Home

Geovision GV-AS110

1. L O Reset Button _ 7 Reset Button Figure 5 14 102 5 GV AS400 Controller 5 3 3 Restoring Factory Defaults You can choose to restore only Basic Settings or All Settings to factory default values For the contents of Basic Setting see 8 1 Basic Settings To restore Basic Settings to factory defaults Press the Default button between the output 16 and RS 485 connectors for 3 seconds After this it may take up to 3 minutes to restore Basic Settings of GV AS400 to default factory values Default Button Figure 5 15 To restore All Settings to factory defaults 1 Remove the jumper cap from JP6 to JP7 2 Press the Reset button in the upper center of GV AS400 circuit board All input LEDs should light on 3 Remove the jumper cap from JP7 back to JP6 After above steps it may take up to 3 minutes to restore all settings to factory default values If GV ASKeypad is connected the message Memory Test on Keypad will appear indicating the default loading is in progress m Reset Button Figure
2. GV AS Controller l GV ASManager Note The Local DDNS Server can be Beene Menor installed in 1 GV ASManager OR 2 a separate computer Figure 8 4 146 E Installing on a Network Installing LocalDDNS Server To install the LocalDDNS Server in a computer download GV Local DDNS Service from http www geovision com tw english 5_ 8 AS asp under the Supplemental Utilities section Follow the on screen instructions to install the application After Installation the program will be minimized to the system tray Configuring Controller on LAN After running the LocalDDNS Server configure the controller on LAN 1 Open an Internet browser and type the default IP address https 192 168 0 100 The login dialog box Figure 8 2 appears In the User Name and Password fields type default value admin and admin respectively Click OK The Network Configuration page Figure 8 5 appears Click Enable and select Send to Local DDNS In the Server IP fields type the IP address of the LocalDDNS Server In the Device Name field keep the default setting or change it to match that of the GV ASManager L GeoVision Basic Setting e Network Setting e Other Setting e Firmware Update e Account Setting Advance Setting Function Setting Parameter Setting Status Monitor Card Information Time Setting In Out Function Extend Device e Extend Reader Network Configuration Machine Name Mach
3. ccccccccccecceeeceeceeseeeceeseeeceeceeeseeseeeseeeaeeeaes 30 1 4 Web Based Configurations ccccccceccsecceeceeeceeeeeeceeeeeeeeeeeeeceeeseeeeeeseeseeeseeseeeseees 31 1 5 GV AS100 1010 Specifications ec ceccecc eee eeeeeeeeeeeeceeceteeeeeeeeeeeeeseseeeeeteeeaes 32 2 GVA 110 T110 CONT ONGN wcsssaccossnsanrssennansedecrncexuanessnsantancenaueneeansenwawasencuswadeoane 34 Zh MAUPOCUG CHOI goatee cenccie tence ayee EE A E EE E E 35 ZN MIN FOA O S te saesetce e E E E E EE S 37 DTZ PACKING TENS Mosca tee coam sees ese tone cancers E r EEEa Ear 38 22 WS VAN ANON esee sete ecu eceusaune wedi ovecns E E E osnece ee once oenncsabssioesaesarcnaces 39 2 2 1 Connecting Card REAETSS ccccccccccsccseeceeeceeceeecueceeecsesaeecuecaeseeeseesaeesaes 41 2 2 1 A Wiegand Readers GV AS110 Only ccccceccecceeeceeceeeseeeeeeseeeeeeeeees 41 2 2 1 B Network Readers GV AS1110 Only eee cecceeec eee eeeeeeeeeseeeaeeneees 41 2 2 2 Connecting Input Devices ccc cec cece eecceeceeeceeceeeceeceeecuesaeecaeseeeseesaeesaes 42 2 2 3 Connecting Output DeVICES c cece cccceceseeceeeceeceeeceeceeeseesaueceeseeeseesaeesaes 43 22A GONMECUNG 10 NC PO cnnan E E E EEEN 45 2 2 4 A Connecting GV AS110 to PC ccecc cece eeeeeeceeeeeeceeeseeseeeseeseeeaeenees 45 2 2 4 B Connecting GV AS1110 to PC cecceccceeceeeeeeseeeeeeeeeeseeseeseeeseees 46 2 2 5 Connecting the POWER cisecaricdeadintedessadsevended
4. connecting it to the Door outputs Breakdown Voltage 250V AC 220V DC Continuous Load Current 1A 30V DC 0 3A 125V AC Note Absolute Maximum Ratings are those values beyond which damage to GV AS110 1110 circuit board may occur Continuous operation of GV AS110 at the absolute rating level may affect GV AS110 1110 s reliability 43 C GeoVision To connect an output device The example below illustrates the connection of a locking device to GV AS110 1110 Connect the point on the locking device to the Door COM wire on GV AS110 1110 connect the two points of the locking device and the external power supply together and connect the point on the external power supply to the Door NO or Door NC wire on GV AS110 1110 based on the state of the locking device 44 4 D o m GV AS110 1110 External Power Supply Locking Device Door NO Door NC Door COM Figure 2 8 GV AS110 1110 Controller 2 2 4 Connecting to the PC Connecting GV AS110 1110 to a computer allows you to access its Web interface and connect it to GV ASManager if the computer is installed with GV ASManager The computer running GV ASManager software can be used to monitor the access information and alarm messages from the controller The communication link between the computer and GV AS110 1110 is as below GV AS110 RS 485 connection or network connection e RS 485 connectio
5. GeoUision The Vision of Security GV AS EV Controller User s Manual Before attempting to connect or operate this product please read these instructions carefully and save this manual for future use a GeoVision 2014 GeoVision Inc All rights reserved Under the copyright laws this manual may not be copied in whole or in part without the written consent of GeoVision Every effort has been made to ensure that the information in this manual is accurate GeoVision Inc makes no expressed or implied warranty of any kind and assumes no responsibility for errors or omissions No liability is assumed for incidental or consequential damages arising from the use of the information or products contained herein Features and specifications are subject to change without notice GeoVision Inc 9F No 246 Sec 1 Neihu Rd Neihu District Taipei Taiwan Tel 886 2 8797 8377 Fax 886 2 8797 8335 http www geovision com tw Trademarks used in this manual GeoVision the GeoVision logo and GV series products are trademarks of GeoVision Inc Windows and Windows XP are registered trademarks of Microsoft Corporation December 2014 Contents WECOME iraa viii Important Notes for Maintaining Power Supply cccccsesseeseeeeseeeeeeeeeseeeeees IX Elevator Control ccccccceccceeceeeeneceeeeneeeeeeeseneeeesensenscneeeesoneeaesenseneseasonseeesensenesensones Xi Optional Devices cts eats
