this section to determine if an adequate power supply circuit is available If a correct circuit is not avai
11. clothing rolled up and long hair tied up and away from machinery Figure 20 Removing switch key from paddle switch Model W1829 Mfg Since 9 11 e H I 5 OPERATIONS General This machine will perform many types of operations that are beyond the scope of this manual Many of these operations can be dangerous or deadly if performed incorrectly The instructions in this section are written with the understanding that the operator has the necessary knowledge and skills to operate this machine If at any time you are experiencing difficulties performing any operation stop using the machine If you are an inexperienced operator we strongly recommend that you read books or trade articles or seek training from an experienced jointer operator before performing any unfamiliar operations Above all your safety should come first Basic Controls This section covers the basic parts and controls used during routine operations Refer to Figures 21 22 for basic parts and control locations A ON OFF Switch Starts and stops the cutterhead rotation The switch has a yellow safety key removing it locks the switch in the OFF position Always remove this yellow key when leaving the work area This prevents unsupervised persons in your shop especially children from starting the jointer B Depth of Cut Adjustment Knob Changes the height of the infeed table to cont
12. danger ous conditions as described in the Stock Inspection amp Requirements instructions on Page 20 3 Set the cutting depth for your operation Note We suggest between 16 and s for bevel cutting using a more shallow depth for hard wood species or for wide stock 4 Make sure your fence is set to the angle of your desired cut 5 If your workpiece is cupped warped place it so the concave side toward the fence 6 Start the jointer 7 With a push block in your leading hand press the workpiece against the table and fence with firm pressure and feed the workpiece over the cutterhead as in Figure 35 Note f your leading hand gets within 4 of the cutterhead lift it up and over the cutterhead and place the push block on the portion of the workpiece that is on the outfeed table Now focus your pressure on the outfeed end of the workpiece while feeding and repeat the same action with your trailing hand when it gets within 4 of the cutterhead To keep your hands safe DO NOT let them get closer than 4 from the cutterhead when it is moving 8 Repeat Step 7 until the angled cut is satisfactory to your needs 24 NOTICE If you are not experienced with a jointer set the depth of cut to 0 and practice feeding the workpiece across the tables as described below This procedure will better prepare you for the actual operation Figure 34 Illustration of b
13. for this machine S OP FOX 5 Model W1829 Mfg Since 9 11 H SETUP Unpacking AWARNING This machine has been carefully packaged for safe transportation If you notice the machine has been damaged during shipping please contact your authorized Shop Fox dealer immediately 267 Z KA N Inventory pO Keep machine disconnected from The following is a description of the main components power until instructed otherwise shipped with the Model W1829 Lay the components out to inventory them Note If you can t find an item on this list check the mounting location on the machine or examine the packaging materials carefully Occasionally we pre install certain components for safer shipping Jointer Inventory Figures 4 5 Qty A Jointer Bed Assembly 1 FenceJuooliess eene s tices REA 1 C Dust Collection uu uuu uuu rera ER ERR TERRE RUE 1 D BIGERS uy uu ERE uqa TIME 2 E Fence Tilting Handle 1 F Fence Bracket Assembly 1 G Fence Sliding Handle 1 H Locking Plate Assembly 1 Ly Fence Support exa aus a sassa FUR VARY FREE REA 1 J aaa aaah
14. grain ROTATION e direction Cutting against the grain increases the OUTFEED TABLE likelihood of stock kickback as well as tear out on the workpiece Against Grain e Jointing and surface planing with the grain pro Figure 23 Correct setting for grain duces a better finish and is safer for the operator alignment Cutting with the grain is described as feeding the stock on the jointer so the grain points down and toward you as viewed on the edge of the stock see Figure 23 Note If the grain changes direction along the edge of the board decrease the cutting depth and make additional passes Remove foreign objects from the stock Make sure that any stock you process with the jointer is clean and free of any dirt nails staples tiny rocks or any other foreign objects that may damage the jointer blades u 2 lt o Figure 24 Minimum dimensions for edge e Only process natural wood fiber through your jointing jointer Never joint MDF particle board plywood laminates or other synthetically made materials Make sure all stock is sufficiently dried before jointing Wood with a moisture content over 20 will cause unnecessary wear on the knives and poor cutting results e DO NOT joint stock that is excessively warped or twisted e Make sure your workpiece exceeds the minimum dimension requirements see Fi
15. no additional steps are necessary Proceed to set the 45 inward and 45 outward stops see Page 34 If the fence is not perpendicular to the table adjust the 90 stop by doing Steps 6 9 6 Loosen the fence tilting handle bring the fence to 90 with the square set against the fence then tighten the handle Note Keep the limit plate tab in the rear slot of the limit block 7 Loosen the jam nut located at the rear of the limit block shaft 8 Using a flathead screwdriver turn the limit block shaft until it hits the fence 9 Tighten the jam nut The 90 stop is now set ECT AWARNING SS zu N unplugged during all service proce dures If this warning is ignored seri ous personal injury may occur MAKE SURE that your machine is Limit Plate 4 Limit Block 3 Rear Slot Limit Block Inward Stop Shaft Figure 43 Fence stop parts identification Figure 44 Checking the 90 stop m Model W1829 Mfg Since 9 11 Setting 45 Inward Stop 1 2 DISCONNECT JOINTER FROM POWER With the fence positioned over the bed and the sliding handle locked loosen the fence tilting handle and release the limit tab Tilt the fence towards the table as far as it will go then tighten the fence tilting handle Note When you tilt the fence towards the table it will stop when
16. personal injury may occur CAUTION Cutterhead knives are sharp and laceration injuries may occur Use caution when handling the cutterhead knives Clamp Screws Figure 41 Cutterhead clamp screw location Figure 42 Knife clamp screw tightening sequence Model W1829 Mfg Since 9 11 Setting Fence Angle Stops This section provides instructions for setting the fence angle stops precisely at 90 45 inward or 45 outward Note To ensure accurate results when edge jointing check the accuracy of these settings frequently monthly at a minimum and re adjust them if necessary Tools Needed Qty Flathead Screwdriver 1 Wrench 8Imim u REPE 1 Wrench TOMM 1 Setting 90 Fence Angle Stop 1 DISCONNECT THE JOINTER FROM POWER 2 Position the fence over the bed and tighten the sliding handle loosen the fence tilting handle 3 Press the forward tab of the limit plate into the rear slot of the limit block 4 the fence as far as it will go towards 90 perpendicular to the table until it hits the limit block shaft Tighten the fence tilting handle 5 Use a square to check the angle of the fence as shown in Figure 44 If the fence is perpendicular to the table the 90 stop is set correctly
