Home

HP 5992-3193 User's Manual

Contents

1. Manufacturing Part Supported OS Supported Versions Edition Publication Date Number Number 5992 3193 RHEL RHEL4U4 and later RHELS5 2 6 September 2009 SLES RHEL5U1 RHEL5U2 and RHEL5U3 SLES10 SLES10SP1 SLES10SP2 and SLES11 5992 3193 RHEL RHEL4U4 and later RHEL5 2 5 May 2009 SLES RHEL5U1 RHEL5U2 and RHEL5U3 SLES10 SLES10SP1 SLES10SP2 and SLES11 5992 3193 RHEL RHEL4U4 and later RHEL5 2 4 September 2008 SLES RHEL5U1 and RHEL5U2 SLES9SP3 SLES9SP4 SLES10 SLES10SP1 and SLES10SP2 Related Information The HP Insight Foundation Suite for Integrity with Linux website http www hp com go integritylinuxessentials The Intel EFI website http developer intel com technology efi The HP WBEM Providers for Linux product website http www hp com go wbemlinux The HP Systems Insight Manager website http www hp com go hpsim The Distributed Management Task Force DMTF website that contains details on the WBEM protocol http www dmtf org standards wbem The Open Group s OpenPegasus website http www openpegasus or The HP Business Support Center website that contains HP Integrity server technical support information http www hp com su ort itaniumservers Manufacturing Part Supported OS Supported Versions Edition Publication Date Number Number 5992 3193 RHEL RHEL4U4 and later and RHELS5 2 3 April 2008
2. 2 Preparing for Installation Preparing your server for an OS installation involves setting up a console VGA serial or both and preparing the hardware for installation If you are migrating from another OS you must also ensure that the server platform and its peripheral devices are compatible with Linux before proceeding This chapter provides detailed instructions for each task Obtaining the Latest HP Insight Foundation Suite for Integrity with Linux HP recommends that you frequently update your copy of the HP Insight Foundation Suite for Integrity with Linux to ensure that your servers are being managed with the most current support tools You can obtain the latest version of the HP Insight Foundation Suite for Integrity with Linux by component format using the following procedure 1 A 4 Ensure that your system has an application that can burn a bootable CD or DVD installed for example Nero or Roxio Go to the HP Insight Foundation Suite for Integrity with Linux Smart Setup download page at http h20293 www2 hp com portal swdepot displayProductInfo do productNumber T2387AA Select the HP Smart Setup ISO file from the Software Specification list complete the online form and then click Next to complete the download The HP Smart Setup ISO file contains the entire HP Insight Foundation Suite for Integrity with Linux product including the HP Support Pack NOTE The HP Insight Foundation Suite for Integrity with
3. All of the available driver and software updates are provided in a categorized listing for your selection 6 Click Download for each driver or software product you want to update and then follow the installation instructions provided Additional information specific to the selected server is also available at this website and includes troubleshooting how to perform regular maintenance how to upgrade or migrate the server and associated documentation Registering for HP Support Notifications HP recommends that you register for alerts and notifications to stay informed of updates to the drivers patches and other components specific to your server To register go to the Subscriber s Choice website and follow the instructions provided http www hp com united states subscribe gatewa Updating the Server 31 Installing the Fibre Channel HBA Drivers for Linux 32 A If your system contains Fibre Channel Host Bus Adapters HBAs you should ensure that the most current drivers supported by HP are installed this is applicable to all releases of Linux distributions Fibre Channel HBAs include the following A6826A PCI X 2 port 2Gbps Fibre Channel A7538A PCI X 1 port 2Gbps Fibre Channel AB379A 2 port 4Gbps Fibre Channel AB429A 1 port 4Gbps Fibre Channel AD167A 1 port 4Gbps Fibre Channel AD168A 2 port 4Gbps Fibre Channel AE311A 1 port 4Gbps Fibre Channel AD300A 2 port 4Gbps Fibre Channel A8002A 1 port 4Gbps Fibre Channe
4. Ata Primary Master CDROM Entry1 b1k0o Acpi PNPOA03 1 Pci 1 0 Scsi Pun0 Lun0 b1k1 Acpi PNPOA03 0 Pci 2 0 Ata Primary Master b1k2 Acpi PNPOAO03 0 Pci 2 0 Ata Primary Master CDROM Entryl TIP The map command displays or defines a mapping between a user defined name and a device handle The most common use of this command is to assign drive letters to device handles that support a file system protocol After these mappings are created the drive letters can be used with all the file manipulation commands It can also be used to create new mappings and delete existing mappings using the d option If the map command is used without any options all the current mappings are listed If the v option is used the mappings are shown with additional information on each mapped handle Record the device name of the CD DVD device s0 in this example Use this device name to explore the contents of the removable media Go to the CD DVD file system fsnumber Preparing for Installation Change directories to EFI boot and then enter the following bootia64 efi The Smart Setup EBSU entry is created in the EFI Boot Manager as a selection for booting to launch the HP Smart Setup EBSU utility Enabling a USB Device To access a USB HDD device you must enable the EFI shell to detect and then access it using the following steps 7 IMPORTANT The USB HDD device must be formatted with a FAT32 file system 1
5. Exit for SLES11 Install HP System Management Homepage Install HP s Server Manageability eXtensions SMX Install Server Manageability eXtensions Webapp via HP SMH Install HP Command Line Array Configuration Utility Install MPT Fusion SAS Integrated RAID configuration utility Install The Open64 Compiler Suite v4 2 1 SMX with everything else available remove IMA WBEM if found Uninstall HIFIL and return to this menu 9 Exit ji PRRPROWATNAUNFWND E wnero w Ne o N AUH Menu for all other Linux Distributions 1 Install HP Insight Manager Agents for HP Integrity servers Install HP System Management Homepage Instal oN An PWD 1 1 HP Insight Management Agents Webapp via HP SMH Install nPartition Commands Install The nPartition Management GUI for HP Integrity servers Install HP Server Manageability eXtensions SMX Install Server Manageability eXtensions Webapp via HP SMH Install HP Command Line Array Configuration Utility 9 Install HP Utilization WBEM Provider 10 Install MPT Fusion SAS Integrated RAID configuration utility 11 Install HPVM Guest Kit for Linux 12 Install The Open64 Compiler Suite v4 2 1 13 WBEM providers with everything else remove SNMP agents if found 14 Install SNMP agents and everything else remove WBEM providers if found 15 Uninstall HIFIL and return to this menu 16 Exit The installation options are categorized as follows Install individual products Individu
6. SLES and RHEL5U1 SLES9SP3 and SLES10 and SLES10SP1 5992 3193 RHEL RHEL4U4 and later and RHELS 2 2 December 2007 SLES and RHEL5U1 SLES9SP3 and SLES10 and SLES10SP1 5991 7635 RHEL RHEL4U4 and later and RHELS 2 1 August 2007 SLES SLES8 HP Smart Setup only SLES9SP3 and SLES10 5991 7635 RHEL RHEL3U8 RHEL4U4 and later 2 0 March 2007 SLES and RHEL5 SLES8 HP Smart Setup only SLES9SP3 and SLES10 5991 6413 RHEL RHEL3U8 and RHEL4U4 and 1 2 November 2006 SLES later SLES8 HP Smart Setup only SLES9SP3 and SLES10 5991 6413 RHEL RHEL3U8 and RHEL4U4 and 1 1 September 2006 SLES later SLES8 HP Smart Setup only and SLES9SP3 5991 5295 RHEL RHEL4U3 1 01 July 2006 5991 5295 RHEL RHEL3U7 and RHEL4U3 1 April 2006 SLES SLES8 HP Smart Setup only and SLES9SP3 Related Information 10 For additional information on HP products and services see the HP website http www hp com For the location of the nearest sales office call In the United States 1 800 637 7740 In Canada 1 905 206 4725 In Japan 81 3 3331 6111 In Latin America 1 305 267 4220 In Australia New Zealand 61 3 9272 2895 In Asia Pacific 8522 599 7777 In Europe Africa Middle East 41 22 780 81 11 For product information contact any of the HP worldwide sales offices or HP Channel Partners in the United States call 1 800 637 7740 HP Encourages Your Comments HP encourages your comments concerning this document We are committed to pro
7. you must re enable SELinux Otherwise bypass this step echo 1 gt selinux enforce Installing Software from the HP Support Pack The software included in the HP Support Pack is installed by running the interactive installer install sh This installer provides options for installing one or more of the products described in Software Provided in the HP Support Pack page 39 Before Running the Installer Before running the installer perform the following steps 1 Review the Product Installation Dependencies page 42 section and ensure that you prepare your system accordingly 2 Ensure that you have the latest version of the product as described in Obtaining the Latest HP Insight Foundation Suite for Integrity with Linux page 17 3 Log in to the system as root 4 Mount the media containing the HP Support Pack or identify the directory into which the tar file was unpacked 44 Installing and Using the HP Support Pack Running the Installer You can run the installer anytime after the OS has been installed however HP recommends that you run the installer immediately after the initial installation of the OS To install software from the HP Support Pack perform the following steps 1 A A Start the installer install sh s NOTE The optional command option s can be used to execute the installation silently The following message is displayed Welcome to the HP Intergrity Es
8. Adapters Option Configure Storage Adapters HP SmartfArray CRAID gt NOTE Prior to launching the Smart Setup wizard you must use the Configure Storage Adapters option to ensure that Linux is installed with the desired storage configuration Only storage that is going to be used as a boot device must be configured at this time Other non boot storage can be configured using the HP Smart Setup EBSU utility or after OS installation Select the appropriate storage adapter and press Enter A list is provided with device IDs that are applicable to your adapter as generated by the EFI command drvcfg as shown in Figure 3 7 Each device represents an adapter or a channel on an adapter Select the appropriate adapter from the list and select Configure Figure 3 7 Configuring Storage Adapters You have selected to configure the LSI Ultra 320 SCSI Storage Adapter on this system You may need to refer to the documentation for the storage adapter If you want to not configure the storage adapter then select Back Otherwise select the adapter to configure lt x 40 19 66 26 i A AcpiCHWPOGG2 166 gt Pci lt i i lt 46 1A 66 26 G1 G1 AcpilHYPOOAZ2 100 gt Pciliii gt gt Back Review the storage adapter documentation and provide any additional information For more information regarding the use of the storage configuration utility see the documentation specific to the storage adapter After the de
9. Installation Using the HP Smart Setup EBSU Utility You can use HP Smart Setup both before and after the OS is installed HP recommends that you obtain the latest version of the HP Insight Foundation Suite for Integrity with Linux For more information about downloading HP Smart Setup see Obtaining the Latest HP Insight Foundation Suite for Integrity with Linux page 17 Before Installing the OS Use any bootable removable media containing HP Smart Setup to boot the server With the media in the CD DVD drive or USB HDD the server boots to the HP Smart Setup EBSU utility which provides an interface for offline setup and assists with configuration tasks such as creating hard disk partitions and upgrading the firmware Additionally the HP Smart Setup EBSU utility provides a wizard called Smart Setup The Smart Setup wizard guides you through preparing the system for and installing the OS The HP Smart Setup EBSU utility works in conjunction with the Linux Installer media which contains the OS image It is strongly recommended that you use the HP Smart Setup to install the OS After Installing the OS Use the HP Smart Setup EBSU utility to install the EFI driver and utilities and to upgrade firmware which ensures the stability and performance of the system Installation Process The OS installation process involves preparing the server installing the OS on the server and updating it with the latest firmware drivers utilities se
10. Intel Extensible Firmware Interface EFI specification defines a model for the interface between the OS the firmware and the hardware EFI serves the same purpose on Itanium based computers as the BIOS on x86 based computers EFI provides a standard environment for running pre boot applications and for booting the OS HP Integrity servers use EFI to initialize the platform firmware and load the OS After the system is initialized EFI provides two interfaces with which you can interact as described in the following sections EFI Boot Manager First displayed when you power on the server the EFI Boot Manager provides a menu based interface Figure 4 1 is an example with options for booting the OS loading EFI applications configuring the server and performing other pre boot operations Using the Option ROM Configuration for Arrays Utility 35 Figure 4 1 EFI Boot Manager EFI Boot Manager ver 1 10 14 62 OO eS ee See S EFI Shell I I I I i I I I I I I z Red Hat Enterprise ga AS ore LAN Core LAN Gb B EFI Shell Built in i i i i i i Prine Explorer A i Boot Configuration l i i System Configuration Security Configuration bs Us an latenial Bootable DUD System Overview hp server rx2620 Serial US5S4987219 System Firmware 3 17 4513 BMC Version 3 48 MP Version E 63 15 Ins
11. ORCA To invoke this utility press F8 on the VGA console or Esc 8 on the serial console Accessing the Removable Media Devices Using EFI When hardware for example a hard disk drive a USB Hard Disk Drive HDD device or a CD or DVD drive is added to a system after the system has booted to EFI the EFI shell environment does not automatically detect the new device You must reconnect the device driver for the EFI shell to recognize the device 20 Additionally the EFI shell environment creates default mappings for all the device handles that support a recognized file system After you change the system configuration or add anew device you must regenerate these mappings Enabling a CD DVD Device To access a CD DVD you must enable the EFI shell to detect it and then access it using the following steps 1 From the EFI shell enter the following Shell gt reconnect r The reconnect command reconnects one or more drivers from a device disconnecting all the drivers from all the devices and then reconnecting them If a device handle is not specified the reconnect operation is performed on all the handles in the system If a device handle is specified only the device handle and the devices below it are reconnected Regenerate all mappings Shell gt map r The r option regenerates all the mappings in a system The EFI shell displays a device mapping table similar to the following example fs0 Acpi PNPOAO3 0 Pci 2 0