6. 7 2 3 Connecting Backup Battery Using the supplied battery cable you can connect any battery of 12V 12Ah to GV EV48 to provide backup power when the main power supply fails When the main power supply is removed and the battery voltage level is above 10 2V the Discharging LED will light and the battery will support normal operation of the GV EV48 Battery 12V 12Ah Charging Discharging Power Figure 7 4 7 2 4 Connecting the Power You can connect GV EV48 to power directly using the supplied 12V DC adaptor After power is connected the power LED on GV EV48 should glow Note Power should only be applied to the unit when all connections are completed and tested Web Setting i OFF DC12V EE on Micro SD Ethernet 12V DC 3A power adaptor Power Source Figure 7 5 136 GV EV48 Controller 7 2 9 Connecting the PC Connecting GV EV48 to a computer allows you to access its Web interface and connects it to GV ASManager if the computer is installed with GV ASManager The computer running GV ASManager software can be used to monitor access information from GV EV48 If connection with GV ASManager is interrupted GV EV48 stores this information on the supplied micro SD card The data stored will be sent to GV ASManager when connection resumes Web Setting DC12V EE au Micro SD Ethernet Network A AAAA BADOAOAOADOADOD
7. The LCD displays Enter Del Card 5 You can either press the card number or present the card to the unit The LCD displays Delete 1 Yes 2 No 6 Press 1 to save and exit GV AS1010 1 Present the Delete Card and enter its PIN code The LCD displays Enter Del Card 2 Youcan either press the card number or present the card to the unit The LCD displays Delete 1 Yes 2 No 3 Press 1 to save and exit 1 3 3 Resetting the APB Function You can reset the anti passback APB function of a card to allow a user to re access the entry or exit reader 1 Press the code 227 x CAR 2 Present the Master Card or Enroll Delete Card and enter its PIN code The LCD displays Add New Card 3 Press 0 several times The LCD displays Reset Card s APB 4 Press The LCD displays Enter Card 5 You can either press the card number or present the card to the unit The LCD displays Reset 1 Yes 2 No 6 Press 1 to save and exit 25 C GeoVision 1 3 4 Accessing the Security Mode The security mode is used to arm GV AS100 1010 In the arm mode no cards can be granted access and no one can program the unit Only the security card that is associated with a PIN code can be used to disarm the unit 1 3 4 A Enabling the Security Mode Before you can access the security mode you need to create a security card first 1 To create a security card follow the steps 1 to 4 in 1 3 2 A Adding a Card select 4 S as car
8. C GeoVision 9 3 Extended Device You can define the GV Readers and GV GF Fingerprint Readers connected to GV AS GV EV Controller through RS 485 or network connection For GV AS400 you can set up the GV I O Box connected Note GV I O Box is only supported for GV AS400 1 2 The Tailgating Setting page is currently not functional 9 3 1 Extended Reader In the left menu click Extended Reader This page appears 186 Extended Reader Configuration GV Reader CR420 GF1921 GF1922 Function RS485 Serial Number Connection Status 0013E2010203 Door Gate 1 Entry 7 S 5 4 No Function 4 No Function 00713E2010208 Door Gate 2 Entry QO14E2013204 Door Gate 5 Entry IDs No Funct Del Ne Function O w7 NoFuet 4 k o Read Mode Read UID GeoFinger Server IP Address 192 168 E from 1025 to 65535 GF1901 GF1902 GF1911 GF1912 Function R5485 Serial Number Function Connection Status 3603490001 Door Gate 3 Entry No Function ka No Function No Funct Oo o i No Funct 4 No Function lt No Function m M N k No Function Figure 9 27 9 The Web Interface GV Reader CR420 GF1921 1922 Function Define the readers connected to the controller and then use the Function drop down list to select the door associated with the reader e GV RK1352 R1352 DFR1352 Select the RS 485 checkbox and type the
9. Control Type Door Entry Control Authentication Mode Card PIN Code Mode Setup GO Figure 3 7 2 Select the COM port that is connected to GV AS120 and click Open COM The red square next to the COM port box should change to blue to indicate the COM port is correct Note To verify the COM port that is connected to GV AS120 go to Windows Device Manager In the Ports COM amp LPT field you should see the entry for Prolific USB to Serial Comm Port The COM port shown in parenthesis indicates the COM number currently in use Ports COM amp LPT F Communications Port COM1 af ECP Printer Port LPT1 Prolific USB to Serial Comm Pork TOM 3 Select an ID number for the GV AS120 Use the drop down list to define the Control Type and Authentication Mode Refer to Door Gate Function and Set Authentication Mode in 2 3 2 Programming the GV AS110 for more details on each type of Control Type and Authentication Mode 5 Click Setup GO The settings are sent to GV AS120 67 C GeoVision 3 2 4 B Network Connection The figure below illustrates the network connection to the computer For this connection a GV ASBox or GV ASNet is required P eae GV ASBox Network GV ASNet Power In l GV AS120 Figure 3 8 Connect two power wires and two RS 485 wires from GV AS120 to GV ASBox GV ASNet The table below shows the wire as
10. Local Time Displays the current date and time of GV AS100 110 120 Time Zone Displays the current time zone of GV AS100 110 120 Local Time m Disable Disable the manual configuration of time and date m Setup Enable the manual configuration of Time Zone Date and Time for GV AS100 110 120 Daylight Savings Time DST m Disable Disable the manual configuration of DST m Time Zone Enable the manual configuration of DST by setting the Start Time and Stop Time for the DST period Click Submit button to save the changes or click Cancel button to return the changes to its previous state 220 10 Optional Devices 10 3 2 F In Out Function In the left menu click In Out Function to define the input and output sensors Note The I O Configuration page is only available when connecting through a GV ASBox ASBOX IO Configuration GeoVision Input Function Basic Setting ASBOX Input 1 Door A Tamper Zone M e Other Setting ASBOX Input 3 Door A Door Contact v e Firmware Update P Bal e Account Setting ASBOX Input 4 Normal Input x Disable Latch p Advance Setting ASBOX Input 5 Normal Input mi Disable Latch p Function Setting ASBOX Input 6 Normal Input Disable Latch Parameter Setting z ER Status Monitor ASBOX Input 7 Normal Input xi Disable Latch p Card Information ASBOX Input 8 Normal Input i Disable Latch p Time Setting Output Function Extend