17. support shopfox biz To realign or replace the cutterhead belt do these steps 1 DISCONNECT JOINTER FROM POWER 2 While facing the rear of the jointer tip it away from you until it rests on the fence assembly 3 Remove the screws that hold the motor cover to the jointer base Lift the cover off and set it aside 4 Inspect the cutterhead belt for proper tension straight alignment and possible damage or wear Note The belt is properly tensioned if it deflects about s when you press down on middle of the belt with moderate pressure from your thumb or forefinger The belt is properly aliened if it lies flat and straight on the motor shaft and drive pulley Belt damage will be evident upon inspection 5 Loosen the four motor mounting cap screws see Figure 49 but do not remove them 6 Replace a damaged belt with a new one Realign and re tension the belt 7 Tighten the motor mounting screws and replace the motor cover 8 Test run the jointer as described on Page 18 If this procedure does not solve the problem call Tech Support Note The fan belt is installed without releasing motor tension Simply slide the old belt off Slide the new belt on and replace the motor cover 236 f Motor Mount Screws E ICutterhead Belt Figure 49 Motor mounting screws and belt locations Model W1829 Mfg Since 9 11 Motor Brush Replacement This jointer has a u
18. vibration stop using the machine immediately then review Troubleshooting on Page 28 If you still cannot remedy a problem contact our Tech Support at 360 734 3482 for assistance To test run the machine do these steps 1 Make sure you understand the safety instructions at the beginning of the manual and verify that the machine is set up properly 2 Ensure all tools and objects used during setup are cleared away from the machine 3 Verify that the machine is operating correctly by turning it ON When operating correctly the machine runs smoothly with little or no vibration or rubbing noises nvestigate and correct strange or unusual noises or vibrations before operating the machine further Always disconnect the machine from power when investigating or correcting potential problems 4 Turn the machine OFF 5 Remove the switch disabling key see Figure 20 6 Try to start the machine with the paddle switch If the machine does not start the switch disabling feature is working as designed If the machine does start immediately stop the machine The switch disabling feature is not working correctly Call Tech Support for help 18 Projectiles thrown from the machine AWARNING SS could cause serious eye injury Wear safety glasses to reduce the risk of injury Loose hair and clothing could get caught in machinery and cause serious personal injury Keep loose
19. with a waxy grease that protects them from corrosion during shipment Clean this grease off with a solvent cleaner or citrus based degreaser DO NOT use chlorine based solvents such as brake parts cleaner or acetone if you happen to splash some onto a painted surface you will ruin the finish AWARNING NEVER clean with gasoline or other petroleum based solvents Most have low flash points which make them extremely flammable A risk of explosion and burning exists if these products are used Serious personal injury may occur if this warning is ignored A CAUTION ALWAYS work in well ventilated areas far from possible ignition sources when using solvents to clean machinery Many solvents are toxic when inhaled or ingested Use care when disposing waste rags and towels to be sure they DO NOT create fire or environmental hazards ain of S OP FOX 5 Model W1829 Mfg Since 9 11 H Bench Mounting The strongest bench mounting option is a Through Mount where holes are drilled all the way through the workbench and hex bolts washers and hex nuts are used to secure the machine to the workbench Bolt Another option for mounting is a Direct Mount where the machine is simply secured to the workbench with a lag screw Machine Base NOTICE This machine must be securely fastened to a stable Flat Washer
20. 12 Attaching the fence bracket assembly to the fence Model W1829 Mfg Since 9 11 6 Slide the fence bracket assembly over and onto the dovetail of the support and locking plate as shown in Figure 13 Fence Bracket Assembly _ a Figure 13 Sliding the fence bracket onto the fence support dovetails 7 Slide the fence forward until it contacts the cutterhead guard and the cutterhead guard completely covers the cutterhead as shown in Figure 14 Jointer Tables Cutterhead Guard Figure 14 Fence positioned over the jointer tables 8 Install the fence tilting handle by screwing the handle shaft into the bracket assembly as shown in ix Figure 15 gt bs Outward Stop A f 5 NEL Val TA Fence Tilting Assembly Handle Shaft Figure 15 Installing the fence tilting handle 15 lt Model W1829 Mfg Since 9 11 Dust Collection The W1829 has a built in dust collection fan and chip exhaust It also includes a 2 5 dust port clamp and dust collection bag The W1829 can also be hooked up to a pre existing dust collection system Recommended CFM at Dust Port 150 CFM Do not confuse this CFM recommendation with the rating of the dust collector To determine the CFM at the dust port you must take into account m
21. MODEL W1829 6 JOINTER MODEL Wigag DEL W182 8 JOINTER OWNER S MANUAL FOR MODELS MANUFACTURED SINCE 9 11 Phone 360 734 3482 Online Technical Support tech support shopfox biz COPYRIGHT SEPTEMBER 2011 BY WOODSTOCK INTERNATIONAL INC WARNING NO PORTION OF THIS MANUAL MAY BE REPRODUCED IN ANY SHAPE OR FORM WITHOUT THE WRITTEN APPROVAL OF WOODSTOCK INTERNATIONAL INC 14362KN Printed in China 4 WARNING This manual provides critical safety instructions on the proper setup operation maintenance and service of this machine tool Save this document refer to it often and use it to instruct other operators Failure to read understand and follow the instructions in this manual may result in fire or serious personal injury including amputation electrocution or death The owner of this machine tool is solely responsible for its safe use This responsibility includes but is not limited to proper installation in a safe environment personnel training and usage authorization proper inspection and maintenance manual availability and compre hension application of safety devices cutting sanding grinding tool integrity and the usage of personal protective equipment The manufacturer will not be held liable for injury or property damage from negligence improper training machine modifications or misuse WARNING Some dust created by power sanding sawing grinding drilling and other construction ac