12. R27 5 JDK Linux Intel Itanium 64 bit file to the directory on the Linux system where HP Partition Manager nPartition Commands and nPartition Provider are to be installed from the BEA JRockit website http download2 bea com pub jrockit 50 jrockit R27 5 0 jdk1 5 0 14 linux ipf bin 3 Set execute permissions on the downloaded file chmod a x jrockit R27 5 0 jdk1 5 0 14 linux ipf bin 4 Run the self extracting binary to extract the RPM file jrockit R27 5 0 jdk1 5 0 14 linux ipf bin A NOTE The initial is required if you do not have a period in your PATH environment variable A binary license agreement is displayed 5 You must agree to the BEA JRockit 5 0 JDK license agreement to proceed with the installation A NOTE The default installation path is root jrockit R27 5 0 jdk1 5 0_14 which can be modified during the installation process A good location to install the JRockit 5 0 JDK is usr local Use this information when setting the JAVA_HOME environment variable in the next step 6 Set the JAVA_HOME environment variable export JAVA _HOME JjavaDir where javaDir is the directory in which the BEA JRockit 5 0 JDK files were installed For example root jrockit R27 5 0 jdk1 5 0 14 A NOTE The JAVA_HOME environment variable must be exported in this fashion prior to and in the same shell session as the use of the HP Support Pack installer 7 If your system is running RHEL5U1
13. The HP Server Manageability eXtensions SMX is a manageability framework for HP Proliant and HP Integrity servers using Web Based Enterprise Management WBEM and the Common Information Model CIM SMX is designed to run on HP servers and provide complete manageability as defined by the Distributed Management Task Force DMTF Storage Networking Industry Association SNIA and the HP WBEM Technical Committee TC HP WBEM Providers for Linux WBEM is a Distributed Management Task Force DMTF standard that uses Internet technologies such as XML HTTP and SSL to manage systems HP WBEM Providers for Linux allows management applications such as HP Systems Insight Management to retrieve monitor and configure system information HP WBEM Providers are the instruments that provide system data for the management application For more information see the HP WBEM Solutions for Linux website http www hp com go wbemlinux HP Partition Manager HP Partition Manager provides you with a convenient GUI to configure and manage nPartitions on HP servers Using HP Partition Manager you can perform complex configuration tasks without having to remember commands and parameters You select nPartitions cells I O chassis or other components from the graphical display and then select an action from a menu HP Partition Manager is installed on your HP Integrity system by default when HP nPartitions commands are installed HP Partition Manager is not insta
14. WBEM providers are installed on SLES 11 It is not installed as a standalone application NOTE The sblim sfcb RPM is not included in the support pack however it is delivered with the SLES11 distribution For more information see the HP SMX WBEM Providers for Linux Installation Guide and Release Notes http docs hp com en For more information about the Small Footprint CIM Broker see the Novell website http www novell com HP Utilization Provider Including WBEM HP Utilization Provider provides a light weight daemon ut ild that records system utilization data on a five minute interval System utilization data includes CPU utilization memory utilization disk utilization and network utilization The HP Utilization Provider includes the WBEM provider which provides access to the utilization data The Virtual Server Environment VSE Management Software relies on the HP Utilization Provider Removing HP Utilization Provider prevents the VSE Management Software from functioning properly Software Provided in the HP Support Pack 41 When HP Utilization Provider is installed it launches the uti1d daemon which consumes minimal CPU memory and disk resources Only 30 days of utilization data are kept in data files in var adm util The total disk space used by these files should not exceed 20MB in the default installation The ut ild process wakes up every five minutes and discovers and records four metrics CPU memor
15. and press Enter 9 Select Exit and press Enter 10 To apply the changes you have selected select Cold Reset from the Boot Option Maintenance menu and press Enter 11 When prompted enter Y and press Enter The firmware and serial console are configured after system reset a Serial Console Although you might have set up a serial console in the EFI boot manager Linux defaults to a VGA console If no VGA device is present console output is directed to a stub device for example not visible To specify a serial console you must pass the console parameter to the kernel This can either be done as an extra parameter to the kernel or by means of the parameter append line in elilo conf For example Manual Boot Option fs0 gt elilo linux console ttySo ELILO boot linux console ttyS0O Automatic via elilo conf append console ttySo Configuring a Serial Console 49 50 we y IMPORTANT Fxactly one UART must be selected in the EFI Console In Out tables for a serial console to work The UART selected in this table is ttySo The format of the console parameter is as follows console ttySn spb n Serial line where s Speed Example 9600 19200 38400 57600 115200 9600 is the default if no speed is specified 115200 is the maximum for HP UART Parity Example n no parity typical case Bit Encoding Example 7 8 8 is the typical case For a 115200 baud console th
16. at the serial console select Boot Option Maintenance Menu Select the option Select Active Console Output Devices Select the line with the appropriate graphics adapter PCI device Oy Oly ye prO If there is no asterisk at the beginning of the line the device is disabled Press Enter to toggle the state of the adapter from disabled to enabled 7 Select Save Settings to NVRAM and then Exit The video display is now directed to the VGA console Preparing the Server Hardware This section describes how to set up the server hardware for OS installation set up the boot drive and set up the CD or DVD drive Setting Up the Boot Drive The OS installs through the boot controller that is detected as adapter zero and then to the drive detected as drive zero VAN CAUTION HP recommends that only the target OS drive be connected during installation This ensures that the OS is installed on the correct drive To set up the boot drive performing the following steps 1 Power down the server Preparing the Server Hardware 19 A Make a list of all device connections so you can reconnect them after the installation is completed Disconnect all mass storage devices from all controllers except the boot controller Configure the boot controller and boot drive NOTE If you are using an HP SmartArray controller see the Controller s User Guide You can interrupt the boot process to invoke the EFI based SmartArray configuration utility
17. for rx2660 rx4640 Embedded I O for rx4640 65 UOMO N A Printed in the US
18. initrd 2 6 18 92 el5xen img done This is the result of the MPT Fusion driver rebuilding the initrd file and modifying elilo conf when the it is installed The following is a comparison of the elilo conf file contents before and after the driver installation Before prompt timeout 20 default linux relocatable image vmlinuz 2 6 18 92 el5xen vmm xen gz 2 6 18 92 e15 label linux initrd initrd 2 6 18 92 el5xen img read only root dev VolGroup00 LogVol100 append rhgb quiet After prompt timeout 20 default HP Corresponds to kernel 2 6 18 92 el5xen previously default linux relocatable image vmlinuz 2 6 18 92 el5xen vmm xen gz 2 6 18 92 e15 label linux initrd initrd 2 6 18 92 el5xen img read only root dev VolGroup00 LogVol100 append rhgb quiet The following entry was added by Proliant HBA install script in package mptlinux 4 00 13 01 3 rhel5 image vmlinuz 2 6 18 92 el5xen label HP Corresponds to kernel 2 6 18 92 e15xen initrd HP initrd 2 6 18 92 el5xen img read only root dev VolGroup00 LogVol100 append rhgb quiet The default variable is changed to HP that corresponds to the Xen kernel and a new image stanza is inserted into the file This new stanza is missing a line which causes the server hang during reboot To avoid the system hangs during reboot you must modify the file etc elilo conf manually after the MPT Fusion driver is installed and before rebooting the server u
19. line 1 Setui timeout to 80 seconds opt hp hpsmh sbin smhconfig ui timeout 80 2 Restart HP SMH etc init d hpsmhd restart From HP SMH 1 Sign in to HP SMH Select Settings SMH Security Timeouts Modify the UI timeout seconds value and then click Apply Sign out of HP SMH Restart HP SMH etc init d hpsmhd restart ae WN HP SAS Integrated Raid IR Configuration Utility May Cause Kernel Panics on RHEL4U7 The Integrated Raid IR Configuration Utility cfggen is a Linux command line utility that configures the IR functionality of the HP Serial Attached SCSI SAS controllers that are used in LSI 1068 based HP SAS controllers The cfggen utility causes kernel panics when creating volumes with RHEL4U7 Until this issue is resolved in the MPT driver HP recommends that you use the EFI executable cfggen efi utility to create volumes If c ggen is installed on a system running RHEL4U7 the HP Support Pack installer will remove it For information about using the cfggen efi utility see the SmartSetup Scripting Toolkit Deployment Guide http www docs hp com en 5991 6250 Flashing HP PCle 2 port 1000Base T adapter AD337A Adapters The HP PCle 2 port 1000Base T adapter AD337A with the 3 0 48 firmware version cannot be flashed using HP Smart Setup 58 Known Issues D Supported Products Matrix This appendix lists the adapters that are supported by the HP Insight Foundation Suite for Integrit
20. the HP Support Pack sss sssssssssssssssseessssessreessreessseesssresssresssrees 39 Software Provided in the HP Support Pack esssssssssesssesssessssseesserssrseesserssissseseensisnreseenseesreseesseessesees 39 HP Management Base for Integrity Servers iiicesssseiccsshedsceansvvascki vs sutes sev eiceacbaceieseiasiaeash tevetvneieceees 39 HP Insight Manse ement ASents c qas2in siihs ovens e nanos EE E 39 RiP System Management Homepage isores erresonante ches tr Eie EEES ora elton eye es aR EREE AE TERR 40 HP Servet Manageability fen Stns xis cise ciate vid coe costae a et A raS Eaei SE EE EE a EAEE TEER 40 HP WBEM Providers fOr LOU enurese ao E a ie T EE A ett NNN 40 HP Patuton Manager lt tisG crisps trn enra E Alaa tn VE AA E helio ER EAE 40 HP n Partition Command Srei a E aa AN E T AAE A A EA 40 HP Array Configuration Utility Command Line Interface ccsscssscesscssssoneensssenssesnssneens 41 OPEN PER ASUS sireni ee eat e e Ee RaT EEE RA ESEE EA a es EA EESE r EE RANT A aS 41 Small F otprint CIM Broken isis ereis aaiasais vce EEE ENTENAS vulceas wet EEr EINER EIEEE EVE ERAR ESPERTA a EER Ra 41 HP Utilization Provider Including WBEM ssssssessesssersersessserssrsessserssissreseessiesrereenseeseseesseesresees 41 HP SmarttSetup Scripting Toolkit eresse sin rasscnir skeie cas nneuteesvecepectas ei rer iakeas iais 42 HP SAS Integrated Raid IR Configuration Utility 2 saccsccscescas sets ondeenivesteieeivaevares e
21. 0 e HP Array Configuration Utility Command Line Interface page 41 e OpenPegasus page 41 e HP Utilization Provider Including WBEM page 41 e HP SmartSetup Scripting Toolkit page 42 e HP SAS Integrated Raid IR Configuration Utility page 42 e HP Integrity Virtual Machines WBEM Provider page 42 HP Management Base for Integrity Servers HP Management Base for HP Integrity servers installs an Open IPMI driver appropriate for the target system and several utilities for Baseboard Management Controller BMC management These items are needed by other management products such as HP Insight Management Agents and HP WBEM Providers For information about HP Management Base see hpbmc 8 hpuid 8 hpseld 8 openipmi 4 and the HP Management Base Installation and User s Guide http www docs hp com en 5991 7630 HP Insight Management Agents Based on the Simple Network Management Protocol SNMP HP Insight Management Agents HPIMA allow you to remotely monitor configuration information and system status on your HP Integrity server from any SNMP browser A central management server that uses HP Insight Manager or HP Systems Insight Manager gathers and organizes the raw agent information from the browser for display in reports allowing you to monitor system use and troubleshoot problems HP Insight Management Agents provide a broad spectrum of SNMP agents for the collection of server manageme
22. 10 From any Linux system go to the http www hp com go integritylinuxessentials website and click on the Download for HP Insight Foundation Suite for Integrity with Linux link Click the link for the HP Smart Setup tar file to download the file to a local folder Connect the USB HDD device and then mount it if the OS does not do so automatically Extract the contents of the HP Smart Setup tar file to the USB HDD device making sure that the EFI folder structure is in the root directory tar zxvf ebsu version tgz C mnt usb Unmount the USB device umount mnt usb CAUTION Failure to unmount the USB device will result in data loss Connect the USB device to the intended server From the EFI shell enter the following Shell gt reconnect r The reconnect command reconnects one or more drivers from a device disconnecting all the drivers from all the devices and then reconnecting them If a device handle is not specified the reconnect operation is performed on all the handles in the system If a device handle is specified only the device handle and the devices below it are reconnected Regenerate all mappings Shell gt map r The r option regenerates all the mappings in a system The EFI shell displays a device mapping table TIP The map command displays or defines a mapping between a user defined name and a device handle The most common use of this command is to assign drive letters to device handles that supp
23. 20 From the EFI Boot Menu select Smart Setup EBSU or Smart Setup from EBSU as appropriate and then press Enter NOTE The entry Smart Setup EBSU or Smart Setup from EBSU are not displayed in all EFI Boot Managers If this entry does not appear perform the steps detailed in Accessing the Removable Media Devices Using EFI page 20 The HP Smart Setup EBSU utility executes and the introduction screen is displayed Click OK and press Enter to continue 36 EFI and HP Smart Setup Media Utilities we The HP Smart Setup EBSU utility provides the following capabilities e Configure Storage Adapters Configures bootable I O adapters A submenu provides a list of storage adapters from which to choose e Smart Setup Provides a wizard that guides you through the following set of preselected Linux installation setup tasks Updating firmware Creating disk partitions Installing offline diagnostic tools Installing Linux e Maintain Firmware Upgrades the firmware for all the selected devices that can be upgraded You can upgrade all the devices at once or select one or more individually A NOTE You may not be able to use the Smart Setup function to upgrade the firmware of some devices This function does not allow you to upgrade the firmware if the installed version is the same or higher than the version of the HP Smart Setup utility However you can make a firmware downgrade by selecting the Maintain Fi