11. Rermlnal SSEEEEch kekkei C zelel BAT Sey yes o EELEER Dis Charging C Charging E Power Figure 6 1 115 C GeoVision 6 2 Installation 6 2 1 Connecting Card Readers GV AS410 4110 810 8110 supports two types of card reader interfaces e Wiegand Compatible with any Wiegand card readers of 26 to 64 bits e RS 485 Only compatible with all GV Readers and GV GF Fingerprint Readers 6 2 1 A Wiegand Readers GV AS410 4110 810 8110 provides 8 Wiegand inputs Wiegand A to Wiegand H Connect up to 8 Wiegand readers ranging from 26 to 64 bits to the Wiegand interfaces Please consult the documentation of your Wiegand reader for wiring Wiegand_H Wiegand_F Wiegand_D Wiegand_B BERBERA lelkek lt gt o lt gt o lt gt o lt 10 Wiegand_G Wiegand_ E Wiegand_C Wiegand_ a Connect to Wiegand compatible readers Figure 6 2 Note Although 8 Wiegand inputs are available GV AS410 4110 only supports control of up to 4 doors 116 6 GV AS410 4110 810 8110 Controller 6 2 1 B RS 485 Readers For long distance connection and non Wiegand card readers you can connect RS 485 connection with any GV Readers and GV GF Fingerprint Readers Up to 8 readers can be connected together with a single RS 485 cable to the RS 485 interface on GV AS410 4110 810 8110 When multiple readers are connected together an extra power supply to each unit is required Use 12V power output and
12. cannot be used as the first character 3 Inthe Password filed type a password Passwords are case sensitive and must be at least 6 characters Type the password again in the Re type Password field for confirmation 4 Inthe Word Verification section type the characters or numbers shown in the box For example type 8UCY in the required field Word Verification is not case sensitive 5 Click the Send button When the registration is complete this page will appear The Hostname is the domain name consisting of the registered username and dipmap com e g somerset01 dipmap com http ns dipmap com register aspx Microsoft Internet Explorer SEE File Edit view Favorites Tools Help 4 Q peck Q x a A Search 5 Favorites 2 E 3 Address G http ns dipmap comfregister aspx v Go Links e Username somerset01 e Hostname somersetO1 dipmap com e IP Address 59 115 135 40 e Your hostname will be activated in 2 minutes e Your hostname will be deleted f you don t update your host address for 30 days Done Internet Figure 8 9 Note The registered username will be invalid when it is not used for one month 150 E Installing on a Network Configuring the GV AS GV EV Controller on Internet After acquiring a domain name from the DDNS Server you need to configure the registered domain name on the controller to access the controller by the domain name on Internet 1 Ope
13. 10 2 4 C Connecting Backup Battery ccc cecccccceeceeeseeceeeseeeeeeeeeseeeaeeeees 206 10 2 4 D Other Settings c cc eccccccecceeceeceeeceeceeeseeseeeceeseeeseeeaeeseeseeeseeeaeeees 207 10 2 4 D a Web Setting SWItCN cc eccccccecceeeseeseeeeeeseeeeeeseeeeeesees 207 10 2 4 D b Restoring Factory Defaults cc ccccccecceeeeeeeeeseeeeeeeeees 207 vi 10 2 4 DC Power Status LED wince eee el ee ee oe 207 10 2 5 GV ASNet Specifications ccscccccscceccessessussessursussussasceseceecessursursarsasess 208 10 3 Web Interface through Optional Devices cece cecccecceeeceeeeeeceeeeeeceeeeeeeeeaeeees 209 103 1 Basic SOUING sre uensenassetied catedeceasseeadaad ue testesuehodeanne te 209 103 2 Advanced SCUUING Sinss gure tues asia rede woen ated sbewutetiotautatoes tat eeausedneler eae 210 10 32 A FPUNEHON SEMING saccccscetscarstie ce beasta a a odaciaeh 211 1023 2 B Parameter Selaras E S 214 1032C Stat s MONIO ern a E ee dae scan 218 10 32 D Card NOMAN neneiia a 219 10 32 E TMe S SUING enra a a a 220 1S2 F MAF OUT FUNCION zin RE ERE O ERE ERES 221 10 3 2 G Extended Reader sexe scscsse acyenedeateetoee save deduestadednated idwatecQeveas aacedexeecives 228 TI PROUDICSNOOGUIAG e 230 APDENGIX uria a nents 236 A GV MountA900 for GV AS110 1110 Optional cc eeeceeeseeeeeeeeeeeeeeeeeeeeeeens 23 vii GeoVision Welcome This user manual includes th
14. Alarr COM ore Be fom REF iw _ er ie 88 por a Le ee Figure 2 5 39 Q GeoVision scinn GV AS1110 Ovi OV2 C GeoVision a 666666666666 Electric Wire pa poe Definition 7 5V 12V DC FE CE KX 2014 GeoVision Inc All rights reserved All GeoVision Products are made in Taiwan GV AS1110 Figure 2 6 40 GV AS110 1110 Controller 2 2 1 Connecting Card Readers 2 2 1 4 Wiegand Readers GV AS110 Only GV AS110 provides one Wiegand input for connection to the Wiegand reader ranging from 26 to 64 bits Through the GV AS110 keypad you can set the Wiegand reader as the entry or exit reader To define the reader see the Door Gate Function option in 2 3 2 Programming the GV AS110 1110 Note Wiegand connection is not supported for GV AS1110 The table below shows the wire assignments of the Wiegand input on GV AS110 Please consult the documentation of your Wiegand reader for wiring You will need to set up a separate power source to power the Wiegand reader Wiegand Data 0 Wiegand Date 1 2 2 1 B Network Readers GV AS1110 Only GV AS1110 supports network port for network connection with GV CR420 and GV GF 1921 1922 Through the GV AS1110 keypad you can set the network reader as the entry or exit reader To define the reader see the Door Gate Function option in 2 3 2 Programming the GV AS110 1110 Note 1 Network connection with reader is not supported fo
15. Electric Lock 2 Een fu Figure 10 26 Below is the explanation based on the numbers marked on the above figure 1 ASBOX Output Edit the name of the Output 2 Output Type Configure the output type Options available for the output type change based on your settings of Door Gate A and Door Gate B in the Function Setting page Figure 10 15 3 Output Function Configure the output function Options available for the output function change based on your setting of Output Type above e When Door Entry Exit Control is selected in the Function Setting page Figure 10 15 these Output Type and Output Function become available Door Electric Lock Output is triggered when the card is presented to open the locking device Alarm Event Output is triggered when the defined alarm events occur Entry Card Output is triggered when the card is presented to enter the door Exit Card Output is triggered when the card is presented to exit the door 224 10 Optional Devices e When Parking Entry Exit Control is selected in the Function Setting page Figure 10 15 these Output Type and Output Function become available Electric Lock See the same function above Alarm Event Entry Card Output is triggered when the card is presented to enter the parking gate Exit Card Output is triggered when the card is presented to exit the parking gate e When Elevator Control is selected in the Function Setting page Figure 10 15 these Ou