22. PART DESCRIPTION REF PART DESCRIPTION 106 X1829106 RIGHT RUBBER FOOT 111 XPCAP68M CAP SCREW 6 1 X 8 107 12 108 113 108 114 110 519 PHLP HD SCR M5 8 X 6 115 X1829115 WIRE RESTRAINT AWARNING Safety labels warn about machine hazards and how to prevent machine damage or injury The owner of this machine MUST maintain the original location and readability of all labels on this machine If any label is removed or becomes unreadable REPLACE that label before allowing the machine to enter service again Contact Woodstock International Inc at 360 734 3482 or www shopfoxtools com to order new labels a WARNING AAWARNING KICKBACK ALWAYS USE HAZARD PUSH BLOCKS 4 DANGER NOTE Align this label with cutterhead throat 121 ECAWARNING AWARNING expose n gt f Failure to keep hands clear of cutterhead s these line may result in serious personal injury MODEL W1829 6 JOINTER READ and UNDERSTAND MANUAL to avoid serious 1 20 A WARNING injury If a manual is not available DO NOT use D machine Instead go to EYE LUNG www shopfox biz or call INJURY HAZARD 800 840 8420 Always wear safety glasses and a respirator when using this machine 118 REF PART DESCRIPTION REF PART DESCRIPTION 116 XLABEL 08A READ MANUAL LABEL 120 1829120 MACHINE ID LABEL 117 CUTTERHEAD GUARD LABEL 121 X1829121 CUTTE
23. R PAL pu PARROT SLICKPLANE j PRO STIIK ABRASIVE BELT amp DISC CLEANER A CCU SHARP Aluma Clusic STEELE FINE TOOLS WHOLESALE ONLY WOODSTOCK INTERNATIONAL INC Phone 360 734 3482 Fax 360 671 3053 Toll Free Fax 800 647 8801 P O Box 2309 Bellingham WA 98227 SHOPFOX BIZ
24. RHEAD EXPOSURE LABEL 118 XLABEL 06C EYE LUNG HAZARD LABEL 122 XPPAINT 1 SHOP FOX WHITE M1006 119 XLABEL 04 ELECTRICITY LABEL CUT ALONG DOTTED LINE Model W1829 Mfg Since 9 11 Ss OP FOX H 5 Warranty Registration Name Street City State Zip Phone Email Invoice Model Serial Dealer Name Purchase Date The following information is given on a voluntary basis It will be used for marketing purposes to help us develop better products and services Of course all information is strictly confidential 1 9 How did you learn about us Advertisement Mail Order Catalog Friend Website How long have you been a woodworker metalworker 0 2 Years 2 8 Years 8 20 Years How many of your machines or tools are Shop Fox 0 2 3 5 6 9 Do you think your machine represents a good value Yes Would you recommend Shop Fox products to a friend 1 _ Yes What is your age group 20 29 50 59 30 39 60 69 What is your annual household income 20 000 29 000 30 000 39 000 50 000 59 000 60 000 69 000 Which of the following magazines do you subscribe to Cabinet Maker Family Handyman Hand Loader Handy Home Shop Machinist Journal of Light Cont Popular Mechanics Popular Science Popular Woodworking Practical Homeowner Precision Shooter Projects in Metal Live Steam RC Modeler Model Airplane News Rifle Modeltec Shop Notes Old House Journa
25. Troubleshooting Grounding Requirements 10 Checking Adjusting Knife Height Extension Cords 10 Replacing Knives Setting Fence Angle Stops SETUP is UO 11 V Belt ML bli cd oC eee Motor Brush Replacement bel RR LM CLE Electrical Safety Instructions Machine Placement 12 Wiring Diagram Cleaning Machine IX cene Bench Mounting 13 PARTS asuata Assembly uuu uye suya cease saa says 14 sas Dust Collection 16 fI Recommended Adjustments 16 PoWer au a 17 WARRANTY Test Run essere tona nn ree xen nne 18 OPERATIONS eee eh u inann 19 19 Basic Controls u 19 Stock Inspection amp Requirements 20 Squaring SEOCK iecore sss eb E edv Er aaa 21 S rface Plani g 22 Edge Jointing 23 Bevel 24 3 A z 5 JADIAYAS
26. anty then the original owner must bear the cost of storing and returning the product This is Woodstock International Inc s sole written warranty and any and all warranties that may be implied by law including any merchantability or fitness for any particular purpose are hereby limited to the duration of this written warranty We do not warrant that Shop Fox machinery complies with the provisions of any law or acts In no event shall Woodstock International Inc s liability under this warranty exceed the purchase price paid for the product and any legal actions brought against Woodstock International Inc shall be tried in the State of Washington County of Whatcom We shall in no event be liable for death injuries to persons or property or for incidental contingent special or consequential damages arising from the use of our products Every effort has been made to ensure that all Shop Fox machinery meets high quality and durability standards We reserve the right to change specifications at any time because of our commitment to continuously improve the quality of our products EM WOODSTOCK INTERNATIONAL INC High Quality Machines and Tools Woodstock International Inc carries thousands of products designed to meet the needs of today s woodworkers and metalworkers Ask your dealer about these fine products UV JOINTER PAL Rotacator mE D U RA STI C Gi MANN REBEL BOARD BUDDIES cms PLANE
27. any variables including the CFM rating of the dust collector the length of hose between the dust collector and the machine the amount of branches or Y s and the amount of other open lines throughout the system Explaining this calculation is beyond the scope of this manual If you are unsure of your system consult an expert or purchase a good dust collection how to book To install the dust port and collection bag do these steps 1 Install the dust port to the chip exhaust as shown in Figure 16 2 Slip the bag clamp over the collection bag then attach the collection bag to the dust port and clamp it in place as shown in Figure 17 Recommended Adjustments For your convenience the adjustments listed below have been performed at the factory and no further setup is required to operate your machine However because of the many variables involved with shipping we recommend that you at least verify the following adjustments to ensure the best possible results from your new machine Step by step instructions for these adjustments can be found in Service on Page 28 1 Knife settings see Page 30 2 Fence stop accuracy see Page 33 16 A CAUTION DO NOT operate this machine with out an adequate dust collection sys tem This machine creates substantial amounts of wood dust while operating Failure to use a dust collection system can result in short and long term respi ratory illness
28. build up around the motor is a sure way to decrease its life span Table amp Base Tables can be kept rust free with regular applications of products like SLIPIT For long term storage you may want to consider products like Boeshield T 9 V Belts To ensure optimum power transmission from the motor to the blade the V belt must be in good condition free from cracks fraying and wear and properly aligned and tensioned refer to V Belt Replacement on Page 36 27 AWARNING P Q AC MAKE SURE that your machine is unplugged during all maintenance pro cedures If this warning is ignored seri ous personal injury may occur Lubrication Since all bearings are sealed and permanently lubricated simply leave them alone until they need to be replaced Do not lubricate them gt m Z gt 2 Q m Model W1829 Mfg Since 9 11 SERVICE General This section covers the most common service adjustments or procedures that may need to be made during the life of your machine If you require additional machine service not included in this section please contact Woodstock International Technical Support at 360 734 3482 or send e mail to tech support shopfox biz Troubleshooting This section covers the most common problems and corrections with this type of machine WARNING DO NOT make any adjustments until power is disconnected and moving parts have