24. 29 HP Smart Array P400 Controller more adapters If the server is cell based the firmware update screen is slightly different as shown in Figure 3 10 Using HP Smart Setup to Install the OS 27 28 12 A Figure 3 10 Fage 1 Update Firmware Cell Based Servers Page 1 of 3 1 What firmware do you want to update Select the firmware devices you want to update Devices prefixed by cannot be updated in this program Press the SPACE bar to display the location of the Release Notes document for the selected firmware The System Firmware Device Version represents the lowest version among all system cells Select all Deselect all System Firmware 7 043 9 022 Management Processor B 000 018 1i B 003 091 882 HP Smart Array eapernen Controller 30 2 76 HP Smart Array P600 Ccnteel tan more adapters Cancel Back Next For either server type all hardware devices present are listed and automatically selected if updating is necessary If multiples of one type of PCI adapter exist only those adapters that are in need of updating are actually upgraded provided that the adapter flasher enables the selection of adapters to flash Select the devices with firmware that you want to update To continue select Next and press Enter to display the next screen as in Figure 3 11 NOTE You may not be able to use the Smart Setup function to upgrade the firmware of some devices This function does not allow y
25. A6865A PCI core I O for X X SuperDome A7061A Win Linux 1000Base T Gigabit Eth Adpt A7073A Win Linux 1000Base SX Gigabit Eth Adpt A9899A Win Linux 2 port X 1000Base SX Giga Adptr A9900A Win Linux 2 port X 1000Base T Giga Adptr AB290A HP PCI X 2p X 1000BT 2p U320 SCSI Adptr AB306A Core IO for the rx86 rp8420 server AB314A HP Integrity X X X X rx8640 Core I O adapter 2p GigE PCI X 2 port X X X X NIC 1000BT w WOL Core I O AD144A Win Linux X X X X 133MHz 10GbE SR Fiber Adapter AD145A Win Linux 4 port X X 1000Base T Gigabit Adapter AD337A HP PCIe 2 port X X X X 1000Base T Adapter AD338A HP PCle 2 port X X X X 1000Base SX Adapter AD385A HP PCI X 266MHz X X X X 10GigE SR Adapter 60 Supported Products Matrix Table D 1 Supported Products Matrix continued Part Description RHEL Support SLES Support Number 4 4U1 BL860c Embedded I O for X X X X BL860c BL870c Embedded I O for X X X X BL870c rx1600 Embedded I O for X rx2600 rx1600 rx2600 rx1620 Embedded I O for X X X rx2620 rx1620 cx2620 rx2620 cx2620 rx2660 Embedded I O for Xx X X X rx2660 MP A6695 SCSI and MP Core 69101 I O A6875A HP Management X X Processor Adapter for ZX6000 A9918A Core I O for the X X rx76xx rp7420 server AB306A Core IO for the X X rx86 rp8420 server AB314A HP Integrity X xX xX X rx8640 Core I O Adapt
26. AD300A Fibre Channel QLogic Corp QLA2432 Fibre Channel Adapter rev 02 A8002A Fibre Channel Emulex Corporation Zephyr LightPulse Fibre Channel Host Adapter rev 01 A8003A Fibre Channel Emulex Corporation Zephyr X LightPulse Fibre Channel Host Adapter rev 02 403619 B21 Fibre Channel QLogic Corp QLA2432 Fibre Channel Adapter rev 02 If any entries are shown that match the model numbers listed update the driver using the following steps 1 Go to http www hp com 2 Click Software amp Drivers 3 Click Download drivers and software and firmware 4 Inthe For Product field enter the model number of your Fibre Channel adapter for example A6826A 5 Press Go 6 Select the appropriate OS from the Product search results list 7 Click the Download button for the latest Linux Driver Kit for Qlogic HBAs and Qlogic based mezzanine HBAs driver to obtain a tar archive of all necessary files EY NOTE All drivers for a given brand of adapter are contained in one driver kit In this case 5 all drivers for Qlogic adapters are contained in this driver kit 8 Unpack the driver files in the kit For example the following command could be used tar zxvf hp qla2x00 date tar gz 9 Change to the directory that was created in the previous step 10 Install the driver INSTALL For additional information see the documentation that is included with the Linux Driver Kit for Qlogic HBAs and Qlogic based mezzanine HBA
27. E ead EEA Do cba seeded NTU EE 52 SSE SMO OAA EAE EED DEEE E AE E OEO EE A O A N 52 SLES Te perrenenarara eara ra a e ea ta e e aa a rae a i e a a 53 E NA SATE REAA E A E AA A yeas 55 HP Insight Management WBEM Providers on Pegasus cimserver Supports Multi Process Mode RMI Vs sas wes E AES EE ETE ET 55 Unalipn d Access Messages 5 s2 sic hintoni a e i E S E E E A 55 Superfluous PAM Authentication Message ssesessessesesserstsetsssstseesessesrensestesensestestssesrensneesessesteses 55 HP Insight Management WBEM Providers Information Reporting s essesssesssesersserrserseesresserssesees 56 Changing IP Address of Network Interface ss cccsoce dassiessedestasyoccoidyctucs toes asue Seetabe rt ngcediniwteestatedestueln 56 Configuring Storage Adapter si ccsemvii ved eara EEE EESE A EET inane eu el nae 56 Partitioning Fibre Channel HBA Adapters tects si nccetas coseetivneachetnbeedgueensteiet Suey trnnensoontoutncenunubsyeinnia 56 Installing the MPT Fusion HBA Driver on RHEL 5U2 and RHEL 5U3 using a Xen Kernel Hangs thie SOrveleis cle ctonsescochssled A cotoast tends seul sutened sabentonssietuadessGetedse enna sat Gouhdsl E ENAT 56 HP System Management Homepage Session Time out Brror avy sceyeviivetocndiessceessvertyeseetvnnelaviderntiastens 58 4 Table of Contents HP SAS Integrated Raid IR Configuration Utility May Cause Kernel Panics on RHEL4U 7 58 Flashing HP PCIe 2 port 1000Base T adapter AD337A Adapters ccocc
28. HP Insight Foundation Suite for Integrity with Linux User s Guide HP Smart Setup HP Support Pack HP Part Number 5992 3193 Published September 2009 Edition 2 6 Copyright 2007 2009 Hewlett Packard Development Company L P Confidential computer software Valid license from HP required for possession use or copying Consistent with FAR 12 211 and 12 212 Commercial Computer Software Computer Software Documentation and Technical Data for Commercial Items are licensed to the U S Government under vendor s standard commercial license The information contained herein is subject to change without notice The only warranties for HP products and services are set forth in the express warranty statements accompanying such products and services Nothing herein should be construed as constituting an additional warranty HP shall not be liable for technical or editorial errors or omissions contained herein Acknowledgments Intel and Itanium are trademarks or registered trademarks of Intel Corporation or its subsidiaries in the United States and other countries RED HAT READY Logo and RED HAT CERTIFIED PARTNER Logo are trademarks of Red Hat Inc Table of Contents About This DOCU Mbit sesvsl siietesesisedscesets ine ransdeaescrsntscantadtstetonscesganebddaietaractuaenetaoinceamtgecess 7 Additional DOctmientatlOnies cs secs ena a ea bet chess web cane beds Lee A eae dead ORN 7 TritenGed Aten Ce ise scenes dee eeeaes a
29. In Out in the EFI boot manager This configuration allows the Linux kernel to interpret the UART as tt yS0 on system boot sending output to the selected display screen Configuring a Serial Console A To configure a serial console perform the following steps NOTE The steps and actual computer output may vary slightly from the following process These differences are based on the version of EFI and version of Management Processor 1 When the system boots select Boot Option Maintenance Menu from the EFI Boot Manager screen and press Enter 2 From the Boot Option Maintenance Menu select Select Active Console Output Devices and press Enter The resulting screen displays a list of UARTs and PCI devices available for console I O fy NOTE Using e UART identifiers of PNP0501 describe modes available for Serial A or Serial 1 built in UART e UART identifiers of HWP0002 describe modes available for the Console UART on the management processor MP 3 Select a UART from the list and press Enter 4 From the same screen select Save Settings to NVRAM and press Enter The system prompts you to save NVRAM if you omit this step 5 Select Exit and press Enter to return to the main menu 6 Select the option Select Active Console Input Devices from the main menu and press Enter 7 From the list provided select the same UART that you chose as your output device and press Enter 8 Select Save Settings to NVRAM
30. Information To prepare for the installation of the HP Insight Foundation Suite for Integrity with Linux verify that the server satisfies the software and hardware requirements described in this section Supported Linux OS Distributions The Linux OS distributions supported by the HP Insight Foundation Suite for Integrity with Linux are as follows e Red Hat Enterprise Linux RHEL RHEL4U4 and later updates RHEL5 and later updates e SUSE Linux Enterprise Server SLES SLES10 and later service packs SLES11 Supported Hardware HP provides support for Linux on HP Integrity servers using only the latest HP Support Pack version that is provided with the HP Insight Foundation Suite for Integrity with Linux This is the latest HP Support Pack for a given Linux distributor without exception HP supports the minimum OS distributions as listed in Table 1 1 including later updates and service packs unless otherwise specified in Support Exceptions page 12 Each HP Support Pack version contains only the currently supported OS distributions and includes any problem resolutions that have been implemented to improve the product HP recommends that you frequently update your copy of the HP Insight Foundation Suite for Integrity with Linux to ensure that your servers are being managed with the most current support tools and that you have the supported version of HP Support Pack You can obtain the latest version of the product as desc
31. Linux media delivered by HP may not contain the latest version of the product Create a bootable disc by writing the HP Smart Setup ISO file and the HP Support Pack files to a CD or DVD using the media burning application sA TIP You can download tar files of the HP Support Pack HP SmartSetup Scripting Toolkit and A HP Management Base products Ensuring Platform Compatibility If you are migrating from another OS to Linux ensure that the hardware is compatible and any data on the server disk is backed up Verifying Hardware Compatibility To verify that your existing hardware is compatible with Linux use the following steps 1 Review the Linux certification and support matrix as described in Ensure Support for Linux on HP Integrity Servers page 12 In the Linux certification and support matrix list select the appropriate Linux distribution tab and then click the link for the server whose compatibility you want to verify Click the Product overview and how to buy link Click the options amp accessories tab to review supported hardware configurations For example the options amp accessories page for the rx8640 server http h71028 www7 hp com enterprise cache 423649 0 0 0 121 htm1 This web page lists the processors memory adapters and controllers that are available for the rx8640 server Obtaining the Latest HP Insight Foundation Suite for Integrity with Linux 17 5 Verify existing device compatibi
32. SD32B and SD64B Single PCI Domain mode is supported for the following systems rx7620 rx8620 and SuperDome SD16A SD32A and SD64A What ACPI configuration mode do you want x Default ACPI Configuration Mode Single PCI Domain ACPI Configuration Mode Cancel b Select the proper setting for your server using the information provided c Select Next and then press Enter to continue d Press Enter to accept the default selection OK The system is rebooted You are returned to the HP Smart Setup EBSU utility introduction screen to continue with your Linux installation using the new ACPI configuration Or MPS Setting The following screen is displayed figure the MPS Setting tup EBSU Fi omart gt gure 3 5 Con System Sett ing The current MPS setting is determined from the system If it is set to ON no further action is required and a confirmation is displayed Otherwise you are prompted to set the MPS variable to ON and reboot the system If this variable cannot be detected set or is unsupported on the system an error is displayed Using HP Smart Setup to Install the OS 25 26 A 5 E NOTE This setting cannot be changed for the rx2660 rx3600 and rx6600 PCI X servers therefore this menu option is not available Select Configure Storage Adapters and press Enter A submenu displays the list of adapters on the system as shown in Figure 3 6 Figure 3 6 Configure Storage
33. The name of a keyboard key Return and Enter both refer to the same key Term The defined use of an important word or phrase UseriInput Commands and other text that you type Variable The name of a placeholder in a command function or other syntax display that you replace with an actual value The contents are optional in formats and command descriptions If the contents are a list separated by you must choose one of the items The contents are required in formats and command descriptions If the contents are a list separated by you must choose one of the items The preceding element can be repeated an arbitrary number of times Separates items in a list of choices Publishing History The document publishing date and part number indicate the current edition of the document The publishing date changes when a new edition is released Minor changes might be made at reprint without changing the publishing date The document part number changes when extensive changes are made Document updates might be issued between editions to correct errors or document product changes To ensure that you receive the updated or new editions subscribe to the appropriate product support service See your HP sales representative for details For the latest version of this document online see HP Insight Foundation Suite for Integrity with Linux User s Guide http h20000 www2 hp com bc docs support SupportManual c01861377 c01861377 pdf
34. ah ees eb a A seaasssavcee A EATER 7 Typographie Conventions es eaea eE EE EAE dea can semi EREA tae teawanadetomensea nt iand nGieteaueaiariae 7 Puplishine FStOry eenen eda conta ea aaee aeee es eitacn ta ent E teed Aoa REE a nese Sandie e ARAE E CEE AAEE 8 Related iorn ao enaa a e A ele 0 ik Sah ETET EE wt E EN hee ates 9 FIP Encourages Your Comment swiscisienciestteceres vie antessbenieRiwhecvevatvennn aae i ae a e a a E e aaea 10 TiPla ning the Installatior sss sssrini erar ren e r EEE ete treet 11 DAAA ANES A E TOT TE E EAE EAA A E A E eeu ene th 11 S pport IMfOrMaAtON siei ieie ierde eE puede Ee EEA EE EEE AEE NEES ET E EE E RTTE a 11 Supported LinuxOS DistributigNS sessionen estia e etina ane das EA asa aa ati areia Eta 11 SUP POMS HardWatesieseriiisisiinr niieoe a ENE eE EEEE EN deni ating ESE Een nba ave ii 11 SUPPORt ED L10100 p eE E E A E eed 12 Ensure Support for Linux on HP Integrity Servers s essesssssessrssrsseersersresressersrisresserssesneeseessees 12 Choosing an Installation Scenario ssesssssessseesessesssersstseessersstssesseessessteseenseenresresseissesresserssisnesseessees 13 Choosing an Installation Biv yir Omianenits2iisi cok iaiye cid natincautvosnenede venascaveaneonhe cou saeubeasueeancutawtapcatuat ee glieeys 13 Wsing a Seral Console esirinnas 14 Using a VGA CONSOle e eshonni iena i EEE SEEE E EA EA EE ET RERIN 14 Using the HP Smart Setup EBSU ity xi sastentas tigre etinmecsleas duet a nevslas thpetne tv