16. To enable connection to PC on GV AS100 Switch 1 must be turned on See 1 2 4 C Switches FEB Gv as100 1010 Controller 1 2 4 A Connecting GV AS100 to PC RS 485 Connection between GV AS100 and PC The figure below illustrates the RS 485 connection to the computer For this connection a RS 485 to RS 232 converter between GV AS100 and the computer is required You can use GV accessories such as GV Hub GV COM and GV NET IO Card as the RS 485 RS 232 converter GV HUB GV COM GV AS100 GV NET IO Card Figure 1 10 The table shows the pin assignments of related RS 485 connectors on GV AS100 Pin Function 4 RS 485 A Note When connecting multiple GV AS100 through RS 485 connection you can use the keypad on GV AS100 to program every unit s ID See 1 3 5 Setting Parameters 15 C GeoVision Network Connection between GV AS100 and PC The figure below illustrates the network connection to the computer For this connection the optional product GV ASBox or GV ASNet is required GV ASBox Network GV ASNet 7777777777777777 Power In GV AS100 Figure 1 11 Connect two power wires and two RS 485 wires from GV ASBox GV ASNet to GV AS100 The table below shows the pin assignments of related connectors on GV AS100 Pin Funcion Pin Function Also see 9 1 4 A Connecting GV AS100 110 120 1 2 4 B Connecting GV AS1010 to PC The figure below illustra
17. connect the two points of the output device and the external power supply together and connect the point on the external power supply to the NO or NC of GV AS400 based on the state of the output device External Power Output Device Figure 5 6 5 2 3 B Outputs 9 16 Outputs 9 16 only accept the power from GV AS400 circuit board Check if your output device meets the following absolute maximum ratings before connecting it to any of outputs 9 16 Breakdown Voltage 350V DC AC Continuous Load Current 130mA Power Dissipation 500mW Note Absolute Maximum Ratings are those values beyond which damage to GV AS400 circuit board may occur Continuous operation of GV AS400 at the absolute rating level may affect GV AS400 reliability WANRING Do not connect any external power supply to outputs 9 16 otherwise damage to GV AS400 circuit board may occur 96 5 GV AS400 Controller If your card readers are equipped with LED or beeper that can be controlled externally connect the control wires to outputs 9 16 The following figure and table shows how to connect the beeper wire of GV Reader to GV AS400 ha SS GeoVision Electric Wires on GV Reader Yellow Beeper Black GND The SW1 on GV Reader must be turned OFF so that the beeper can be controlled by GV AS400 97 C GeoVision 5 2 4 Connecting the Power There are two ways to connect GV AS400 to power using GV AS Power Board or
18. each unit NO5 CN COMS5 mo C NC5 LJ NO6 2 3 COM6 A a NC6 ao NO7 is CON7 NC7 NO8 CON8 NC8 12V Auxiliary TY one Connects to GV GF ae ate Fingerprint Readers Figure 10 3 To define each GV Reader and GV GF Fingerprint Reader you need to use the GV AS100 GV AS110 GV AS120 Web interface See 10 3 2 G Extended Reader Setting Note The RS 485 connector on GV ASBox is only designed for the connection of GV Readers and GV GF Fingerprint Readers 195 C GeoVision 10 1 4 D Connecting Input Devices GV ASBox provides 8 inputs DI1 to DI8 All inputs are dry contact and can be configured as normally open NO or normally closed NC through the Web interface The default value is NO The figure below shows the pin assignments of input connectors on GV ASBox The 8 inputs are divided into two terminals Terminal A consists of DI1 to DI4 and terminal B includes DI5 to DI8 Every terminal has two COM Common points connect the Common wire to any of the two COM points on the related terminal O00 JJJ NOURA O N O LIC Woy GIG g wot O 3 UJ yv wog Figure 10 4 V 196 10 Optional Devices 10 1 4 E Connecting Output Devices GV ASBox provides 8 outputs and 2 auxiliary power outputs of 12V DC The outputs are divided into two groups outputs 1 4 and outputs 5 8 Before connecting make sure if your output device meets any of the two dif
19. power and reconnect it to power If the year is still shown as 1999 or 2000 the controller battery needs to be replaced When this occurs connect the controller to a backup battery and maintain connection with GV ASManager at all times When connected to GV ASManager the controller s time will be synchronized with GV ASManager s time Elevator Control GV AS GV EV Controllers provide two types of elevator control For GV AS100 1010 110 1110 120 210 2110 400 410 4110 810 8110 the GV AS Controller can control access to the elevator call buttons Users who present the correct identification card to the elevator reader will be able to use the elevator and can go any floors The output relays are connected to the call button of the elevator For GV EV48 a controller especially designed for elevator control access can be granted to specific floors You can configure each identification card to specify the floors it can access In this type of elevator control each output relay is connected to the button of corresponding floor in the elevator control panel Xi C GeoVision Optional Devices Optional devices can expand the capabilities and versatilities of your GV AS GV EV Controllers Consult your sales representative for more information GV ASKeypad with LCD display is a hot swapping device giving you convenience to configure GV AS400 GV Reader 1251 is a card reader that uses a 125 kHz frequency I
20. 1 1 Main Features e Grant access to specific elevator floors using access cards card s PIN code or fingerprints e GV EV48 24 Floors Built in 24 relay outputs to support up to 24 elevator floors e GV EV48 48 Floors Built in 48 relay outputs to support up to 48 elevator floors e Support up to 2 GV Readers GV GF Fingerprint Readers through network connection and RS 485 connection 7 1 2 Packing List e GV EV48 24 Floors 48 Floors e Power Adaptor 12V DC 3A e Power Cord e Battery Cable e Micro SD Card 2 GB 132 GV EV48 Controller 7 1 3 GV EV48 Board Layout Not Functional for GV EV48 24 Floors TLL Rec TTT Steet CCE EENE Termina R amp 485 Resistor Charging Discharging Red Power Q GeoVision GV EV4 JZINO SZIN aZINO 9ZINO RCI Z ZIG WOAD W092 LEINO 6Z1NO ZEINO OETNO LA LE OEZ WOAD W092 GEINO J EEINO 9EINO PELNO 9EIGE VEEE WOAD WO9 OVIGE 8E WOAD WO9 vrINO z7iIno Prier Zrile NO9 W092 J7INO SVINO EvINO LEINO 8rINO 97INO Qb 7 ObIGT IWOD WOOD Q GeoVision GV EV48 o O Z fa e O kej a oa Q H Jopp uuop p1e0g Ol CON3 Reset Ethernet Web Setting Wl OFF DC12V Micro SD Ethernet GGILG PZIEZ IWOD WOD ZOINO EZIN LZINOJEZINO RLY L OCI6L WOD WOD RBLINO OZINO JLINO JBLINO GIL VIE WO9 WO9 NO9 INOD WO9 INOD NON NOJ VV BLL ad SET