29. come to a complete stop Motor amp Electrical PROBLEM Machine does not start or a breaker trips Machine stalls is underpowered or is overloaded POSSIBLE CAUSE Safety key removed from ON OFF switch Plug receptacle is at fault or wired incorrectly Power supply is at fault switched OFF Lockout key is malfunctioning Motor brushes are at fault Motor ON OFF switch is at fault Wiring is open has high resistance Motor is at fault Wrong workpiece material wood Cutterhead belt slipping Plug receptacle is at fault Motor brushes are at fault Motor bearings are at fault Knives dull feed rate is too fast depth of cut too great 7 Motor has overheated Motor is at fault 28 Replace safety key Test for good contacts correct the wiring Ensure hot lines have correct voltage on all legs and main power supply is switched ON Replace lockout key replace switch Remove replace brushes Replace faulty ON OFF switch Check for broken wires or disconnected corroded connections and repair replace as necessary Test repair replace Use wood with correct moisture content without glues and little pitch resins Replace cutterhead belt and re tension Test for good contacts correct the wiring Remove replace brushes Test by rotating shaft rotational grinding loose shaf
30. ead knives do these steps 1 DISCONNECT JOINTER FROM POWER 2 Carefully rotate the cutterhead until the clamp screws are accessible 3 Remove the cutterhead clamp screws fastening the knife to the cutterhead see Figure 41 Carefully remove the knife and clamp from the cutterhead 4 Repeat Steps 2 3 for the second cutterhead knife 5 Clean the cutterhead thoroughly before installing new knives or re installing sharpened knives 6 Install one knife clamp it in the cutterhead and slightly tighten each of the clamp screws in sequence as shown in Figure 42 Note By tightening the clamp screws out of sequence jointing results may be hampered Following the tightening sequence reduces that possibility 7 Repeat Step 6 for the second cutterhead knife 8 Check the alignment of the knives to the outfeed table They should be parallel to the outfeed table If the knife is not parallel to the outfeed table adjust the jack screws to fine tune the knife height Refer to Checking Adjusting Knife Height on Page 30 9 Follow the tightening sequence and final tighten each of the clamp screws for both knives as shown in Figure 42 10 Ensure cutterhead guard is working properly Align the fence as needed Perform a test cut on a suitable piece of scrap material 32 MAKE SURE that your machine is AWARNING SP unplugged during all service proce dures If this warning is ignored seri ous
31. ety and operational information is not under stood and followed DO NOT risk your safety by not reading USE this and other machinery with caution and respect Always consider safety first as it applies to your individual working conditions No list of safety guidelines can be complete every shop environment is different Failure to follow guidelines could result in serious personal injury damage to equipment or poor work results JOINTER KICKBACK Kickback is when the workpiece is thrown off the jointer table by the force of the cutterhead Always use push blocks and safety glasses to reduce the likelihood of injury from kick back If you do not understand what kickback is or how it occurs DO NOT operate this machine CUTTERHEAD ALIGNMENT Keep the edge of the cutterhead knives at top dead center TDC even with the top edge of the outfeed table to avoid kickback and personal injuries WORKPIECE SUPPORT Supporting the workpiece adequately at all times while jointing is crucial for making safe cuts and avoiding injury Never attempt to make a cut with an unstable workpiece PUSH BLOCKS Always use push blocks whenever surface planing Never pass your hands directly over the cutterhead without a push block KICKBACK ZONE The kickback zone is the path directly through the end of the infeed table Never stand or allow others to stand in this area during operation MAXIMUM CUTTING DEPTH
32. evel cutting results AA Figure 35 Typical bevel cutting operation Model W1829 Mfg Since 9 11 ACCESSORIES The following jointer accessories may be available through your local Woodstock International Inc Dealer If you do not have a dealer in your area these products are also available through online dealers Please call or e mail Woodstock International Inc Customer Service to get a current listing of dealers at 1 800 840 8420 at salesewoodstockint com D3319 6 Replacement Jointer Knives Set of 2 D1123 Steelex Knife Sharpener Add a razor hone to your planer and jointer knives with this hand held sharpening device This handy tool sharpens flat and beveled surfaces quickly and easily Great for touch ups D3640 Shop Fox Tool Table Plus This new tool table plus was designed to answer customer requests for a slightly wider and taller table It is built to accommodate a variety of bench top machines including the W1829 Jointer m 5 W1218A Rotacator Adjust the W1829 to within 001 The magnetic base keeps the Rotacator firmly in position while the indicator indexes at 0 90 180 and 270 for unmatched versatility This is an extremely precise and useful tool 25 Model W1829 Mfg Since 9 11 D2675 Safety Glasses D2676 Adju
33. face down on the surface of the infeed table Figure 32 Illustration of edge jointing 6 Start the jointer results 7 Press the workpiece against the table and fence with firm pressure Use your trailing hand to guide the workpiece through the cut and feed the workpiece over the cutterhead see Figure 33 m 5 Note f your leading hand gets within 4 of the cutterhead lift it up and over the cutterhead and place it on the portion of the workpiece that is over the outfeed table Focus your pressure on the outfeed end of the workpiece while feeding and repeat the same action with your trailing hand if it gets within 4 of the cutterhead Keep your hands safe DO NOT let them get closer than 4 from the cutterhead s v Figure 33 Typical edge jointing operation 8 Repeat Step 7 until the entire edge is flat 23 o Model W1829 Mfg Since 9 11 Bevel Cutting The purpose of bevel cutting is to cut a specific angle into the edge of a workpiece see Figure 34 The Model W1829 has preset fence stops at 45 inward 90 and 45 outward 135 If your situation requires a different angle the preset fence stops can be easily adjusted for your needs To bevel cut on the jointer do these steps 1 Read and understand SAFETY beginning on Page 6 2 Make sure your stock has been inspected for
34. gures 24 25 before edge jointing or surface planing or it may break or kick back during the operation Figure 25 Minimum dimensions for surface planing 20 Model W1829 Mfg Since 9 11 FOX Squaring Stock Squaring stock involves four steps performed in the order below 1 Surface Plane on Jointer The concave face of the workpiece is surface planed flat with the jointer see Figure 26 2 Surface Plane on a Thickness Planer The opposite face of the workpiece is surface planed flat with a thickness planer see Figure 27 3 Edge Joint on the Jointer The concave edge of the workpiece is jointed flat with the jointer see This Side Previously Figure 28 Surface Planed 4 Rip Cut on a Table Saw The jointed edge of the workpiece is placed against a table saw fence and the opposite edge cut off see Figure 29 planer SNOILVYAdO This Side SS Previously Edge Jointed Figure 29 m cut on a table saw 21 N 2 ja o Model W1829 Mfg Since 9 11 Surface Planing The purpose of surface planing on the jointer is to make one flat face on a piece of stock see Figures 30 31 to prepare it for surface planing on a thickness planer NOTICE If you are not experienced with a jointer set the de