35. al products can be installed one at a time and the process is repeated for each product you want to install Install everything RHEL4 SMX and everything or IMA and everything With all Linux distributions it is possible to install all of the products in the HP Support Pack at one time However with all distributions except RHEL4 there is a choice of which WBEM provider to install with the HP Support Pack products HP SMX or HP WBEM If you choose to install the HP SMX web based providers HP IMA is removed first to avoid conflicts Conversely if HP WBEM SNMP based providers are chosen for installation then HP SMX is removed first to avoid conflicts Update all products To update all the software products in the HP Support Pack that can coexist in a single step enter the appropriate option number and press Enter The installer automatically exits after all products are updated or installed 46 Installing and Using the HP Support Pack A 4 A Uninstall HIFIL This option is displayed only when HP Management Base is installed on the system To remove the HIFIL product including HP Management Base enter the appropriate option number and press Enter The installer returns to the menu after the entire HIFIL product is removed Enter an option from the menu and press Enter NOTE If HP Management Base is installed and you select it for installation the installer will ask if you want to upgrade or uninstall it Choosing to up
36. ation see the documentation that is included with the MPT Fusion driver update 34 Installing the OS and Updating the Server 4 EFI and HP Smart Setup Media Utilities This chapter describes functions available through the HP Smart Setup EBSU utility and provides an easy to use interface to upgrade the firmware partition the hard disk install diagnostic tools configure storage controllers and run other EFI utilities Using the Option ROM Configuration for Arrays Utility Option ROM Configuration for Arrays ORCA is an EFT utility that enables you to configure a RAID array without booting Linux Using ORCA you can create view or delete a logical drive For detailed instructions on using ORCA see any of the following documents HP SmartArray 5300 Controller User s Guide HP SmartArray 6402 Controller User s Guide HP SmartArray P600 Controller User s Guide and HP SmartArray P800 Controller User s Guide To access ORCA 1 Log on to the MP management processor using telnet or Hyperterminal 2 Enter the console command CO to access the SAC gt prompt 3 At the SAC gt prompt enter restart to reboot the system 4 During the system reboot after the SmartArray adapter is detected you are prompted to press F8 at the MP prompt or Esc 8 if you are using a serial console to enter the ORCA utility The Main menu is displayed 5 Choose one of the options presented Create View or Delete a Logical Drive Using EFI The
37. cation information is provided in a categorized listing Choosing an Installation Scenario When you purchase an HP Integrity server you can order additional hardware support options and an OS Enablement Kit such as the HP Insight Foundation Suite for Integrity with Linux You can also order a factory installation of the OS Depending on your order and subsequent use one of the following scenarios will apply to your system Factory Installed Linux To get the system up and running verify that the OS is installed correctly Perform an update of the latest Linux patches and fixes from the website of the installed Linux distribution Install additional tools and utilities using the HP Support Pack No OS Installed Use HP Smart Setup to prepare the server hardware for installation and use the Linux Installer media to load the OS files on the server or you can execute a cold installation After installation verify that the OS is installed correctly Perform an update of the latest Linux patches and fixes from the website of the installed Linux distribution Install additional tools and utilities using the HP Support Pack Factory Installed OS Other than Linux If you run an alternate factory installed OS you can perform the migration on an entry level server or engage an HP Customer Engineer CE to perform the migration on a mid range or high end server Contact HP Support or sales to engage an HP CE When migrating to Linux from anothe
38. ct versions of the product HP Smart Setup EBSU utility and the rx2600 HP Integrity server The HP rx2600 server is not supported by the HP Smart Setup EBSU utility after the version 4 2 so you must retain a copy of this version for use in managing this server MPT Fusion HBA driver requirements on the rx2660 BL860c and BL870c HP Integrity servers The use of the MPT Fusion HBA driver on the rx2660 BL860c and BL870c HP Integrity servers requires an update of this driver when your server is running RHEL5 or SLES10 and is described in Installing the MPT Fusion HBA Drivers for Linux page 33 Support for Linux on HP Integrity Servers HP recommends that you review the Linux certification and support matrix for your HP Integrity servers prior to downloading Linux from the Red Hat or Novell SUSE websites You should ensure that the distribution of Linux that you want to install is both certified and supported on your server Use the following steps to review information about the supported and certified distributions of the RHEL and the SUSE Linux distributions for HP Integrity servers 1 Go to the Open Source and Linux from HP website at http www hp com go integritylinux 12 Planning the Installation Click Linux certification and support matrices Select the appropriate Linux distribution tab locate the server name of interest and then click the link Detailed product information downloads documentation and specific certifi
39. curity fixes and OS fixes Figure 1 3 shows the main tasks involved in each stage Installation Process 15 Figure 1 3 Installation Overview Install Linux on an HP Integrity server PREPARE INSTALL UPDATE Run Smart Setup Download and install OS Smart Setup appropriate Linux distribution Update firmware Ensure platform compatibility Download and Install the latest Create disk partitions security fixes and u to drivers and documentation at Install diagnostic tools the HP Integrity servers Technical support website Back up data http www hp com support itaniumservers Run Linux Installer Download the latest version of Subscribe to update the HP Integrity Essentials notifications at the HP Integrity Foundation Pack for Linux support website Format system partition Express Custom Prepare hardware Copy matmior fos Install the HP Support Pack For HP Integrity rx7620 and utilites rx8620 and Superdome servers you must update the system firmware and install the latest utilities available at the HP Integrity servers Technical support website http vaww hp com support itaniumservers Set up boot drive Set up CD DVD USB drive There are minor differences in the sequence of tasks or the interface you use to perform them based on your choice of console and installation media Use the detailed instructions in the following chapters and note any warnings or cautions that might apply 16 Planning the Installation
40. dc hp com parmgr 2 02 04 xxx rhel5 ia6 4 rpm need below packages None hp smx 02 05 xxx rhel5 ia64 rpm need below packages glibc libgcc libstdc hp utilprovider 01 07 xxx rhel5 ia6 4 rpm need below packages glibc libgcc libstdc mptsas_cfggen 2 0 30 xxx ia64 rpm need below packages None open64 4 2 1 xxx ia64 rpm need below packages gcc glibc info perl tog pegasus 2 7 1 xxxhp rhel5 ia64 rpm need below packages bash bind utils chkconfig coreutils e2fsprogs glibc grep libgcc libstdc net snmp net tools openssl pam procps redhat lsb sed SysVinit SLES 10 The following list provides information about software contained in SLES10 and the related dependencies hpacucli 8 28 xxx ia64 rpm need below packages glibc prcetl libunwind hpima 3 12 xxx slesl10 ia64 rpm need below packages compat e2fsprogs glibc openssl libgcc libstdc net snmp popt rpm sensors sles release tcpd hpima webapp 4 5 xxx sles10 ia64 rpm need below packages net snmp hpmgmtbase 2 11 xxx slesl10 ia64 rpm need below packages binutils glibc sles release hpsmh 3 0 0 xxx ia6 4 rpm need below packages None hpsmh tomcat 1 3 xxx linux ia64 rpm need below packages None hpsmx webapp 0 2 xxx noarch rpm need below packages libxml2 python python python devel python xml hpvm 4 1 0 xxx slesl10 ia64 rpm need below packages glibc hpvmprovider 4 1 0 xxx sles10 ia64 rpm need below packages glibc libgcc libstdc libunwind hp com npartiti
41. ditional Documentation The HP Smart Setup and Support Pack software packages each contain a set of software documentation The documentation is located in the docs directory Within the docs directory you can access the index html web page or the README txt file both of which list the documentation found in the respective software packages Linux OS distributions provide documentation with their respective products The documentation for your specific Linux OS is included with your system For additional information about your Linux OS and its associated documentation read the support notes document that HP provides with your OS distribution Intended Audience This document is intended for system administrators responsible for installing configuring and managing Linux Administrators must have knowledge of OS concepts commands and configuration It is also helpful to have knowledge of Extensible Firmware Interface EFI concepts Typographic Conventions This document uses the following typographical conventions Command A command name or qualified command phrase ComputerOut Text displayed by the computer Ctrl x A key sequence A sequence such as Ctrl x indicates that you must hold down the key labeled Ctrl while you press another key or button ENVIRONVAR The name of an environment variable for example PATH Additional Documentation 7 ERRORNAME The name of an error usually returned in the errno variable Key
42. e partitioning the hard disk and installing diagnostic tools Installation requires a serial or VGA console and involves the following steps e booting from a bootable removable media containing HP Smart Setup e running the HP Smart Setup EBSU utility e launching the Linux installer e loading OS files to the boot disk e and booting the server from the boot disk You must be connected either to the serial or VGA console of the MP on the target server using a terminal emulation application such as SSH client PuTTY minicom or the cu command If the MP is not available on the network you must be physically connected using a serial or VGA cable IMPORTANT When using QLogic Fibre Channel adapters while using the configuring partitions creating partitions or HP Smart Setup EBSU utilities if an older version of the EFI aux driver is installed it is possible that storage devices attached to this adapter may not be detected If this situation occurs a prompt is displayed and you must update the firmware of the QLogic Fibre Channel adapters before reattempting the utility To install Linux perform the following steps 1 Ensure that the removable media is accessible and contains the HP Smart Setup EBSU utility For details see Accessing the Removable Media Devices Using EFI page 20 2 From the EFI Boot Menu select Smart Setup EBSU as appropriate and then press Enter Figure 3 1 shows the EFI Boot Manager menu tha
43. e following syntax is used console ttyS0 115200n8 NOTE If you are using a Linux distribution that uses kernel revision 2 6 10 or later Post RHEL4 this method of specifying a console will not work For more information on serial ports with these kernels see the Linux Cross Reference website http Ixr linux no source Documentation ia64 serial txt Configuring and Using a Serial Console B HP Support Pack Dependencies Some software products contained in the HP Support Pack have dependencies or prerequisites that may or may not already be available on your system If there are dependencies that are not delivered with the installer or with the Linux OS installation an error message displays with information on the missing software packages or files and the installation process is aborted You must then obtain and install the required packages or files from the Linux distribution media before running the installer again The following sections provide information about dependencies for the HP Support Pack for RHEL4 RHEL5 SLES10 and SLES11 RHEL4 The following list provides information about software contained in RHEL4 and the related dependencies hpacucli 8 28 xxx ia64 rpm need below packages glibc pretl libunwind hpima 3 12 xxx rhel4 ia64 rpm need below packages bzip2 libs compat libstdc 296 e2fsprogs elfutils libelf systemtap glibc openssl popt redhat release rpm libs tcp_wrappers zlib hpima webapp 4 5 xxx rhe
44. ed when the program exits For more information about cf ggen see cfggen 8 the Utilities Reference chapter of the SmartSetup Scripting Toolkit Deployment Guide or the HP 8 Internal Port SAS Host Bus Adapter SAS Controller Users Guide http docs hp com en 6369 90071 HP Integrity Virtual Machines WBEM Provider HP Integrity Virtual Machines Integrity VM is a soft partitioning and virtualization technology within the HP Virtual Server Environment that enables you to create multiple virtual servers or machines within a single HP Integrity server or nPartition Each virtual machine hosts its own guest operating system instance applications and users The HP Integrity VM WBEM provider facilitates the enabling of manageability and support of guests Product Installation Dependencies 42 Some software products have dependencies or prerequisites that might not be available on your system When installing software the Management media installer attempts to handle any dependencies that are required Also most required software is provided with your Linux OS distribution media and should be installed by default If there is required software that is not delivered with the Management media installer or with the Linux OS installation an error message displays information about the missing software packages or files and the installation process is aborted You must then obtain and install the required packages or files before runn
45. er AB315 Core I O for X X X X 60201 Mittlehorn server RUSA Ruby Sapphire X X X X UCIO Unified Core I O board rx4640 Embedded I O for X X X rx4640 RAID 337972 HP Smart Array X X X X B21 P600 Controller A9825A Smart Array 5302 X X with 128MB cache A9826A Smart Array 5304 X Xx with 256MB cache A9890A HP Smart Array X X X X 6402 128MB Controller AD335A HP Smart Array X X X X P800 Controller 61 62 Table D 1 Supported Products Matrix continued Part Description RHEL Support SLES Support Number 4 4U1 AH226A HP PCIe Smart X Array E500 SAS Controller SA P400 PCIe 8 port int SAS X core 1 Smart Array P400 Core I O rx2660 SA P400 PCIe 8 port SAS X core 2 Smart Array P400 Core I O rx3600 rx6600 SA P600 PCI X 8 port X int 4 port ext SAS Smart Array P600 Core I O rx3600 rx6600 SA P800 PCIe 8 port X int 8 port ext SAS Smart Array P800 Core I O rx3600 rx6600 SAS 431643 HP BLc PCIe Mezz X B21 pass thru BL860c Embedded I O for Xx BL860c BL870c Embedded I O for X BL870c rx2660 Embedded I O for X rx2660 SCSI A6695 SCSI and MP Core 69101 I O A6794A SCSI amp LAN Core X X T O Procurium A7059A Windows and X X Linux Ultra160 SCSI Adapter A7060A Windows Linux 2 X X port Ultra160 SCSI HBA A7173A HP Dual Channel X X Ultra320 SCSI Adapter A9918A Core I O for the X XxX rx76xx rp7420 serve