21. 2 Duress Held Open e Caeser Fire Zone A Electric Lock A Firmware Update ASBOX Input 3 ASBOX Output 1 Account Setting AS100 Input 3 General Alarm A Advance Setting Tamper Zone A ASBOX Output 3 Function Setting ASBOX Input 4 7 Lighting Parameter Setting AS100 Input 4 Tre ASBOX Output 5 Status Monitor Normal Input Normal Output Card Information ASBOX Input 1 ASBOs Output 6 Basic Setting Network Setting Time Setting ASBOX Input 2 UFE Normal Output In Out Function AS BOX Input 5 UFE ASBOX Output 7 j ABO Input 6 Extend Device H Normal Output Extend Reader ASEOA Input 7 ASBOX Output 8 ABO Input 6 Figure 10 20 Control Mode will change depending on the chosen Door Gate s Authentication Mode in the Function Setting page Figure 10 15 The listed number of outputs will change depending on the chosen Output Type in the In Out Function page Figure 10 23 ON Indicates the current input output device is triggered UEH Indicates the current input output source is not triggered Indicates the current event is triggered e Indicates the current light is on e Indicates the current light is off Note Outputs must be turned on in the In Out Function page to be monitored here 218 10 Optional Devices 10 3 2 D Card Information In the left menu click Card Information This Card Configuration page appears Card Configuration GeoVision Card Database Basic Setting Number o
22. 30V DC Continuous Load Current 5A NO 3A NC Note Absolute Maximum Ratings are those values beyond which damage to GV AS100 circuit board may occur Continuous operation of GV AS100 at the absolute rating level may affect GV AS100 reliability EJ Gv as100 1010 Controller To connect an output device The example below illustrates the connection of a locking device to GV AS100 1010 Connect the point on the locking device to the Door COM on GV AS100 1010 connect the two points of the locking device and the external power supply together and connect the point on the external power supply to the Door NO or Door NC on GV AS100 1010 based on the state of the locking device External Power Supply GV AS100 External Power Supply Door NC th aineena 2 Door NO 3 Door COM GV AS1010 Figure 1 9 13 C GeoVision 1 2 4 Connecting the PC Connecting GV AS110 1110 to a computer allows you to access its Web interface and connect it to GV ASManager if the computer is installed with GV ASManager GV ASManager software can monitor the access information and alarm messages from GV AS100 1010 The communication link between the computer and GV AS100 1010 is as below GV AS100 RS 485 connection or network connection e RS 485 connection a RS 485 to RS 232 converter is required e Network connection an optional GV ASBox or GV ASNet is required GV AS1010 Network connection IMPORTANT
23. 5 16 103 C GeoVision 5 4 The Web Interface You can install GV AS400 on a network and configure GV AS400 through its Web interface Refer to Chapter 8 Installing on a Network for detailed instructions on setting up a fixed or dynamic IP address to access GV AS400 Refer to Chapter 9 The Web Interface for details on the setup pages of the Web interface Through the Web interface you can configure general settings input output devices associated doors gates and connected readers 104 5 GV AS400 Controller 5 5 Optional GV ASKeypad GV ASKeypad is an optional device for an administrator to control and manage GV AS400 An administrator can carry GV ASKeypad around to access GV AS400 installed at different locations Features e 2 Lines x 16 English Characters e 4x4 Keys 5 5 1 Installation 1 Flip both clips of the 26 pin connector on GV AS400 2 Using the supplied 26 pin ribbon cable connect GV ASKeypad to GV AS400 26 Pin Ribbon Cable GV ASKeypacd Figure 5 17 Note GV ASKeypad is a hot swapping product You can plug or unplug the 26 pin ribbon cable while GV AS400 is operating 105 C GeoVision 5 5 2 Operation GV ASKeypad allows you to configure basic settings and view system information Press the following codes on the keypad to start operating ooo Pali 4 738 Sets parameters 347 Displays system information 737 Restores the Advanced Settings of GV AS400 to factory defaults
24. 5 7 GV AS400 Specifications 1 RS 485 interface only for GV Readers and GV GF Fingerprint Readers max 8 readers 8 relay outputs 30V DC 3A 110V AC 250V AC 3A 10 90 RH non condensing 750 g 1 65 Ib CE FCC RoHS All specifications are subject to change without notice 112 6 GV AS410 4110 810 8110 Controller C GeoVision 6 1 Introduction 6 1 1 Main Features e One way control GV AS410 4110 4 doors GV AS810 8110 8 doors e Two way control GV AS410 4110 4 doors GV AS810 8110 4 doors by Wiegand only 8 doors by Wiegand RS 485 Network e Support 8 Wiegand card readers of 26 to 64 bits e Support 8 GV Readers GV GF Fingerprint Readers through RS485 connection Network e Built in 16 digital inputs and 24 relay outputs e Suitable for door parking and elevator access control e Support for tampering alarm 6 1 2 Packing List e GV AS410 4110 810 8110 e GV AS410 4110 Power Adaptor 12V DC 3 5A GV AS810 8110 Power Adaptor 12V DC 5A e Power Cord e Battery Cable e Micro SD Card 2 GB 114 6 GV AS410 4110 810 8110 Controller 6 1 3 GV AS410 4110 810 8110 Board Layout OUT1 OUT1z OUT12 OUT14 OUT1E OUT1E O Q O O O O ZO2Z2202 202202 202202 lt FOOTY basee A E Thee LLLE _ O Jiii e nooo Cntr ele 14 GeoVision Reset GV AS410 4110 810 8110 r g Load Defauli ON OFF eevee Enable aa BOBEREEH AGBAAGBA Feiner EN R
25. 8110 Controller Connect the ED pins to the and points on the output device ex electric lock GV AS410 4110 810 8110 ED ED COM NC NO ED ED COM NC NO Figure 6 14 When all connections are completed connect the power supply to a 110 120V power Source Note 1 The power supply of GV AS410 4110 810 8110 Kit comes in US standard and EU standard Make sure the device is connected with a voltage within its voltage range You can place a backup battery in the supplied battery casing and connect the backup battery to the GV AS410 4110 810 8110 board Refer to 6 2 4 Connecting Backup Battery for details 127 GeoVision 6 4 4 GV AS410 4110 810 8110 Kit Specifications Power Adapter Board Power Supply 110 120V 50 Hz 60 Hz 200 240V 50 Hz 60 Hz 420 x 300 x 110 mm 16 5 x 11 8 x 4 33 in GV AS410 4110 810 8110 Kit 4 4 kg 9 68 Ib 128 6 GV AS410 4110 810 8110 Controller 6 5 The Web Interface You can install GV AS410 4110 810 8110 on a network and configure GV AS410 4110 810 8110 through its Web interface Refer to Chapter 8 Installing on a Network for detailed instructions on setting up a fixed or dynamic IP address to access GV AS410 4110 810 8110 Refer to Chapter 9 The Web Interface for details on the setup pages of the Web interface Through the Web interface you can configure gener