35. his manual AWARNING X Incorrectly wiring or grounding this machine can cause electrocution fire or machine damage To reduce this risk only a qualified electrician or service personnel should do any required electrical work for this machine NOTICE The circuit requirements listed in this manual apply to a dedicated circuit where only one machine will be running at a time If this machine will be connected to a shared circuit where multiple machines will be running at the same time consult a qualified electrician to ensure that the circuit is properly sized for safe operation 1V2I4 12313 lt O Model W1829 Mfg Since 9 11 Grounding Requirements This machine MUST be grounded In the event of certain types of malfunctions or breakdowns grounding provides a path of least resistance for electric current to travel in order to reduce the risk of electric shock Improper connection of the equipment grounding wire will increase the risk of electric shock The wire with green insulation with without yellow stripes is the equipment grounding wire If repair or replacement of the power cord or plug is necessary do not connect the equipment grounding wire to a live current carrying terminal Check with a qualified electrician or service personnel if you do not understand these grounding requirements or if you are in doubt abou
36. ions that make workpiece control difficult or increase the risk of accidental injury UNATTENDED OPERATION Never leave machine running while unattended Turn machine off and ensure all moving parts completely stop before walking away MAINTAIN WITH CARE Follow all maintenance instructions and lubrication schedules to keep machine in good working condition An improperly maintained machine may increase the risk of serious injury CHECK DAMAGED PARTS Regularly inspect machine for damaged parts loose bolts mis adjusted or mis aligned parts binding or any other conditions that may affect safe operation Always repair or replace damaged parts wires cords or plugs before operating machine MAINTAIN POWER CORDS When disconnecting cord connected machines from power grab and pull the plug NOT the cord Pulling the cord may damage the wires inside Do not handle the cord plug with wet hands Avoid cord damage by keeping it away from heated surfaces high traffic areas harsh chemicals and wet or damp locations EXPERIENCING DIFFICULTIES If at any time you are experiencing difficulties performing the intended operation stop using the machine Contact our Technical Support for help at 360 734 3482 Model W1829 Mfg Since 9 11 Additional Safety for Jointers AWARNING A CAUTION READ and understand this entire manual before using this machine Serious per sonal injury may occur if saf
37. it hits the inward stop bolt Use a combination square to check the angle of the fence as shown in Figure 45 f the fence leans 45 towards the table the inward 45 stop is set correctly proceed to set the outward 45 stop see Page 35 f the fence does not lean 45 towards the table adjust the inward 45 stop by performing Steps 5 9 Loosen the fence tilting handle bring the fence to 45 then tighten the handle just enough to keep the fence in position Remove the limit block from the fence bracket assembly and set it aside Using two 8mm wrenches adjust the inward stop bolt see Figure 46 until it contacts the fence at precisely 45 inward then tighten the jam nut where the bolt meets the bracket assembly while holding the stop bolt in place Some trial and error will be required to set this stop correctly Use two 8mm wrenches to tighten the hex nut on the inward stop as you hold the stop in place Put the limit block back bring the fence back to 90 and tighten the tilting handle 34 Figure 45 Checking the inward 45 stop Inward Stop Bolt Figure 46 Adjusting the inward stop bolt Model W1829 Mfg Since 9 11 Setting 45 Outward Stop 1 2 DISCONNECT JOINTER FROM POWER Loosen the fence tilting handle remove the limit block and set it aside Tilt the fence backward away from the table until it stop
38. jury CHILDREN amp BYSTANDERS Keep children and bystanders a safe distance away from work area Stop using machine if children or bystanders become a distraction REMOVE ADJUSTING TOOLS Never leave adjustment tools chuck keys wrenches etc in or on machine especially near moving parts Verify removal before starting SECURING WORKPIECE When required use clamps or vises to secure workpiece A secured workpiece protects hands and frees both of them to operate the machine FEED DIRECTION Unless otherwise noted feed work against the rotation of blades or cutters Feeding in the same direction of rotation may pull your hand into the cut GUARDS amp COVERS Guards and covers can protect you from accidental contact with moving parts or flying debris Make sure they are properly installed undamaged and working correctly before using machine NEVER STAND ON MACHINE Serious injury or accidental contact with cutting tool may occur if machine is tipped Machine may be damaged STABLE MACHINE Unexpected movement during operations greatly increases the risk of injury and loss of control Verify machines are stable secure and mobile bases if used are locked before starting FORCING MACHINERY Do not force machine It will do the job safer and better at the rate for which it was designed AWKWARD POSITIONS Keep proper footing and balance at all times when operating machine Do not overreach Avoid awkward hand posit
39. l Shotgun News Comments Other Local Store 20 Years 10 No No 40 49 70 ___ 40 000 549 000 70 000 Today s Homeowner Wood Wooden Boat Woodshop News Woodsmith Woodwork Woodworker West Woodworker s Journal Other FOLD ALONG DOTTED LINE WOODSTOCK INTERNATIONAL INC P O BOX 2309 BELLINGHAM WA 98227 2309 FOLD ALONG DOTTED LINE TAPE ALONG EDGES PLEASE DO NOT STAPLE e H 5 Model W1829 Mfg Since 9 11 WARRANTY Woodstock International Inc warrants all Shop Fox machinery to be free of defects from workmanship and materials for a period of two years from the date of original purchase by the original owner This warranty does not apply to defects due directly or indirectly to misuse abuse negligence or accidents lack of maintenance or reimbursement of third party expenses incurred Woodstock International Inc will repair or replace at its expense and at its option the Shop Fox machine or machine part which in normal use has proven to be defective provided that the original owner returns the product prepaid to a Shop Fox factory service center with proof of their purchase of the product within two years and provides Woodstock International Inc reasonable opportunity to verify the alleged defect through inspection If it is determined there is no defect or that the defect resulted from causes not within the scope of Woodstock International Inc s warr