46. grade the product may reveal dependency conflicts which will require you to intervene Instructions for solving these conflicts or how to properly configure HP Management Base are provided by the installer NOTE There is a known compatibility issue with HP ACU CLI and RHEL5U1 on HP Integrity servers with a SmartArray controller configured with more than one logical drive To avoid creating this adverse condition the installer will not install the HP ACU CLI hpacucli product on these servers and this option is not displayed in the product installation menu Further if hpacucli is detected on the system it is uninstalled by the installer After the installation is complete you must start the appropriate framework to access any providers execute one of the following WBEM Providers OpenPegasus on RHEL or SLES 10 etc init d tog pegasus start SMX WBEM Providers SFCB on SLES 11 etc init d sfcb start NOTE The installation log for the HP Support Pack is located in var log hp managementCD version_number install 1log This directory is applicable if the media you are using is CD DVD or the USB HDD Installing Software from the HP Support Pack 47 48 A Configuring and Using a Serial Console Before the Linux operating system OS is booted all console interaction occurs through EFI To modify the default local graphics display to be a serial console path you must configure a single serial port UART for both Console
47. ht flash periodically as your tasks are automatically performed 16 Press Enter to continue You are prompted to insert the diagnostics media 17 Insert the HP Itanium Processor Family IPF Offline Diagnostics and Utilities media and press Enter Using HP Smart Setup to Install the OS 29 18 A prompt is displayed with a message directing you to insert the Linux installer media in the CD or DVD drive as shown in Figure 3 13 we IMPORTANT If you are using a serial console prior to starting the Linux OS Installation see Configuring and Using a Serial Console page 49 and follow the instructions Figure 3 13 Inserting the Linux Installer Media i INFORMATION Insert the first disk of your Linux installation media 1 If you are using a serial console ensure that you select a serial console at the ELILO prompt This may involve using a console ttySO of kernel command line parameter The HP Service Partition HPSP has been created most Linux installers do not create this necessary partition Ensure that you select the disk formatting options that preserve the HPSP This may include options that will Remove all Linux partitions Do not select Remove all partitions options 0K Help Insert the Linux Installer media and press Enter The Linux OS installation completes Immediately after the initial installation of the OS is successfully installed HP recommends that you run the HP Suppo
48. info perl SLES11 53 54 C Known Issues This appendix contains known issues with the HP Insight Foundation Suite for Integrity with Linux product which undergoes rigorous testing before each release From HP test activities to date the following items have been uncovered that you should keep in mind HP Insight Management WBEM Providers on Pegasus cimserver Supports Multi Process Mode Only HP Insight Management WBEM providers running on Pegasus cimserver RHEL5 SLES10 only support running in multi process mode HP Insight Management WBEM Providers will not currently support running in a single process on the Pegasus cimserver To ensure your providers are running in a Pegasus multi process configuration perform the following steps as the root user 1 Verify that the cimserver is running to retrieve configuration values by entering etc init d tog pegasus start 2 Verify that forceProviderProcess is set to true by entering cimconfig g forceProviderProcesses This command should return Current value true 3 Based on the value returned in Step 2 perform one of the following steps e Ifthe command returns Current value false reset the value by entering cimconfig p s forceProviderProcesses true e Ifthe command returns Current value true reset the Pegasus cimserver to allow the new setting to take affect by entering etc init d tog pegasus restart Unaligned Access Messages Due to the current alignment bou
49. ing the installer again See your Linux OS for information about obtaining and installing the missing software A list of software dependencies for all supported Linux distributions is provided in HP Support Pack Dependencies page 51 Installing and Using the HP Support Pack A NOTE The Management media installer automatically checks your system for the hpmgmtbase software This software is installed or updated by default Removing OpenWBEM OpenPegasus is required to install nPartition Commands Partition Manager and HP WBEM Providers Removing OpenWBEM requires the removal of several other SLES utilities You should verify that you do not need these utilities before you remove them The HPIMA ACU CLI and HP SMH utilities do not require OpenPegasus The installer prompts you to remove OpenWBEM if you choose to install any of the above packages that require OpenPegasus You are first prompted to view more information about the package before removal and then you are prompted to remove the OpenWBEM package from your system At this point you must decide whether to reply with confirm to remove OpenWBEM and continue with the installation or with n to discontinue Installing the Java Development Kit Product Installing Sun JDK 6 for the Linux IA64 Platform Use this procedure to install the Sun Java Development Kit JDK 6 1 Download Sun JDK 6 binary file for the Linux Intel Itanium platform from the Sun Developer Netwo
50. istcanccciectieenisdenel 58 DSupponed Products MONK aua EAE des nearer earats 59 Table of Contents 5 About This Document This document describes how to use the HP Insight Foundation Suite for Integrity with Linux HIFIL V2 6 product e The HP Smart Setup software prepares your system for installation of the Linux operating system OS The HP Smart Setup EFI based setup utility EBSU utility assists with tasks such as configuring storage adapters upgrading firmware preparing a system hardware inventory and installing diagnostics tools e The HP Support Pack installs additional utilities and tools such as HP system management software after the Linux OS is installed It includes the HP Integrity Linux Management Tools which provides HP Systems Insight Manager for additional functionality The document printing date and part number indicate the document s current edition The printing date changes when a new edition is printed Minor changes may be made at reprint without changing the printing date The document part number changes when extensive changes are made Document updates may be issued between editions to correct errors or document product changes To ensure that you receive the updated or new editions you should subscribe to the appropriate product support service See your HP sales representative for details See the latest version of this document at the HP Technical Documentation website http docs hp com Ad
51. iveespneaee tres 42 HP Integrity Virtual Machines WBREM Provider iciccisssdssesnevvaccescnduvesstseiescvenetscenveieceibe Ceieavevtiedeoe 42 Product Installation Dependenciessii ccaincieoruarins cadena eta eae 42 Removing Open WBEM 5 0 20 ec serenor sept S ure R EER Ae EEES r EA S E REEE AET ERRAN 43 Installing the Java Development Kit Products isc cit ce healt scouts ion deesveckewalecyataess eaakaeiads omavvanceh ray 43 Installing Sun JDK 6 for the Linux IA64 Plattorin sci sssnesveccesntsoniseatswmnntoneavecncannesudetsouasurevernens 43 Installing BEA JRockit 5 0 JDK for the Linux IA64 Platform 0 cece cece cess ceeeeeeeeeeeeneee 43 Installing Software from the HP Support Pack ist 5 ecsavenseieesucas ates cvostorey aewsbos Sednaeear nesses tvouleceuneeutes eagnivs 44 Betore R nnine the Installert seg estas iie a at ta a eaa Ei 44 R nning the Installeren erna rare ae Tanni en e OS a aana EEEa EEAS A NEEE taeda mean EEEn 45 A Configuring and Using a Serial Console icsscsiscstestisciccsaies devenveisianscenetanmnwenee 49 Configuring a Serial CONSOle sa ieisvecdas dovidhsasies eiednaenas say Ea EEEE REEERE EEES EERTE ERRAN EEE ne ER 49 Using ad Serial Consoles erserioconcii enirir iiini ier EEEE EEEE EEE py Seca EE E eden EER 49 B HP Support Pack DemenGen cies inci sscacsceesssceashticcaceuciesdeseccavceredccublecsuuasavecaccdeedys 51 dW Ln a ea SRE ae EN dO eS Pr N Pe RP 2 er ST Vara Ast OCR AET 51 TRE ree SEAE A bea cane peed asad etree
52. l A8003A 2 port 4Gbps Fibre Channel 403619 B21 2 port 4Gbps Fibre Channel List all PCI devices to determine whether your system contains one of these adapters lspci grep Fibre 80 02 0 Fibre Channel Emulex Corporation Helios X LightPulse Fibre Channel Host Adapter rev 01 a0 02 0 Fibre Channel QLogic Corp QLA2312 Fibre Channel Adapter rev 03 a0 02 1 Fibre Channel QLogic Corp QLA2312 Fibre Channel Adapter rev 03 NOTE The number of PCI functions displayed for each adapter by 1spci is determined by the number of ports the adapter has In other words 2 port adapters have two entries with the same PCI bus slot that differ only in function number as in the previous example Adapter Part No Output of 1spci Command A6826A Fibre Channel Fibre Channel QLogic Corp QLA2312 Fibre Channel Adapter rev 03 A7538A Fibre Channel Fibre Channel QLogic Corp QLA2312 Fibre Channel Adapter rev 03 AB379A Fibre Channel QLogic Corp QLA2422 Fibre Channel Adapter rev 02 AB429A Fibre Channel QLogic Corp QLA2422 Fibre Channel Adapter rev 02 AD167A Fibre Channel Emulex Corporation Helios LightPulse Fibre Channel Host Adapter rev 01 Installing the OS and Updating the Server Adapter Part No Output of 1spci Command AD168A Fibre Channel Emulex Corporation Helios X LightPulse Fibre Channel Host Adapter rev 01 AE311A Fibre Channel QLogic Corp QLA2432 Fibre Channel Adapter rev 02
53. l4 ia64 rpm need below packages net snmp hpmgmtbase 2 11 xxx rhel4 ia64 rpm need below packages binutils glibc redhat release hpsmh 3 0 0 xxx ia6 4 rpm need below packages None hpsmh tomcat 1 3 xxx linux ia64 rpm need below packages None hpvm 4 1 0 xxx rhel ia64 rpm need below packages glibc hpvmprovider 4 1 0 xxx rhel ia6 4 rpm need below packages glibc libgcc libstdc tog pegasus hpwbem 3 3 8 xxx rhel4 ia64 rpm need below packages glibc libgcc libstdc popt tog pegasus hpwbem base server 3 3 8 xxx rhel4 ia64 rpm need below packages glibc libgcc libstdc popt tog pegasus hpwbem firmwarelogs 3 3 8 xxx rhel4 ia64 rpm need below packages glibc libgcc libstdc tog pegasus hpwbem legacy 3 3 8 xxx rhel4 ia64 rpm need below packages ethtool glibc libgcc libstdc rpm libs sysfsutils tog pegasus hp com npartition providers 1 07 01 xxx rhel4 ia6 4 rpm need below packages glibc libgcc libstdc tog pegasus hp com npartition cmds 1 03 00 xxx rhel4 ia64 rpm need below packages glibc libgcc libstdc tog pegasus hp com parmgr 2 02 04 xxx rhel4 ia6 4 rpm need below packages tog pegasus hp utilprovider 01 07 xxx rhel4 ia6 4 rpm need below packages glibc libgcc libstdc tog pegasus mptsas_cfggen 2 0 30 xxx ia64 rpm need below packages None net snmp 5 1 2 xxx EL4 7hp ia64 rpm need below packages beecrypt bzip2 libs chkconfig elfutils libelf systemtap glibc libselinux openssl popt rpm libs tcp w
54. lation of the products provided with the HP Support Pack NOTE If the installer detects missing RPMs that are necessary to the installation messages are displayed indicating which RPMs you must install before proceeding For example messages similar to the following may appear hpima will not be available because the following required RPMs are missing net snmp sensors hpsmh will not be available because the following required RPMs are missing net snmp sensors In this case you would need to install the required RPMs for HP IMA and HP SMH before these products can be installed A menu of available products and options that can be installed is displayed The contents of this menu depend upon the version of the HP Support Pack that you are installing or the Linux distribution installed on your system A menu similar to one of the following is displayed Installing Software from the HP Support Pack 45 Menu for RHEL4 Install HP Insight Manager Agents for HP Integrity servers Install HP System Management Homepage Install HP Insight Management Agents Webapp via HP SMH Install nPartition Commands Install The nPartition Management GUI for HP Integrity servers Install HP WBEM Providers for Linux Install HP Command Line Array Configuration Utility Install HP Utilization WBEM Provider Install HPVM Guest Kit for Linux Install The Open64 Compiler Suite v4 2 1 Install or update everything Uninstall HIFIL and return to this menu
55. lity at the HP Integrity server connectivity website http www hp com go serverconnectivi 6 Verify storage compatibility by reviewing the HP Integrity Server Storage Support Matrices located at http www hp com products1 serverconnectivity support_matrices html A NOTE This list is not exhaustive because storage vendors may support more configurations E than those indicated at this site As a general rule check with your storage vendor and an HP Sales Representative for a definitive statement on server storage compatibility Backing Up Existing Data To restore the data from the hard disk on your server after migrating to Linux you must first back up the data and verify that it can be restored Use the following guidelines 1 Perform a server wide backup using your existing backup utilities 2 Verify the integrity of the backup by restoring samples of data to another server 3 Store the backup in a safe place Setting Up a Console You can install the OS and administer the server from either a VGA console a serial console or both On HP Integrity rx1600 rx1620 rx2600 and rx2620 servers the Management Processor MP is optional In cases where the MP was not ordered the only console is the serial interface on the bulkhead connector This connector is a serial port UART and must be configured for use For configuration information see Configuring and Using a Serial Console page 49 Setting Up a Serial Con
56. lled as a standalone application You can use HP Partition Manager to perform the following tasks create modify and delete nPartitions examine the nPartition configuration of a complex all of hardware within a server including all cells I O chassis cables cabinet hardware and power and utilities components check the complex for potential configuration and hardware problems and manage hardware resources on the complex we IMPORTANT Before installing HP Partition Manager you must download and install the Sun JDK 6 or BEA JRockit 5 0 For the JDK installation details see Product Installation Dependencies page 42 HP nPartition Commands HP nPartition Commands enable you to create modify and delete nPartitions on HP nPartition servers including HP Integrity servers such as the Superdome rx8640 rx8620 rx7640 and rx7620 servers The manpages for these commands are also installed 40 Installing and Using the HP Support Pack HP Array Configuration Utility Command Line Interface HP Array Configuration Utility Command Line Interface ACU CLI for Linux on Itanium based systems is an online tool that can be used to manage and configure Smart Array based storage controllers The HP ACU CLI is an interactive command console that provides immediate feedback to the user and is functionally equivalent to the ACU GUI OpenPegasus y OpenPegasus implements the WBEM standard to enable management solutions tha