26. APB Display System Door sAuthMode G O Doors Event Jo ooo Memory s State ID amp IPAddress G O Display Version S S Set Parameter Set Local Time Set AS1010 ID Set AS1010 IP Set Auth Mode Auth Schedule Fixed Card Mode Fixed Card PIN Fixed Card Common Local Unlock Mode Local Lock Mode AS1010 Function Anti Passback Anti Passback Anti Passback Anti Passback Door Entry Type Door Exit Type Parking Entry Type Parking Exit Type Elevator Control Enroll Pin Change Delete Pin Change Local Rest Time Set Held Open Time Set Alarm Event Held Open Alarm Force Open Alarm Fire Alarm Tamper Alarm Access Denied Tailgating Alarm Set Fire Action Unlock Door Gate Lock Door Gate Unchanged Set Contact Type Door Car Sensor Door Gate Button Fire Sensor Set Function Key m Q Set F1 ork Time Start Work Time End pf Set F2 Away Start Away End sf Set F Overtime Start Overtime End Set F 4 Break Time Start Break Time End Note Tailgating alarm function is currently not functional 23 C GeoVision 1 3 2 Adding and Deleting a Card Note 1 GV ASManager cannot manage the cards enrolled on GV AS100 1010 since the card data will not be transmitted to GV ASManager 2 The cards added through GV ASManager cannot be deleted on GV AS100 1010 1 3 2 A Adding a Card Up to 1 000 cards can be enrolled on GV AS100 1010 directly without additional software Wh
27. Entry Exit Control is selected in the Function Setting page Figure 10 15 these Input Type and Input Function become available Normal Input Enable Latch The Normal Input is used for a normal Disable batch detection mode in which the input is set to trigger an output Instead of constant output alarm in N O and N C the Enable Latch option provides a momentary alarm when triggered Door Aor B Fire Zone Depending on the type of sensor and the location where it is installed select the best Input Function name to fit the sensor Exit Button description When the sensor is activated an Door Contact alarm event occurs and the alarm device can be triggered For alarm events see Alarm 9 3 2 B Parameter Setting For example when the Door Contact sensor detects unauthorized access a Force Open event occurs and it can trigger the Force Open alarm Tamper Zone e When Parking Entry Exit Control is selected in the Function Setting page Figure 10 15 these Input Type and Input Function become available Normal Input Enable Latch See the same Input Type above Disable Latch Gate AorB Fire Zone See the Doo A or Door B Input Type above Tamper Zone For example when the Car Detection sensor detects any car driving by a Parking Entry Exit Butt a or Parking Exit event occurs and the parking Car Detection gate will respond the event accordingly 222 10 Optional Devices e When Elevator C
28. GND on the power terminal or the Wiegand connectors to power on each unit J37 J35 RS485 B Not funct a Ww Cc wT p Term Resistor 5 a C C C B B Not functional Connect each reader to the t power terminal or Wiegand encomonaanarens connectors for power supply Up to 8 GV Readers and GV GF Fingerprint Readers Figure 6 3 117 C GeoVision Note 1 118 Each set of 12V power output and GND can provide power for up to 2 readers The 3 sets on the power terminal can support up to 6 readers If you wish to connect more readers and the Wiegand interfaces are already occupied you can connect the readers to external power source By default a jumper cap is installed on the RS485_A Terminal Resister J37 to ensure stability when the RS 485 connection between GV AS410 4110 810 8110 and the reader is over 600 meters RS485_B Terminal Resister J35 is not functional Although up to 8 RS 485 readers can be connected GV AS410 4110 only supports control of up to 4 doors 6 GV AS410 4110 810 8110 Controller 6 2 2 Connecting Input Devices Up to 16 input devices can be connected to GV AS410 4110 810 8110 Connect the input wires to IN1 16 and connect GND wires to GND Multiple GND wires can be connected to the same GND pin All inputs are dry contact that can be configured as normally open NO or normally closed NC on the Web interface
29. GV ASManager Fixed Card Common mode Grants access after the user presents the card or enters the door s password and ignores the authentication schedule of GV ASManager Authentication Schedule Mode Follows the authentication schedule set on GV ASManager Door Gate B This option is only available for GV ASBox and only becomes available after Door Gate B is selected from the ASBox Wiegand option above Select the function type and authentication mode for the use of Door Gate B The Function and Authentication Mode options are the same as those of Door Gate A But remember that the settings here are used to define the Wiegand reader connected to GV ASBox Anti Passback This setting lets you perform Anti Passback applications across multiple GV AS Controllers Anti Passback prevents use of a card to gain successive entries without exit to a controlled area For details on setup see Chapter 6 Anti Passback on GV ASManager User s Manual m Enable Disable Enables or disables the Anti Passback function m Info IP Enter the IP address of the next corresponding GV AS100 110 120 Delete MasterCard Delete Click the Delete button to delete the current MasterCard information Click Submit button to save the changes or click Cancel button to return the changes to its previous state 213 C GeoVision 10 3 2 B Parameter Setting In the left menu click Parameter Setting This AS100 AS110 AS120 Confi
30. GV AS1010 Note Cards complying with ISO 14443A standard for smart card technology can be formatted as Master Card Enroll Card or Delete Card Only one Master Card can be created To create a Master Card for GV AS100 1 Power on the unit The LCD displays Enter Master Card 2 Present a card to be the Master Card The LCD displays Master PIN Code 1234 3 Keep the default PIN code as 1234 and press The LCD displays Succeed Alternatively you can press any four digits on the keypad to change the default value The double confirmation of the new PIN code is required After this the LCD should display the message of success After the Master Card is created GV AS100 will run a self test and display the message Master Memory Test After it is finished you can see the message of GV AS100 online or offline followed by a date and time Then you can start programming GV AS100 To create a Enroll Card and a Delete Card for GV AS1010 1 Power on the unit The LED flashes blue 2 Present a card to be the Enroll Card 3 Present a card to be the Delete Card After 1 to 2 minutes the LED should be a constant blue light to indicate READY 20 FE Gv as100 1010 Controller The table below shows the codes to start various programming and display system information 227 CAR Accesses the Card Manager function 276 x ARM Accesses Security Mode x 347 DIS Displays system information 738 SET Acces