40. lable a qualified electrician MUST install one before you can connect the machine to power A power supply circuit includes all electrical equipment between the breaker box or fuse panel in the building and the machine The power supply circuit used for this machine must be sized to safely handle the full load current drawn from the machine for an extended period of time If this machine is connected to a circuit protected by fuses use a time delay fuse marked D Full Load Current Rating The full load current rating is the amperage a machine draws at 100 of the rated output power On machines with multiple motors this is the amperage drawn by the largest motor or sum of all motors and electrical devices that might operate at one time during normal operations Full Load Current Rating at 110V 12 Amps Circuit Requirements for 110V This machine can be converted to operate on a 110V power supply details about voltage conversion can be found later in this manual The 110V power supply circuit must have a verified ground and meet the requirements that follow Circuit Type 110V 120V 60 Hz Single Phase Circ it SIZE uuu a ssaassssaspasawaptssayakysqawqshaqaasias 15 Amps Plug Receptacle NEMA 5 15 AWARNING The machine must be properly set up before it is safe to operate DO NOT connect this machine to the power source until instructed to do later in t
41. ly to check the knife height f the knife moves the straightedge slightly forward and back on the table the knife height is set correctly If the knife does not move the straightedge slightly forward and back on the table continue to make fine adjustments with the jack screws until the knife is set correctly When the knife heights are set correctly final tighten each of the knives clamp screws according to the proper tightening sequence see Figure 40 Return the cutterhead guard to the operating position and ensure it is working properly Re align the fence and tables as needed Perform a test cut on suitable piece of scrap material 31 A CAUTION Cutterhead knives are sharp and laceration injuries may occur Use caution when handling the cutterhead knives Black Lines Represent Straightedge Positions From Overhead View Figure 40 Knife clamp screw tightening sequence Model W1829 Mfg Since 9 11 Replacing Knives Sharp cutterhead knives provide the best cutting results Under normal operation these knives will become dull and need to be sharpened or replaced Refer to Troubleshooting see Page 28 to determine if the knives may be dull Tools Needed Qty Hex Wrench rh rh rrr xr ern 1 Hex Wrench 5mm 1 To replace the cutterh
42. n when operating or observing loud machinery Extended exposure to this noise without hearing protection can cause permanent hearing loss MENTAL ALERTNESS Be mentally alert when running machinery Never operate under the influence of drugs or alcohol when tired or when distracted DISCONNECTING POWER SUPPLY Always disconnect machine from power supply before servicing adjusting or changing cutting tools bits blades cutters etc Make sure switch is in OFF position before reconnecting to avoid an unexpected or unintentional start DANGEROUS ENVIRONMENTS Do not use machinery in wet or rainy locations cluttered areas around flammables or in poorly lit areas Keep work area clean dry and well lighted to minimize risk of injury Model W1829 Mfg Since 9 11 APPROVED OPERATION Untrained operators can be seriously hurt by machinery Only allow trained or properly supervised people to use machine When machine is not being used disconnect power remove switch keys or lock out machine to prevent unauthorized use especially around children Make workshop kid proof ONLY USE AS INTENDED Only use machine for its intended purpose Never modify or alter machine for a purpose not intended by the manufacturer or serious injury may result USE RECOMMENDED ACCESSORIES Consult this owner s manual or the manufacturer for recommended accessories Using improper accessories will increase the risk of serious in
43. niversal motor that uses carbon brushes which are considered wear items Refer to the troubleshooting guide to determine if the motor brushes must be replaced You can order a new brush kit two brush assemblies by calling customer service and ordering part X1829024 1 To replace motor brushes do these steps 1 DISCONNECT JOINTER FROM POWER 2 While facing the rear of the jointer tip it away from you until it rests on the fence assembly 3 Remove the screws that hold the motor cover to the jointer base Lift the cover off and set it aside 4 Vacuum all dust and debris from the motor and belt areas 5 Use a dime to unscrew the brush caps See Figure 50 to locate the brush caps Brush Cap si Locations Note When you remove the brush caps a spring will pop out of the socket the carbon brush is firmly attached to this spring When you buy a new brush kit you will get a pair of brush spring assemblies 6 Check the brushes for wear If a brush is worn to less than 3 32 in length replace both brushes 7 Insert the brush assemblies positioning them so they slide into the slots built into the sockets then press the brush cap against the spring push it into the Figure 50 Removing a motor brush socket and turn it to lock it in the motor housing 8 Replace the motor cover 9 Test run the jointer as described on Page 18 the jointer runs properly you are done ua 2
44. o 5 passes to achieve a perfect edge depending on the starting condition of the board and the depth of cut 29 Model W1829 Mfg Since 9 11 Checking Adjusting Knife Height The knives MUST be level with the outfeed table when they are at top dead center their highest point during rotation or the workpiece cannot be safely fed across the jointer Tools Needed Qty Hex Wrench 4mm 1 Hex Wrench DIMM e Pr ar RE Ea Re 1 Checking Knife Height 1 DISCONNECT JOINTER FROM POWER SOURCE 2 Place a straightedge on the outfeed table so it extends over the cutterhead For best results use a straight edge that will stand on edge without having to be held in place as illustrated in Figure 36 3 Rotate the cutterhead under the straightedge f the knives are parallel to the straightedge rotating the cutterhead will move the straightedge slightly s forward no adjustments are necessary If the knives fall below the straightedge or if the knives lift the straightedge and move it more than 1 4 when you rotate the cutterhead the knives must be adjusted Adjusting Knife height 1 DISCONNECT JOINTER FROM POWER SOURCE 2 Block the cutterhead guard back so the cutterhead is fully exposed 3 Locate the knife clamp screws and knife adjustment jack screws see Figures 37 38 Note You will perform the procedure in Steps 4 8 fo
45. ous personal injury fire or machine damage If you notice that any wires or components are damaged while performing a wiring task replace those wires or components before completing the task MOTOR WIRING The motor wiring shown in these diagrams is current at the time of printing but it may not match your machine Always use the wiring diagram inside the motor junction box MODIFICATIONS Using aftermarket parts or modifying the wiring beyond what is shown in the diagram may lead to unpredictable results including serious injury or fire CAPACITORS INVERTERS Some capacitors and power inverters store an electrical charge for up to five minutes after being disconnected from the power source To avoid being shocked wait at least this long before working on these components ELECTRICAL REQUIREMENTS You MUST follow the electrical requirements at the beginning of this manual when connecting your machine to a power source EXPERIENCING DIFFICULTIES If you are experiencing difficulties understanding the information included in this section contact our Technical Support at 360 734 3482 NOTICE The photos and diagrams included in this section are best viewed in color You can view these pages in color at www shopfox biz BLACK WHITE w GREEN G RED WIRING DIAGRAM COLOR KEY BLUE YELLOW BROWN A BLUE 8 fj GRAY end UR ORANGE PINK QUOIsE 789 38 e