57. n to disable the firewall b For RHEL4 or RHELS set Enable SELinux to Enable to use a security policy HP Insight Foundation Suite for Integrity with Linux supports the use of SELinux with RHEL4 and RHELS only 3 Continue the installation using the defaults provided or configure as needed until the Package Group Selection screen appears Modify the selection by clicking Everything to install all packages included with RHEL 4 Continue the installation using the defaults provided or configure as needed The Linux OS installation completes HP recommends that you run the HP Support Pack installer immediately after the installation of the OS is complete as described in Chapter 5 page 39 Updating the Server To update your system after installing the OS you must install the latest patches and fixes from the appropriate Linux OS distribution website A NOTE Firmware upgrades for Superdome sx1000 rx8640 rx8620 rx7640 and rx7620 servers must be performed by HP CEs in compliance with the support agreement Installing Updates from the Web The latest software updates for your HP Integrity server are available from the HP Business Support Center as follows 1 Go to the http www hp com support itaniumservers website Click on the appropriate product link for your server Click the Download drivers and software link Select a software driver language from the list Click on the appropriate Linux distribution link ae WN
58. ndaries of certain data structures on Integrity servers customers may see infrequent messages in the system event log with the format sfcbd unaligned access This should only occur during WBEM Provider initialization and does not represent any loss of data integrity or functionality Supertluous PAM Authentication Message The release currently shipping for SuSE Linux Enterprise Server 11 SLES11 has a verbose sfcb default configuration setting for all PAM authenticated actions This setting results in a superfluous message of the following form pam_ succeed if sfcb auth requirement user ingroup sfcb was met by the root user This message appears in var log messages reporting for each successful PAM authentication during WBEM requests An enhancement request has been filed with SuSE as well as SFCB maintainers and will be resolved by the next distribution release If the messages become an issue use the workaround that follows until this is resolved The PAM logging setting for sfcb can be changed by using the following steps 1 Shutdown SFCB by running the following as root user etc init d sfcb stop 2 Edit the etc pam d sfcb config file by making the following edit Replace the line auth required pam_succeed if so user ingroup sfcb HP Insight Management WBEM Providers on Pegasus cimserver Supports Multi Process Mode Only 55 with the following line auth required pam_succeed_if so quiet success user ingroup sfcb 3 Resta
59. nnedsaseveabucas aeatss tigencteneds 15 Tristallation Protestoni ee E E E a bbe Setad A A E aS 15 2 Preparing for Installahionsi enuen aeae aaa a aa e i 17 Obtaining the Latest HP Insight Foundation Suite for Integrity with LinuX s sesssesssessessesssersersees 17 Ensuring Platform Compatibility erseseiiisie eisin axed cuecesssunceceasthvkadespyieeeaannteaaavnmigeant ii 17 Verifying Hardware Compatibility s ssseessssesseesesseesserssessesserssisrseserssisnreseessienrereenseesresresseessesees 17 Backing Up Existing etek catatonic ice naz nave dave ven eds va Daa eho EEEE MATERE RTE Lasoo Dever E EEEREN Stai 18 Setting Upa Consoles ore enaar era EEE AEA E S ieee EE AE EEA nein 18 Setting Up a S rial Consolen oc sti cchewd opt ecaarieentas i e a a a a a i a a a 18 Setting UpP a VGA CONSOLE ieren iie onas E e aT E EE Medios EE EAE ENSS 19 Preparing tie Server Hardware disisi reiri enrarir es EA S E A EEREN EE enata ie 19 Setting Up the Boot Driverinn eirin a e a a E a a a a a a a 19 Accessing the Removable Media Devices Using EFI ssssesssssssesssseseesesesressestesessessesesseseensesees 20 Enabling a CD DVD Device i rcris5csscttesvadtogsses cedaceveresyitia cts EEEa A e a Sesinia EEEn i ri akea Seutas 20 Fnabling asl SBD CV iCe 5 sivis2 bsncsiierssitnsnncnsndcis WeeGed in an EEEE R e a EE E i 21 3 Installing the OS and Updating the Server escssssssessecseeesseeesseeesseeeseenesneneanenees 23 Using HP Smart Setup to Ins
60. nt data This product includes SNMP extensions data collection agents and MIBs ported from the legacy Compag Insight Manager product such as Health Host Network Interface Card NIC Standard Equipment Standard Information Storage including IDA IDE SCSI and FC and Threshold The agents are handled by the HP Systems Insight Manager though they should work with any other management console applications that use SNMPv1 You can obtain the latest version of HP Insight Management Agents by installing the downloaded HP Support Pack as described in Obtaining the Latest HP Insight Foundation Suite for Integrity with Linux page 17 Software Provided in the HP Support Pack 39 For more information see HP Insight Management Agents for Linux on HP Integrity Servers Installation Guide and Release Notes http www docs hp com en 5991 2731 HP System Management Homepage The HP System Management Homepage SMH is a web server that can be used by HP web enabled system management software The System Management Homepage provides an interface between the HP Insight Management Agents and the HP manageability tools The HP System Management Homepage software organizes data from HP Insight Management Agents installed on a server into easy to read tables that are displayed in a web interface For more information see the HP System Management Homepage website http www hp com servers manage smh HP Server Manageability eXtensions
61. nter The MP gt prompt is displayed if you are using the Management Processor otherwise the server s output is shown A NOTE Before the Linux OS is booted all console interaction occurs through EFI To modify the default local graphics display to a serial console path you must configure a single serial port UART for both Console In Out in the EFI boot manager For detailed instructions see Configuring and Using a Serial Console page 49 Setting Up a VGA Console On servers configured with an internal graphics adapter you can connect a monitor keyboard and mouse directly to the appropriate ports On HP Integrity rx5670 servers you must first install an HP Graphics and USB Combo adapter A6869A and then connect the console to the appropriate ports From an existing serial console you can then modify the system configuration to redirect the output to the VGA console Table 2 1 Graphics Support on Server Models Server Model Graphics Adapter rx1600 rx2600 rx4640 rx1620 rx2620 Internal graphics adapter available on an MP adapter which is optional on some servers 1x5670 Optional HP Graphics and USB Combo adapter A6869A To install the HP Graphics and USB Combo adapter Insert the HP Graphics and USB Combo adapter in an open PCI slot of the server Connect a VGA monitor USB HP keyboard and USB mouse to the appropriate ports Boot the server to the EFI Boot Manager menu From the EFI Boot Manager
62. nue with the use of the HP Smart Setup EBSU utility however it could invalidate your HP service contract For more HP Integrity server information see the HP Business Support Center website http www hp com support itaniumservers 4 Ifyour HP Integrity server is cell based for example a Superdome sx2000 server or contains the zx2 chipset execute this step otherwise continue to step 6 The additional System Settings option appears on the Main Menu as shown in Figure 3 3 Figure 3 3 HP Smart Setup EBSU Main Menu with System Setting Option PE RVEPrP FXIOUY Configure Storage Adapters 24 Installing the OS and Updating the Server Based on the type of server the option to configure either the Advanced Configuration and Power Interface ACPI or maximum payload size MPS setting appears Use the following steps to configure your system s ACPI or MPS settings properly Select System Settings and press Enter Choose one of the following processes as appropriate for your system either ACPI or MPS ACPI Setting a The following screen is displayed Figure 3 4 Configure the ACPI Setting Linux requires setting the appropriate ACPI configuration mode to operate correctly Select help for more information about how to configure ACPI mode for Linux Please set the ACPI mode according to your platform as shown below Default ACPI Configuration Mode is supported for the following systems rx7640 rx8640 and SuperDome SD16B
63. on providers 1 07 01 xxx sles10 ia64 rpm need below packages 52 HP Support Pack Dependencies glibc libstdc libunwind hp com npartition cmds 1 03 00 xxx sles10 ia64 rpm need below packages glibc libgcc libstdc libunwind hp com parmgr 2 02 04 xxx slesl10 ia64 rpm need below packages None hp smx 02 05 xxx sles10 ia6 4 rpm need below packages glibc libgcc libstdc libunwind hp utilprovider 01 07 xxx sles10 ia64 rpm need below packages glibc libgcc libstdc libunwind mptsas_cfggen 2 0 30 xxx ia64 rpm need below packages None open64 4 2 1 xxx ia64 rpm need below packages gcc glibc info perl tog pegasus 2 7 1 xxxhp sles10 ia64 rpm need below packages bash bind utils coreutils e2fsprogs glibc grep openssl libgcc libstdc libunwind net snmp net tools openssl pam procps sed SLES 1 The following list provides information about software contained in SLES11 and the related dependencies hpacucli 8 28 xxx ia64 rpm need below packages glibc prctl libunwind hpmgmtbase 2 11 xxx slesll ia64 rpm need below packages binutils glibc sles release hpsmh 3 0 0 xxx ia64 rpm need below packages None hpsmx webapp 0 2 7 noarch rpm need below packages libxm1l2 python python python xml hp smx 02 05 xxx slesll1 ia6 4 rpm need below packages glibc libtdb1 libgcc43 libstdc 43 libunwind sblim sfcb mptsas_cfggen 2 0 30 xxx ia64 rpm need below packages None open64 4 2 1 xxx ia64 rpm need below packages gcc glibc
64. ort a file system protocol After these mappings are created the drive letters can be used with all the file manipulation commands It can also be used to create new mappings and delete existing mappings using the d option If the map command is used without any options all the current mappings are listed If the v option is used the mappings are shown with additional information on each mapped handle Record the device name of the USB HDD device s0 for example Use this device name to explore the contents of the removable media Go to the USB file system fsnumber Preparing the Server Hardware 21 11 Change directories to EFI boot and then enter the following bootia64 efi The Smart Setup EBSU entry is created in the EFI Boot Manager as a selection for booting to launch the HP Smart Setup EBSU utility A NOTE This entry may fail if you change the USB connection You must execute the preceding steps again to reconnect the USB HDD device 22 Preparing for Installation 3 Installing the OS and Updating the Server This chapter provides instructions for installing Linux using the HP Smart Setup EBSU utility or a cold installation You can install the HP Support Pack after installing the OS Using HP Smart Setup to Install the OS we The HP Smart Setup EBSU utility provides an easy to use interface for installing the OS and for performing other tasks such as configuring storage adapters upgrading firmwar
65. ou to upgrade the firmware if the installed version is the same or higher than the version of the HP Smart Setup utility However you can make a firmware downgrade by selecting the Maintain Firmware function from the Main Menu When using this function you are prompted for confirmation of the downgrade ADD EBSU QLOGIC PROMPT CHANGES HERE AND IN CH5 The Smart Setup wizard upgrades the firmware for all supported servers except the following rx1660 rx1620 rx2600 rx2620 cx2620 rx4640 rx5670 rx7620 rx8620 Superdome sx1000 For these servers you must contact HP Support for assistance in upgrading the firmware Figure 3 11 Page 2 Disk Partitioning Page 2 of 3 2 Select the logical volume for which you want to crente partitions at Pressing the SPACE bar displays the full device Kx gt BLK fAcpi 666333F0 16 gt Pcit1i gt Scsi Pun Lun extra Cnull gt GB gt BLK 1 Acpi 6444F1 161 gt Pcit1i gt Scsi Pun Luni2 gt Cnull gt GB more hard disks NOTE The EFI System Partition CESP gt and the HP Service Partition CHPSP gt will be created on the selected disk 3 Do you want to install the Drive Explorer utility on the HP Service Partition CHPSP gt x Yes lt gt No Cancel Back Next arrows move i TAB lt move gt ENTER selects i for Help Installing the OS and Updating the Server 13 Make the appropriate selections for the options on Smart Setup Page 2 as follows a For
66. port e Drive Explorer Offers these options Execute Launches Drive Explorer which displays the directories present on the disks in the EFI partition or executes EFI programs Install Installs Drive Explorer IMPORTANT When using QLogic Fibre Channel adapters while using the configuring partitions creating partitions or HP Smart Setup EBSU utilities if an older version of the EFI aux driver is installed it is possible that storage devices attached to this adapter may not be detected If this situation occurs a prompt is displayed and you must update the firmware of the QLogic Fibre Channel adapters before reattempting the utility HP Smart Setup Utilities 37 38 5 Installing and Using the HP Support Pack This chapter provides instructions for installing and using the HP Support Pack This contents of this software package must be installed after installation of the OS only Software Provided in the HP Support Pack The HP Insight Foundation Suite for Integrity with Linux provides the following additional functionality and utilities for your Linux system in the HP Support Pack e HP Management Base for Integrity Servers page 39 e HP Insight Management Agents page 39 e HP System Management Homepage page 40 e HP Server Manageability eXtensions page 40 e HP WBEM Providers for Linux page 40 e HP Partition Manager page 40 e HP nPartition Commands page 4
67. question 2 specify the logical volume on which you want to create partitions E NOTE The EFI System Partition ESP and the HP Service Partition HPSP will be created on the chosen logical volume to simplify the maintenance of your server b For question 3 specify the option to install the Drive Explorer utility which enables you to browse a drive in EFI Select Next and press Enter to display the next screen similar to Figure 3 12 Figure 3 12 Page 3 Installation Considerations 14 Make the appropriate selections for the options on Smart Setup Page 3 as follows a For question 4 specify the option to install offline diagnostic tools from the HP Itanium Processor Family IPF Offline Diagnostics and Utilities media b Question 5 is only enabled if the system is cell based otherwise it appears in red and is disabled If the system is cell based specify the ACPI configuration mode For the Superdome rx8640 rx8620 rx7640 and rx7620 servers use of the default selection is suggested all others should use the Default ACPI Configuration Mode selection c For question 6 specify the option to launch the Linux installer Select Setup and press Enter to display the partition deletion confirmation window 15 Select Continue and press Enter A prompt is displayed with the following message i INFORMATION All tasks you selected will now be performed A progress bar is displayed along with the status text The screen mig