31. Readers GV AS100 Only GV AS100 provides one Wiegand input for connection of the Wiegand reader ranging from 26 to 64 bits Through the GV AS100 keypad you can set the Wiegand reader as the entry or exit reader To define the reader see the AS100 Function option in 7 3 5 Setting Parameters Note Wiegand connection is not supported for GV AS1010 The table below shows the pin assignments of the Wiegand input on GV AS100 Please consult the documentation of your Wiegand reader for wiring in Function fe Wesana Data 9 12V Power Supply 1o FEB Gv as100 1010 Controller 1 2 1 B RS485 Readers For long distance connection and non Wiegand card readers you can establish RS 485 connection with any GV Readers and GV GF1911 1912 GV AS100 can connect with 1 reader through RS 485 connection GV AS1010 can connect with up to 2 readers through a single RS 485 cable When connecting a second reader to GV AS1010 you will need to set up a Separate power source to power the second reader 6 S485 Be RS4e57 E RS485 B GV AS100 GV Readers or GV GF Fingerprint Readers Sl RS485 Rs4g5 12 RS485 GV AS1010 Up to 2 GV Readers and GV GF Fingerprint Readers Figure 1 C GeoVision 1 2 1 C Network Readers GV AS1010 Only GV AS1010 supports network connection with GV CR420 and GV GF1921 1922 Through the GV AS1010 keypad you can set the network reader as the entry or exit reader To d
32. Relay 2 v Event Alarm B A5610_0ut5 Door3 Electric Lock Figure 9 20 177 C GeoVision Here you can name and define each output device connected to the GV AS Controller such as locking devices and Exit Button Select from the drop down list to configure the Output Type Depending on the chosen Output Type either Output Function or Output Conditions will become available AS810 Outputl Outputl Configuration Output Function 3A 30VDC 110VAC 250VAC AS810_Out1 Output Type AS810_Out2 Normal v Output Type Output Conditions Figure 9 21 Note After upgrading GV AS400 from previous firmware versions to version 1 03 or later you must first load default to be able to name the sensor outputs 178 E The Web Interface 9 2 7 A Output Function Settings This section explains the output functions available when Output Type is set to Door Gate or Relay Output Function AS2Z10_Outl ia 1 Output Type 2 Output Functions Figure 9 22 1 Output Type Configure the output type Options available for the output type change based on your settings of Door Gate in the Function Setting page Figure 9 9 2 Output Function Configure the output function Options available for the output function change based on the Output Type selected above e When Door is selected as Output Type these Output Functions become available GV AS210 2110 Door Electric Lock Output is triggered
33. Serial Number of the reader Note that the ID number located next to the serial number field need to match the reader s ID number defined through the GV RK1352 Config AP e GV Reader 1251 Reader 1352 V2 Select the RS 485 checkbox and leave the serial number field blank Note that the ID number located next to the serial number field need to match the reader s ID number defined by the dip switches on the reader e GV GF1921 GF1922 Type the MAC address of the fingerprint reader and do not select the RS 485 checkbox e GV CR420 Select the RS 485 checkbox only if the GV CR420 is connected to the controller through RS 485 connection If the reader is using network connection do not check the RS485 box Type the MAC address of GV CR420 if you using the latest GV CR420 firmware Refer to the note below if you are using firmware V1 0 Read Mode Select Read UID or Read GID to set the connected GV R1352 RK1352 to read UID unique identifier or GID GeoVision ID on the card key fob If you select Read GID make sure there are two numbers on your GV AS ID Cards Key Fobs as shown below If there is only one number on your GV AS ID Cards Key Fobs GID is not supported and you must select Unique Identification UID GID UID Figure 9 28 Note GID is only supported by GV R1352 RK1352 firmware V1 2 or later GeoFinger Server IP Address To allow GV ASManager to receive data from the GV GF1921 1922 defined on this page dur
34. Settings see 10 3 2 Advanced Settings 10 1 4 G b Resetting the GV ASBox To reset GV ASBox press the Reset EN button on GV ASBox for 3 seconds 10 1 4 G c Restoring Factory Defaults To restore factory default values press the Default button on GV ASBox for 3 seconds After this it may take up to 3 minutes to restore GV ASBox to default values 200 10 Optional Devices 10 1 5 GV ASBox Specifications 32 bit ARM7 TDMI Microprocessor 100 240V AC 50 60 Hz 12V SAh 2 separate interfaces for GV Readers and GV GF Fingerprint Readers Max 4 readers 1 Wiegand interface 26 64 bit format 12V DC Power Supply 200mA RS 485 10 90 RH non condensing All specifications are subject to change without notice 201 C GeoVision 10 2 Optional GV ASNet The optional GV ASNet is the network expansion module for GV AS100 GV AS110 and GV AS120 With the GV ASNet GV AS100 110 120 can be connected to the GV ASManager and you can access the Web interface of GV AS100 110 120 10 2 1 Main Features e Add TCP IP networking capability to GV AS100 110 120 e Access GV AS100 110 120 s features through Web based interfaces e Support 2 units of GV Readers and GV GF Fingerprint Readers 10 2 2 Packing List e GV ASNet e Power Adaptor 12V DC e Power Cord e Battery Power Cable 202 10 Optional Devices 10 2 3 GV ASNet Overview Front View Rear View O O Ethernet RS485 Terminal Oo We
35. assign the fixed IP to the GV ASManager and GV AS GV EV Controller respectively This procedure can determine if the problem is caused by the faulty devices and incorrect network settings 1 Disconnect the hub or switch which connects the GV ASManager and GV AS GV EV Controller from the network 2 Give the GV ASManager a fixed IP address that is NOT used by another device e g 192 168 0 154 Internet Protocol TCP IP Properties pma General You can get IP settings assigned automatically if your network supports this capability Otherwise you need to ask your network administrator for the appropriate IP settings Obtain an IP address automatically IP address 192 168 0 154 Subnet mask a 2 ee 2 Default gateway Use the following DNS server addresses Preferred DNS server Alternate DNS server Figure 11 1 3 Reset the controller module and Ethernet module to factory defaults a Plug the GV ASKeypad to the controller b Remove the jumper cap from the 2 pin Default jumper c Press the Reset button d Replace the jumper cap back to the 2 pin Default jumper e Toreset the Ethernet Module press and hold the Default EN button for 6 seconds 231 C GeoVision 4 Open the browser and enter the controller default address http 192 168 0 100 Network Configuration C GeoVision Machine Name Basic Setting Machine Name Controller 1 Network Setting e Other Setting e Firmware