46. pth of cut to 0 and practice feeding the workpiece across the tables as described below This procedure will better prepare you for the actual operation To surface plane on the jointer do these steps 1 Read and understand SAFETY beginning on Page 6 2 Make sure your stock has been inspected for dangerous conditions as described in the Stock Inspection amp Requirements instructions on Page 20 3 Set the cutting depth for your operation We suggest 32 for surface planing using a more shallow depth for hard wood species or for wide stock 4 Make sure your fence is set to 90 5 If your workpiece is cupped warped place it so the concave side is face down on the surface of the infeed table 6 Start the jointer 7 With a push block in each hand press the workpiece against the table and fence with firm pressure and feed the workpiece over the cutterhead Figure 30 Note When your leading hand with push block gets within 4 of the cutterhead lift it up and over the cutterhead and place the push block on the por tion of the workpiece that is on the outfeed table Now focus your pressure on the outfeed end of the workpiece while feeding and repeat the same action with your trailing hand when it gets within 4 of the cutterhead To keep your hands safe DO NOT let them get closer than 4 from the cutterhead when it is moving 8 Repeat Step 7 until the entire surface is flat
47. r each of the two knives 4 Use 4mm hex wrench to loosen the four knife clamp screws 5 Adjust the two jack screws until both ends are sightly below the straightedge 30 MAKE SURE that your machine is AWARNING SP unplugged during all service proce dures If this warning is ignored seri ous personal injury may occur Straightedge Figure 36 Illustration of a typical cutterhead alignment setup Cutterhead Knife Clamp Screws Knife Adjustment Jack Screws Figure 38 Knife adjustment jack screws Model W1829 Mfg Since 9 11 ost 10 11 12 13 Move the straightedge to position A as shown in Figure 39 Turn the jack screw nearest the fence counterclockwise until the end of the knife touches the straishtedge Move the straightedge to position B as shown in Figure 39 Turn the jack screw nearest the suard counterclockwise until the end of the knife touches the straightedge Slightly tighten the clamp screws according to the proper tightening sequence as shown in Figure 40 Repeat Steps 6 7 for the other cutterhead knife Note Slightly tightening the clamp screws maintains the knife position while performing the same step on the other knife They will be final tightened in a later step Without disturbing the knife clamp rotate the cutterhead slight
48. rkpiece in order to properly square the material for further layout construction and joining Model W1829 Mfg Since 9 11 MACHINE SPECIFICATIONS Woodstock International Inc e Phone 800 840 8420 Web www shopfox biz MODEL W1829 SHOP FOX 6 BENCHTOP JOINTER Motors Main 1b Universal ET e ETTMS 1 1 2 HP 110V di gm LUE Single Phase Dif 12A Speed 20 000 RPM CYCLO p W U n aswaa 60 Hz NUMBEr of uu s uyantaqa hacia alten hae 1 Power Transiter CD Belt Drive BEAMINGS E TN Shielded and Lubricated Main Specifications Cutting Capacities Joiltilig siccis irse boda iU Vx OFEN Left amp Right 45 Maximum Width Of QUE uay ass reet eer resa RE Ra Ye ys e Pe VE AVI TR EE EE 6 in Maximum Depth of CUE u u rore rere vi eese ani ios 1 8 in Number of Cuts Per Minute 20 000 Fence Information Fence Eid 22 7 8 in Fence Width
49. rkpiece for knots and grain Page 20 in wood only use clean stock 2 Nicked or chipped blades 2 Adjust one of the nicked knives sideways replace knives Page 32 3 Feeding workpiece too fast 3 Slow down the feed rate 4 Taking too deep of a cut 4 Take smaller depth of cut Always reduce cutting depth when surface planing or working with hard woods Fuzzy Grain 1 Wood may have high moisture con 1 Check moisture content and allow to dry if moisture tent or surface wetness is over 15 2 Dull knives 2 Replace knives Page 32 Long lines or ridges that 1 Nicked or chipped knives 1 Sharpen or replace knives Page 32 run along the length of the board Uneven cutter marks wavy 1 Feeding workpiece too fast 1 Slow down the feed rate surface or chatter marks 2 Knives not adjusted at even heights 2 Adjust the knives so they are set up evenly in the n the face of the in the cutterhead cutterhead Page 30 oard Board edge is concave 1 Board not held with even pressure 1 Hold board with even pressure as it moves over the convex after jointing on infeed and outfeed table during cutterhead cut 2 Board started too uneven 2 Take partial cuts to remove the extreme high spots before doing a full pass 3 Board has excessive bow or twist 3 Surface plane one face so there is a good surface to along its length position against the fence 4 Insufficient number of passes 4 t may take 3 t
50. rol the depth of cut C Fence Tilting Handle Locks the fence at the desired angle Use fence stops to quickly set the fence to 90 perpendicular to the tables 45 inward or 45 outward D Fence Sliding Handle Allows you to adjust the position of the fence over the tables ALWAYS tighten it before you begin operations The position of the fence determines the width of the cut as the workpiece moves over the cutterhead NEVER operate the jointer if ANY part of cutterhead is exposed on the work area 19 AWARNING READ and understand this entire instruc tion manual before using this machine Serious personal injury may occur if safety and operational information is not understood and followed DO NOT risk your safety by not reading Figure 21 1829 basic controls in front Figure 22 W1829 basic controls in back SNOILVYAdO Model W1829 Mfg Since 9 11 Stock Inspection amp Requirements Here are some rules to follow when choosing and jointing stock CORRECT FEED DIRECTION ROTATIO e DO NOT joint or surface plane stock that contains OUTFEED TABLE Va NS EPIS loose knots Injury to the operator or damage to the A With Grain workpiece can occur if the knots become dislodged during the cutting operation ss INCORRECT FEED DIRECTION DO NOT joint or surface plane against the
51. s Note The fence will stop when the outward stop bolt hits the fence bracket Use a square to check the angle of the fence as shown in Figure 47 If the fence is tilting away from the table at 45 the outward stop is set correctly Put the limit block back bring the fence to 90 and tighten the tilting handle If the fence is not tilting away from the table at 45 perform Steps 5 6 to set the outward stop correctly With the outward stop bolt resting against the fence bracket use an 8mm wrench to adjust the length of the stop until the fence is at 45 then tighten the jam nut see Figure 48 Put the limit block back bring the fence to 90 and tighten the fence tilting handle 35 8 F gt Figure 47 Checking the outward 45 stop Figure 48 Outward stop bolt detail m Model W1829 Mfg Since 9 11 V Belt Replacement The Model W1829 uses two belts to drive the cutterhead and the dust collection impeller When these belts are not tensioned correctly misaligned or damaged your jointer will not function properly The part number for the replacement drive belt is X1829070 the part number for the replacement fan belt is X1829092 Refer to the parts diagram in this manual when fixing belt problems If you need further assistance call our Tech Support at 360 734 3482 or send e mail to tech