68. r Supported Products Matrix Table D 1 Supported Products Matrix continued Part Description RHEL Support SLES Support Number 4 4U1 AB290A HP PCI X 2p X X 1000BT 2p U320 SCSI Adpter AB306A Core IO for the X rx86 rp8420 server AB314A HP Integrity X X rx8640 Core I O Adapter AB315 Core I O for X X 60201 Mittlehorn server rx1600 Embedded I O for X rx2600 rx1600 rx2600 rx1620 Embedded I O for X X rx2620 rx1620 cx2620 rx2620 cx2620 USB A6869A Graphics USB X Adapter for HP servers A6869B HP Servers X X Graphics USB PCI Adapter BL860c Embedded I O for X X BL860c BL870c Embedded I O for X XxX BL870c RUSA Ruby Sapphire X X UCIO Unified Core I O board rx1600 Embedded I O for X rx2600 rx1600 rx2600 rx1620 Embedded I O for X X rx2620 rx1620 cx2620 rx2620 cx2620 rx2660 Embedded I O for X X rx2660 rx4640 Embedded I O for X X rx4640 Video A6869A Graphics USB adapter for HP servers A6875A HP Management X X Processor adapter for zx6000 63 64 Table D 1 Supported Products Matrix continued Supported Products Matrix Part Description RHEL Support SLES Support Number 4 4U1 BL860c Embedded I O for BL860c BL870c Embedded I O for BL870c RUSA Ruby Sapphire UCIO Unified Core I O board rx2660 Embedded I O
69. r OS pay attention to the differences in supported hardware between the two operating systems You must replace incompatible components with those supported on Linux If you want to keep the data residing on the server hard disk you must back up the data and verify that you can restore it elsewhere Use HP Smart Setup to prepare the server hardware for installation and update the system with the latest firmware and drivers Use the Linux Installer media to load the OS files on the server Perform an update of the latest Linux patches and fixes from the website of the installed Linux distribution Install additional tools and utilities using the HP Support Pack Installed Linux Incorrect or Inoperable Use HP Smart Setup to set up and update the system with the latest firmware and available drivers After reinstallation of Linux verify that the OS is installed correctly Perform an update of the latest Linux patches and fixes from the website of the installed Linux distribution Install additional tools and utilities using the HP Support Pack Choosing an Installation Environment The installation environment consists of the server model the Linux OS distribution and version a VGA or serial console and the software you need to perform the installation The software required for installation includes the HP Smart Setup software package and the Linux installer media A list of the supported HP Integrity servers is provided in the Support Info
70. rappers zlib net snmp perl 5 1 2 xxx EL4 7hp ia64 rpm need below packages bzip2 libs elfutils libelf systemtap glibc openssl perl popt rpm libs tcp_wrappers zlib net snmp utils 5 1 2 xxx EL4 7hp ia64 rpm need below packages elfutils libelf systemtap glibc openssl perl net snmp devel 5 1 2 xxx EL4 7hp ia64 rpm need below packages beecrypt devel elfutils devel rpm libs rpm devel net snmp libs 5 1 2 xxx EL4 7hp ia64 rpm need below packages RHEL4 51 glibc openssl open64 4 2 1 xxx ia64 rpm need below packages gcc glibc info perl RHELS The following list provides information about software contained in RHELS and the related dependencies hpacucli 8 28 xxx ia64 rpm need below packages glibc pretl libunwind hpima 3 12 xxx rhel5 ia64 rpm need below packages compat libstdc 296 e2fsprogs libs glibc net snmp net snmp libs openssl perl redhat release tcp wrappers zlib hpima webapp 4 5 xxx rhel5 ia64 rpm need below packages net snmp hpmgmtbase 2 11 xxx rhel5 ia64 rpm need below packages binutils glibc OpenIPMI redhat release hpsmh 3 0 0 xxx ia6 4 rpm need below packages None hpsmh tomcat 1 3 xxx linux ia64 rpm need below packages None hpsmx webapp 0 2 xxx noarch rpm need below packages libxml2 python python python devel hp com npartition providers 1 07 01 xxx rhel5 ia6 4 rpm need below packages glibc libgcc libstdc hp com npartition cmds 1 03 00 xxx rhel5 ia64 rpm need below packages glibc libgcc libst
71. ribed in Obtaining the Latest HP Insight Foundation Suite for Integrity with Linux page 17 HP recommends that you review Appendix D page 59 to ensure that the adapters in your server are supported by the HP Insight Foundation Suite for Integrity with Linux In addition HP recommends that you keep the server up to date as described in Updating the Server page 31 Overview 11 The following table provides the minimum RHEL and SLES OS distributions that are supported using the latest HP Insight Foundation Suite for Integrity with Linux Table 1 1 Supported Minimum OS Distributions by HP Integrity Server Server RHEL Distributions SUSE Distributions BL860c RHEL4U6 RHEL5U1 SLES10 SLES11 BL870c RHEL4U6 RHEL5U1 SLES10SPI SLES11 cx2620 RHEL4U4 None rx1600 RHEL None 1x1620 RHEL4 RHEL5 SLES10 rx2600 RHEL4 None rx2620 RHEL4 RHEL5 SLES10 1x2660 RHEL4U4 RHEL5 SLES10SP1 SLES11 1x3600 RHEL4U4 RHEL5 SLES10 SLES11 1x4640 RHEL RHEL5 SLES10 1x5670 None None 1x6600 RHEL4U4 RHEL5 SLES10 SLES11 1x7620 RHEL4U1 RHEL5U1 SLES10 1x7640 RHEL4U4 RHEL5U1 SLES10 SLES11 1x8620 RHEL4U1 RHEL5U1 SLES10 1x8640 RHEL4U4 RHEL5U1 SLES10 SLES11 Superdome sx1000 RHEL4U1 RHEL5U1 SLES10 Superdome sx2000 RHEL4U4 RHEL5U1 SLES10SP1 SLES11 Support Exceptions Ensure The following support exceptions should be reviewed to ensure that you are using the corre
72. rk website http java sun com javase downloads index js 2 Set execute permissions on the downloaded file chmod jdk 6u1l2 linux ia64 bin 3 Run the self extracting binary to extract the RPM file jdk 6u12 linux ia64 bin A NOTE The initial is required if you do not have a period in your PATH environment variable A binary license agreement is displayed 4 You must agree to the Sun JDK 6 license agreement to proceed with the installation A NOTE The default installation path is usr java which can be modified during the installation process A good location to install the Sun JDK is usr local Use this information when setting the JAVA_HOME environment variable in the next step 5 Set the JAVA_HOME environment variable export JAVA_HOME JjavaDir where javaDiris the directory in which the Sun JDK 6 files were installed For example usr java jdk1 6 0 12 A NOTE The JAVA _HOME environment variable must be exported in this fashion prior to and in the same shell session as the use of the HP Support Pack installer Installing BEA JRockit 5 0 JDK for the Linux IA64 Platform Use this procedure to install the BEA JRockit 5 0 Java Development Kit JDK Product Installation Dependencies 43 1 If your system is running RHEL5U1 you must disable SELinux before installing the BEA JRockit 5 0 JDK Otherwise bypass this step echo 0 gt selinux enforce 2 Download the JRockit 5 0
73. rmation page 11 section a list of the supported adapters is provided in Appendix D page 59 Choosing an Installation Scenario 13 Using a Serial Console A serial console is a PC running terminal emulation software such as a Secure SHell SSH client like PuTTY available from the web or on your Linux system Using the minicom or cu command connect to the server through the Management Processor MP serial port or LAN port Figure 1 1 shows serial consoles connected to an HP Integrity rx4640 server Figure 1 1 Serial Console Configuration HP Integrity rx4640 server rear mene ney null modem cable to fal s z a remote T port E cat5 cable to MP LAN port When using a headless console to install Linux you can view detailed installation information for each file by monitoring the setup log channels Using a VGA Console 14 A VGA console is a VGA monitor a USB HP keyboard and a USB mouse connected to the server You can use a USB to PS2 converter to connect to a console switch Figure 1 2 shows a VGA console connected to an HP Integrity rx4640 server Figure 1 2 VGA Console Configuration HP Integrity rx4640 server rear A VGA console provides complete access to all the installation and administration tasks that can be performed on the server You can use the VGA console to prepare the server for installation install the OS and check server status after installation Planning the
74. rmware function from the Main Menu When using this function you are prompted for confirmation of the downgrade The Smart Setup wizard upgrades the firmware for all supported servers except the following rx1660 rx1620 rx2600 rx2620 cx2620 rx4640 rx5670 rx7620 rx8620 Superdome sx1000 For these servers you must contact HP Support for assistance in upgrading the firmware e Create Partitions and Install Diagnostics Creates partitions such as the EFI System Partition ESP or the HP Service Partition HPSP ESP A partition that is required to boot the OS Only the EFI drivers and the OS files should be stored here This partition is labeled EFIPART HPSP An optional partition The files from the HP Itanium Processor Family IPF Offline Diagnostics and Utilities media are stored here This partition is labeled HPPART e Install Linux Launches the Linux Installer e System Inventory Retrieves system information and displays a complete categorized report of the system inventory information including the UUID Logical and Serial Number Logical when possible installed memory and the firmware version for all I O adapters e Install Diagnostics Installs a copy of the diagnostics programs from the HP Itanium Processor Family IPF Offline Diagnostics and Utilities media to the HPSP partition e Install and Update Support Tools Copies support tools to the HPSP partition These tools are for use only by HP Sup
75. rt Pack installer as described in Chapter 5 page 39 Using the Linux Media to Install the OS 30 You can install Linux on your server using the distribution media for one of the supported OSs This activity is considered a cold installation The installation process is very similar to the standard cold installation with these three configuration exceptions e Firewall configuration e Security Enhanced Linux SELinux e Package group selection The instructions for the supported OSs are detailed in the following documents e For RHEL4 See Red Hat Enterprise Linux 4 Installation Guide for x86 Itanium AMD64 and Intel Extended Memory 64 Technology Intel EM64T EL 4 Manual x8664 multi install e For RHEL5 See Red Hat Enterprise Linux 5 Installation Guide http www redhat com docs manuals enterprise RHEL 5 manual Installation_Guide en US e For SLES10 See Installing SUSE LINUX Enterprise Server 10 on HP Integrity Servers http docs hp com en 5991 6394 e For SLES11 See Installing SUSE LINUX Enterprise Server 11 on HP Integrity Servers http docs hp com Installing the OS and Updating the Server To install the OS follow these steps 1 Begin the OS installation as described in the installation guide for the OS you are installing 2 Select the defaults or configure as needed until the Firewall Configuration screen appears Modify the selections offered as follows a Click the No firewall radio butto
76. rt SFCB by entering the following etc init d sfcb start HP Insight Management WBEM Providers Information Reporting HP Insight Management WBEM Providers do not currently report all information about bonded network interfaces If bonded interfaces are configured on a given server CIM_IPProtocolEndpoint WBEM instances will not be displayed on these servers This information will be available on servers when the HP Insight Management WBEM Providers add Ethernet teaming support the next release Changing IP Address of Network Interface While HP Insight Management WBEM Providers are running if the IP address of a network interface is changed the providers do not pickup the new IP address of the network interface This issue will be resolved in the next release Until this issue is resolved use the following workaround Restart the cimserver using one of the following commands as the root user e If running Pegasus on RedHat Enterprise Linux 5 RHELS or SuSE Linux Enterprise Server 10 SLES10 enter the following etc init d tog pegasus restart e If running SFCB on SuSE Linux Enterprise Server SLES11 enter the following etc init d sfcb restart Configuring Storage Adapters The Configure Storage Adapters function in the HP Smart Setup EBSU utility requires that the EFI driver for the storage adapter be installed prior to configuring storage adapters You must first select the Maintain Firmware function from the HP Smart Se
77. s Installing the MPT Fusion HBA Drivers for Linux Support for the HP Insight Management Agent for the Core 8 port Serial Attached SCSI SAS HBA on the rx2660 server or BL860c and BL870c server blades is not included with the MPT Fusion driver that is shipped with the Red Hat and Novell Linux distributions However HP Insight Management Agent support is included with the MPT Fusion driver that is shipped with RHEL4 6 and RHEL4 7 If you are running HP Insight Management Agents for these HBAs on one of the listed servers you must update the driver using the following steps 1 Go to the http www hp com support itaniumservers website 2 Click on the appropriate product link for your server 3 Click the Download drivers and software link 4 Select a software driver language from the list Installing the MPT Fusion HBA Drivers for Linux 33 5 Click on the appropriate Linux distribution link All of the available driver and software updates are provided in a categorized listing for your selection 6 Click the Download button for the latest MPTLinux Driver Update for Integrity Servers driver to download the tar file 7 Install the driver on your system rpm ivh lt downloaded driver name gt 8 Reboot your system A NOTE To avoid any potential issues review the known issue Installing the MPT Fusion HBA Driver on RHEL 5U2 and RHEL 5U3 using a Xen Kernel Hangs the Server page 56 For additional inform
78. sentials Foundations Pack for Linux version Check ftp ftp hp com pub linux for software updates Y N Select one of the following options a If you want the installer to determine if a newer version of the HP Support Pack is available enter Y The installer connects to the HP FTP site and performs a comparison between your version and the latest version of the HP Support Pack e Ifa newer version is not available the installation of the current version of the HP Support Pack software proceeds e If anewer version is available a message is shown notifying you that a new version is available A list of options is displayed Select the appropriate option b Ifyou do not want the installer to determine if a newer version of the HP Support Pack is available enter N You have selected not to update your Management CD software at this time If you would like to update this software in the future you can obtain the latest version from HP s support website as follows For the latest information and downloads go to http www hp com go integritylinuxessentials Press lt enter gt to continue the installation of the current version of the HP Support Pack Press Enter to proceed with the installation of the current version of the HP Support Pack You are prompted to make additional selections based on the software update option you selected in the previous step The installer analyzes your system and prepares it for instal
79. sing the following steps 1 Edit etc elilo conf 2 Add the following line immediately after the line image vmlinuz 2 6 18 92 e15xen in the label HP stanza vmm xen gz 2 6 18 92 e15 The file should now look like prompt timeout 20 default HP Corresponds to kernel 2 6 18 92 el5xen previously default linux relocatable image vmlinuz 2 6 18 92 el15xen vmm xen gz 2 6 18 92 e15 label linux initrd initrd 2 6 18 92 el5xen img read only root dev VolGroup00 LogVol100 append rhgb quiet The following entry was added by Proliant HBA install script in package mptlinux 4 00 13 01 3 rhel5 Installing the MPT Fusion HBA Driver on RHEL 5U2 and RHEL 5U3 using a Xen Kernel Hangs the Server 57 image vmlinuz 2 6 18 92 el15xen vmm xen gz 2 6 18 92 e15 label HP Corresponds to kernel 2 6 18 92 e15xen initrd HP initrd 2 6 18 92 el5xen img read only root dev VolGroup00 LogVol100 append rhgb quiet 3 Reboot the server HP System Management Homepage Session Time out Error The default value of the ui timeout option in the HP SMH is 20 seconds For servers with numerous devices 80 CPUs for example the home or device pages may take more than 20 seconds to load and you may encounter a timeout message in your browser You can avoid this by setting the value of ui timeout to the maximum of 80 seconds using one of the following methods A NOTE The maximum value for ui timeout is 3600 seconds From the command
80. sired storage adapters are configured press ESC to return to the Main Menu Installing the OS and Updating the Server A 10 11 A NOTE If you have just configured a RAID volume then you must reboot the system so that it is detected Additionally on rx7620 and rx8620 servers you must run the search all command from the EFI shell before attempting to use this volume To launch the Smart Setup wizard from the Main Menu select Smart Setup and press Enter as shown in Figure 3 8 Figure 3 8 Select Smart Setup Smart Setup provides an introduction to the wizard NOTE To install Linux on a RAID volume or a Fibre Channel LUN you must first ensure that this storage is configured as described in the previous steps Select Next and press Enter to continue and display the next screen Smart Setup Page 1 Figure 3 9 is the firmware update screen which lists each system device its installed firmware version and the firmware version that is in the HP Insight Foundation Suite for Integrity with Linux you are using Figure 3 9 Page 1 Update Firmware Pp LBV Page 1 o 1 What firmware do you want to update Select the firmware devices you want to update Devices prefixed by cannot be updated in this program Press the SPACE har to display the location of the Release Notes document for the selected firmware Select all Deselect all System Firmware 1 36 BMC 1 39 Management Processor E 2
81. sole From the serial console you can access the EFI shell and the MP Use these utilities while installing and administering Linux on HP Integrity servers You can configure a serial console in two ways e Connect a PC to the MP serial port using a null modem cable e Connect a PC to the MP LAN port using a cats LAN cable On a system running Linux the SSH client is the native terminal emulator application On a system running Windows use a terminal emulator application such as PuTTY or HyperTerminal PuTTY is a free implementation of Telnet and SSH for 32 bit Linux and UNIX and it provides an xterm terminal emulator HP recommends that you use PuTTY version 0 57 or later which is available the HP Insight Foundation Suite for Integrity with Linux or from the PuTTY Download Page website http www chiark greenend org uk sgtatham putty download html To set up a serial console perform the following steps 1 Use a null modem cable to connect a PC to the MP serial port or to the serial console port for systems without MP or use a cat5 cable to connect a PC to the MP LAN port 2 If necessary install a terminal emulator and specify the following port settings Bits per second 9600 Data bits 8 Parity none Stop bits 1 Flow Control Xon Xoff 18 Preparing for Installation 3 Use the Keyboard Configuration Panel to map the Backspace character to Ctrl H 4 Boot the server 5 Run the terminal emulator and press E
82. t deliver increased control of enterprise resources OpenPegasus is installed on your HP Integrity system by default when WBEM providers or HP nPartitions commands are installed OpenPegasus is not installed as a standalone application OpenPegasus SDK is the software developers kit for the OpenPegasus product It provides the tools needed to develop Common Information Model CIM client applications and provides modules for OpenPegasus NOTE The OpenPegasus SDK is included with your Linux RHEL5 and SLES 10 OS distribution For your convenience the OpenPegasus SDK for RHEL and SLES 10 are found in the HP Support Pack software package in the following locations respectively distros rhel5 tog pegasus devel 2 7 1 17hp rhel5 ia64 rpm distros sles10 tog pegasus devel 2 7 1 17hp sles10 ia64 rpm You can download all current versions of OpenPegasus SDK from the Open Group website http www openpegasus org pr For more information see the HP WBEM Providers for Linux Installation Guide and Release Notes http docs hp com en 5991 6518 Small Footprint CIM Broker A The Small Footprint CIM Broker s fcb is a CIM server conforming to the CIM Operations over HTTP protocol It supports the HP SMX WBEM providers that were developed in conjunction with the Common Manageability Programming Interface CMPI The Small Footprint CIM Broker provides access to the HP SMX WBEM providers and is installed on your HP Integrity system by default when
83. t is displayed Figure 3 1 EFI Boot Manager Menu EFI Boot Manager ver 1 10 14 62 System Overview hp server rx2620 Serial US54987219 System Firmware 3 17 45131 BMC Version 3 48 MP Version E 3 15 Installed Memory 2648 MB CPU Logical Module CPUs Speed Status 6 1 1 6 GHz Active 1 1 1 6 GHz Active Boot Menu Red Hat Enterprise bati AS Core LAN Core LAN Gb B EFI Shell Built in N i i i i i i Drive Explorer i R i i i i i i tA un Offline Diagnostics and Boot Configuration System Configuration Security Configuration FE rs ae a os ee a Se ea ee et ee ee eee he Soe ee SSeS See and v to change option lt s gt Enter to select an option Internal Bootable DUD Using HP Smart Setup to Install the OS 23 E NOTE The entry Smart Setup EBSU if configured are not displayed in all EFI Boot Managers If this entry does not appear perform the steps detailed in Accessing the Removable Media Devices Using EFI page 20 3 The HP Smart Setup EBSU utility starts and displays the introduction screen Press Enter to accept the default selection and continue The Main Menu is displayed as shown in Figure 3 2 Figure 3 2 HP Smart Setup EBSU Main Menu onfigure Storage Adapters Sp NOTE If there are I O adapters installed on your system that Linux does not support the list of unsupported adapters is displayed In addition you are warned that you can conti
84. tall the Ob ccc vatesssacedes cp cacnesysed cats eebecger ces tenie iiri E nan siii iia rasek 23 Using the Linux Media to Install the OS i v5sics inn cists Wests dba osianay ealrv econ vas sbegs eats Sousnes ates ease oaau a nenetar aves eens 30 Updating the SSL Ver cise ee susasnanvenenasieveaseszerctess E RERE e aE T vvda tesa RA ey i EATE aA ERT E 31 Installing Updates fromm the We issue n scvcvshsrelonesietoisasay ecterettevsls rot tac teauteebaaeeDeeeasiuves Ea E 31 Registering for HP Support Notications cccscitonsses wicks hoete rt iatacers lett aieeskes le edteen maces tbeditengens 31 Installing the Fibre Channel HBA Drivers for Ux eis sis sceeetiset ste vtaneracotun sean ves seinasievies Gaetan dea ieeds 32 Installing the MPT Fusion HBA Drivers for Linx iscdecnscs csc Seas sot dans segues sedestassevecesiewteganssesiedtsveesnazseves 33 4 EFI and HP Smart Setup Media Utilities cccesesssseseseccssssssesesesesestsssseseeeseeteeeeeees 35 Using the Option ROM Configuration for Arrays DG lity c5csscicssseccees sack sdchceesersuevecesanesceet saviecenanaceess 35 Usmo EBT cite sesicaoaiease ice east ey ree eee ae oe ee ene 35 Table of Contents 3 EFL Boot Manag enrere e a a Aei a EEEa EEAS E EEE EAA econ AEO EEE EE ENERE Eea 35 PR SOM E E E E E A S EO A EOT 36 HP Smart Setup Vth tesore ea e EEEE EEA o iE vuitan ss whnapanyuesdeasnueeders SAATE 36 Accessing HP Smart Setup Wate cvavciscece tice ia ea oil a a e e aa a 36 5 Installing and Using
85. talled Memory 2648 MB CPU Logical Module CPUs Speed Status 6 1 1 6 GHz Active 1 1 1 6 GHz Active Boot Menu un Offline Diagnostics and Secteea eee ee nce noe mee ree spe ea d v to change option lt s gt Use Enter to select an option Available as a selection from the EFI Boot Manager the EFI Shell provides a command line interface from which you can get information about the system install an operating system boot the operating system execute batch scripts launch EFI applications load EFI drivers and manage files and system variables For Additional Information Use the following resources to obtain additional EFI information The Intel EFI website http developer intel com technology efi EFI Shell command help From the EFI Shell enter help or for a list of EFI shell commands HP Smart Setup Utilities Some of the options available from the HP Smart Setup EBSU utility main menu are not part of the steps required to prepare your system for Linux installation but such options can be used to customize diagnose problems or fine tune firmware settings Accessing HP Smart Setup Utilities To access the HP Smart Setup utilities 1 2 A Power on the server The server boots to the EFI utility Ensure that the removable media containing the HP Smart Setup EBSU utility you want to use is accessible For details see Accessing the Removable Media Devices Using EFI page
86. tup EBSU main menu to upgrade the adapters thus installing the EFI driver You can then proceed to use the Configure Storage function to set up your storage adapter Partitioning Fibre Channel HBA Adapters Creating a partition using EBSU or other partitioning tools can result in the duplication of the created partition in multiple LUNs Typically this happens when there are redundant paths to the same storage device For example when you have two paths A and B to a storage device then two blocks bound to the original LUN are created If you create a partition in the original LUN it will be mirrored in the duplicated blocks For more details regarding configuring LUNs see the HP StorageWorks Booting Windows Server 2003 for Itanium based systems from a storage area network application notes http h20000 www 2 hp com bc docs support SupportManual c00193929 c00193929 pdfF To configure the boot LUN see the Configuring the HBAs section in conjunction with the Cabling options for single channel HBAs section to create a zone boot environment with only one LUN mapped to the boot HBA Installing the MPT Fusion HBA Driver on RHEL 5U2 and RHEL 5U3 using a Xen Kernel Hangs the Server After the MPT Fusion HBA driver is installed on a system running RHEL 5U2 using a Xen kernel the server hangs during rebooting and the following messages are displayed 56 Known Issues ELILO boot Uncompressing Linux done Loading file HP
87. viding documentation that meets your needs Send any errors found suggestions for improvement or compliments to docsfeedback hp com Include the document title manufacturing part number and any comment error found or suggestion for improvement you have concerning this document 1 Planning the Installation Installing the Linux operating system OS on an HP Integrity server involves preparing the hardware for the OS installation installing the OS and updating the system with the latest OS patches This chapter helps you plan the installation based on the server model the OS edition the source of the OS media and your network environment Subsequent chapters guide you through the installation process Overview The HP Integrity server family based on the Intel Itanium processor supports Linux on a full range of server models This range includes entry level servers such as the 2 processor rx1620 mid range servers such as the rx7640 and rx8640 and the high end 128 processor Superdome Some servers such as the HP Superdome rx8640 and rx7640 servers are based on the HP Super Scalable Processor chipset sx1000 or sx2000 They are composed of basic building blocks known as cells These cell based servers can be set up as a single system or divided into multiple partitions where each partition is assigned memory processors and I O resources for its exclusive use Each partition can execute its own OS image Support
88. y disk and network utilization this discovery process has minimal impact on system performance The WBEM schema files for the HP Utilization Provider are installed at opt util mof For more information see utild 1M HP SmartSetup Scripting Toolkit The SmartSetup Scripting Toolkit SSTK enables you to deploy a large number of HP Integrity servers rapidly and efficiently Using SSTK you can develop custom scripts that simplify server deployments by automating various hardware configuration and software installation operations SSTK can set specific Extensible Firmware Interface EFI boot variables create disk partitions and tie into the standard unattended installation process to install the OS and selected applications SSTK is delivered as a tar file that is used to install and configure the product For more information see the Configuring the Repository section of the SmartSetup Scripting Toolkit Deployment Guide http www docs hp com en 5991 6250 HP SAS Integrated Raid IR Configuration Utility The Integrated Raid IR Configuration Utility cfggen is a Linux command line utility that configures the IR functionality of the HP Serial Attached SCSI SAS controllers that are used in LSI 1068 based HP SAS controllers This utility is a minimally interactive program that can be executed from the Linux prompt The result from invoking this utility is communicated to the environment through the program status value return
89. y with Linux in each of the supported OS distribution release Table D 1 lists the I O adapter part number by category a brief description of the part and the initial supported Linux distribution s including later updates or service packs Table D 1 Supported Products Matrix Part Description RHEL Support SLES Support Number 4 4U1 Fibre Channel 403619 HP BLc QLogic B21 QMH 2462 FC HBA Opt Kit A6826A PCI X Dual Channel 2Gb Fibre Channel HBA A7538A HP StorageWorks Linux Q2300 64 bit HBA A8002A HP FC2142SR 4GB PCI e HBA A8003A HP FC2242SR PCI e DC HBA AB379A HP PCI X 2 0 2Port 4Gb Fibre Channel HBA Qlogic AB379B HP PCI X 2 0 2Port 4Gb Fibre Channel HBA Qlogic AB429A 1 port 4Gb FC X X X X Qlogic AD167A 1 port 4Gb FC X X X X Emulex AD168A 2 port 4Gb FC X X X X Emulex AD300A 2 port 4Gb FC X X X X Qlogic PCI e AE311A 1 port 4Gb FC X X X X Qlogic PCI e IDE rx1600 Embedded I O for X rx2600 rx1600 rx2600 rx1620 Embedded I O for X X X rx2620 rx1620 cx2620 rx2620 cx2620 rx4640 Embedded I O for X X X rx4640 59 Table D 1 Supported Products Matrix continued Part Description RHEL Support SLES Support Number 4 4U1 LAN 447883 4 port GbE Mezz X X X X B21 A5506B PCI 4 Port X X X 100Base TX LAN Adapter A6794A SCSI amp LAN Core X X T O Procurium

Download Pdf Manuals

Related Search

Related Contents

USER MANUAL  SureCycler 8800 Setup and User`s Guide  NetLogo User's Guide - Centre de Recherches sur la Cognition  GUIDE PRATIQUE : Cnam Champagne  USER`S MANUAL - Sears PartsDirect  Quick Start Guide  

Copyright © All rights reserved. Failed to retrieve file