52. stable Safety Glasses Exceeding ANSI Z87 1 1989 standards for impact resistance these Safety Glasses offer outstanding eye protection Wrap around side shields provide additional protection and a wide field of view Model D2676 features easily adjustable ear pieces D2759 Safety Filter Mask This Safety Filter Mask provides greater protection over paper filters with its form fitting cloth seal Level 2 filtra tion provides 98 6 filtration Ideal for the dusty shop and work environments One size fits all W1041 3 x 21 2 Adapters W1044 4 x 2 2 Adapters These adapters will allow you to connect 21 2 dust chute of the W1829 to an existing dust collection system with standard 3 or 4 fittings W1044 N 2 ja o 26 Model W1829 Mfg Since 9 11 MAINTENANCE General Regular periodic maintenance on your machine will ensure its optimum performance Make a habit of inspecting your machine each time you use it Check for the following conditions and repair or replace when necessary Loose mounting bolts Worn switch Worn or damaged cords and plugs Damaged V belt Any other condition that could hamper the safe operation of this machine Cleaning Frequently blow off sawdust and chips with compressed air This is especially important for the internal working parts and motor Dust
53. t requires bearing replacement Use sharp knives reduce feed rate depth of cut 7 Clean off motor let cool and reduce workload Test repair replace Model W1829 Mfg Since 9 11 Motor amp Electrical continued PROBLEM POSSIBLE CAUSE CORRECTIVE ACTION Machine has vibration or 1 Motor or component is loose 1 Inspect replace stripped or damaged bolts nuts noisy operation and re tighten with thread locking fluid 2 Knife blades clamp or jack screws 2 Resharpen replace knives as required set knife are at fault alignment correctly 3 Belts worn or loose 3 Inspect replace belts with a new ones 4 Motor fan is rubbing on fan cover 4 Replace dented fan cover replace loose damaged fan 5 Loose mounting bolts 5 Replace tighten as required 6 Blade is at fault 6 Replace warped bent or twisted blade resharpen dull blade Operation PROBLEM POSSIBLE CAUSE CORRECTIVE ACTION Excessive snipe gouge 1 Knives set too high 1 Set the knives just even with the outfeed table when the end of the board that they re at TDC top dead center ae with the rest of 2 Operator pushing down on trailing 2 Reduce eliminate downward pressure on that end of end of the workpiece workpiece Workpiece stops in the Knives set too low Set the knives just even with the outfeed table when middle of the cut they re at TDC top dead center Chipping Knots or conflicting grain direction 1 Inspect wo
54. t whether the tool is properly grounded If you ever notice that a cord or plug is damaged or worn disconnect it from power and immediately replace it with a new one For 110V Connection A NEMA 5 15 plug has a grounding prong that must be attached to the equipment grounding wire inside the included power cord The plug must only be inserted into a matching receptacle see Figure 3 that is properly installed and grounded in accordance with all local codes and ordinances Extension Cords We do not recommend using an extension cord with this machine Extension cords cause voltage drop which may damage electrical components and shorten motor life Voltage drop increases with longer extension cords and the gauge smaller gauge sizes higher gauge numbers indicate smaller sizes Any extension cord used with this machine must contain a ground wire match the required plug and receptacle and meet the following requirements Minimum Gauge Size at 110V 14 AWG Maximum Length Shorter is Better 50 ft 10 GROUNDED 110V 5 15 RECEPTACLE Grounding Prong 5 15 PLUG Neutral Hot Figure 3 NEMA 5 15 plug amp receptacle A CAUTION CK E DO NOT modify the provided plug or use an adapter if the plug will not fit your receptacle Instead have a qualified electrician install the proper receptacle on a power supply circuit that meets the requirements
55. tes an imminently hazardous situation which if not avoided ADANG ER WILL result in death or serious injury Indicates a potentially hazardous situation which if not avoided AWARNING COULD result in death or serious injury A CAUTION Indicates a potentially hazardous situation which if not avoided MAY result in minor or moderate injury This symbol is used to alert the user to useful information about NOTICE proper operation of the equipment and or a situation that may cause damage to the machinery Standard Machinery Safety Instructions OWNER S MANUAL Read and understand this owner s manual BEFORE using machine Untrained users can be seriously hurt EYE PROTECTION Always wear ANSI approved safety glasses or a face shield when operating or observing machinery to reduce the risk of eye injury or blindness from flying particles Everyday eyeglasses are not approved safety glasses HAZARDOUS DUST Dust created while using machinery may cause cancer birth defects or long term respiratory damage Be aware of dust hazards associated with workpiece materials and always wear a NIOSH approved respirator to reduce your risk WEARING PROPER APPAREL Do not wear clothing apparel or jewelry that can become entangled in moving parts Always tie back or cover long hair Wear non slip footwear to avoid accidental slips which could cause a loss of workpiece control HEARING PROTECTION Always wear hearing protectio
56. tivities contains chemicals known to the State of California to cause cancer birth defects or other reproductive harm Some examples of these chemicals are e Lead from lead based paints e Crystalline silica from bricks cement and other masonry products e Arsenic and chromium from chemically treated lumber Your risk from these exposures varies depending on how often you do this type of work To reduce your exposure to these chemicals Work in a well ventilated area and work with approved safety equip ment such as those dust masks that are specially designed to filter out microscopic particles USE THE QUICK GUIDE PAGE LABELS TO SEARCH OUT INFORMATION FAST D Contents INTRODUCTION ERE ERO RR EE NE san 2 ACCESSORIES u eee eee ER conis ERES VE Ee EVE Woodstock Technical Support 2 About Your Machine 2 Machine Specifications 4 General Controle amp Features 5 CIBBHIIIB ados Ue os Table Base ses er o d Rx a SAFETY 5 NUMAE 6 WEDGES cetur esas apes bans edd sau RE EYE Standard Machinery Safety Instructions 6 Lubrication sisse ced ari Rl ea XR WEE trm ELECTRICAL u u u e ere eer rrr rn nnn nnn 9 iii ever Circuit Requirements 9
57. uyay eset Sere 3 41 FENCE Height 4 5 16 in Fence STOPS kawa 45 amp 90 deg Cutterhead Information ca aayqa rre e Ke evens dune PARE Opa s DES ee pua E RET ees 2 Knife Cutterhead Diameter reor rrr eere eh n E a eee sob 1 7 8 in Cutterhead Speed rete luasnya ra ent Rei ea ur a ner PCs 10 000 RPM Knife Information Number Of iue seats pereo site era eniro hse ts 2 E Straight Aether 6 1 2 in WAGES iss 7 8 in Knife Thickness US 3 32 in Knife Adj stmenti uya Jack Screw FIN Model W1829 Mfg Since 9 11 Table Information Z e lt Table Lengti u aaa ERA 28 1 2 in Table E T Sau 6 1 4 in Table ThICR0ess crie eese erre conde 1 4 in Floor to Table Height uuu eese reete ee E LAE aee e Uc 73 1 4 in Table Adjustment Type u y pires te Vae e ne Viele Dv Reg baden ele Knob Table Movement EN E a CEN o sete Swing Construction GDIcaeP
Download Pdf Manuals
Related Search