36. directly Power should only be applied to the unit when all other connections are completed and tested After power is connected the power LED on GV AS400 should glow Caution The supplied 24V DC power adaptor is for GV AS Power Board Do not plug the 24V DC power adaptor to the power input of GV AS400 Connect Through GV AS Power Board 1 Connect GV AS400 to GV AS Power Board using the supplied adaptor cable 2 Connect the power board to a power source using the supplied power adaptor The supplied power adaptor can connect to any power source supplying from 100 to 250V Connect to power using the supplied 24V DC power adaptor Power GV AS400 Input GV AS Power Board 2V out 12V ouij 12V oui Connect 1 of the 6 power outputs on GV AS Power Board to GV AS400 using the supplied adaptor cable _ Figure 5 8 Connecting to Power through GV AS Power Board 98 5 GV AS400 Controller Connect GV AS400 to Power Directly To connect GV AS400 to a power source directly you must use a 12V DC adaptor Connect to power using a 12V DC power adaptor not supplied Power LED GV AS400 E i Figure 5 9 Connecting GV AS400 to Power Directly Note The 12V DC power adaptor is not supplied with the GV AS400 Do not plug the supplied 24V DC power adaptor to GV AS400 5 2 5 Connecting the PC Connecting GV AS400 to a computer allows you to access its Web interface and connect it to GV ASManage
37. is set to OFF Advanced Settings are not accessible For details on Advanced Settings see 10 3 2 Advanced Settings 10 2 4 D b Restoring Factory Defaults To restore factory default values press the Default button on GV ASNet for 6 seconds After this it may take up to 3 minutes to restore GV ASNet to default values 10 2 4 D c Power Status LED The three LED located on the right of the rear panel indicate the power status of the GV ASNet When the power LED d is red it indicates that the GV ASNet is powered When the main power source is off and that the GV ASNet is running on battery the battery LED turns green An orange charging LED f means that the battery is being charged 207 C GeoVision 10 2 5 GV ASNet Specifications 32 bit ARM7 TDMI Microprocessor 100 240V AC 50 60 Hz 12V 5Ah and 12V 12Ah 1 RS 485 interface only for GV Readers and GV GF Fingerprint Readers Max 2 readers RS 485 10 90 RH non condensing All specifications are subject to change without notice 208 10 Optional Devices 10 3 Web Interface through Optional Devices Through GV ASBox or GV ASNet you can access the GV AS100 GV AS110 GV AS120 s Web interface Also through GV ASBox or GV ASNet GV AS100 GV AS110 or GV AS120 can communicate with GV ASManager over the network GV ASBox and GV ASNet must be assigned an IP address to make it accessible on the network Refer to Chapter 8 Installing on a Network for detail
38. left menu of the Web interface is divided into three sections Basic Setting Advanced Setting and Extended Device The options available vary among different controller models Basic Setting Network Setting Other Setting Firmware Update Account Setting Advanced Setting Function Setting Parameter Setting Time Setting Input Setting Output Setting Wiegand Setting Urgent Card Extended Device Extended Reader Extended l0 Figure 9 1 153 C GeoVision 9 1 Basic Settings The Basic Settings section covers general system settings firmware update and user account settings For details on Network Setting refer to Chapter 8 Installing on a Network 9 1 1 System Setup In the left menu click Other Setting This page appears Other Configuration 3DES Code 3DES Code1 characters 8 24 3DES Code2 option 3DES Code3 option Device Port Device Port from 1025 to 65535 SD Card Capacity total 1920704kB free 1377664kB 71 72 Unmount Check Mac Address Firmware Version Mac Address 00 13 e2 ff 1b 87 Firmware Version V1 2 3 20141111 Reboot System Set Default Reboot System Configuration Control Default Value Backup Configuration a Browse Upload Restore Configuration Figure 9 2 154 9 The Web Interface m 3DES Code 1 3 Stands for Triple DES Data Encryption Standard Type up to three different keys for data encryption The default 3DES Code is 123456
39. oe BY o BUTT o Figure 7 1 133 C GeoVision 7 2 Installation 7 2 1 Connecting RS 485 Card Readers With a single RS 485 cable you can connect up to 2 GV Readers and or GV GF Fingerprint Readers to the RS 485 interface on GV EV48 Up to 2 GV Readers and GV GF Fingerprint Readers B B a funct o i Bae iis i B B A A Terminal RS485 Resistor Figure 7 2 To connect to GV CR420 or GV GF1921 1922 through network connection refer to 9 3 1 Extended Reader for details Note When the RS 485 connection between GV EV48 and the reader is over 600 meters turn ON the RS485 A Terminal switch to avoid unstable signals RS485_B Terminal Resister is not functional 134 GV EV48 Controller 7 2 2 Connecting Output Relay Up to 24 output relays can be connected to the GV EV48 24 Floors to control up to 24 elevator floors Up to 48 output relays can be connected to the GV EV48 48 Floors to control up to 48 elevator floors Each output relay is set to control access to a corresponding floor in the elevator To connect output relay Connect the output relay on the GV EV48 to the corresponding floor on the elevator control panel Next connect the COM on the GV EV48 to the COM on the elevator control panel IO Board Connector Elevator i Control Panel 7 8 5 6 O OUT10 11 12 9 10 C GeoVision GV EV48 CON 15 16 13 14 Figure 3 135 C GeoVision
40. page modify the login name and password The password is case sensitive and is limited to alphabets and numbers Security Configuration Account Account Name Password Password Change TILLI Password Confirm PT itiii Figure 9 6 158 E The Web Interface 9 2 Advanced Settings To configure the Advanced Setting on the Web interface set the Web Setting switch on the GV AS GV EV Controller to ON See the Web Setting Switch section of each controller chapter Under Advanced Settings you can configure door Wiegand settings turn on Alarms set the device time and edit the input output functions Changes in some of the Advanced Settings pages will affect the options available on other pages Below is a diagram drawing the relationships between each Advanced Settings page The Relationship Diagram between each Advanced Setting Page Advanced Setting Affects Function Setting Parameter Setting Affects Time Setting Input Setting Output Setting Wiegand Setting Urgent Card Figure 9 7 Note 1 The Urgent Card setting page is only available for GV AS400 2 For GV AS1010 and GV AS1110 a Card Setting and a Card Information setting page are available 3 For GV AS1010 a Function Key setting page is available 159 C GeoVision For GV EV48 the options available in Advanced Settings page are fixed Only the following setting pages are available Advanced Setting Function Se
41. ree eet nsec nec ce estee eeeeedgeeetavenecean xii Installation CONSIAErations cccceeceeceeeeeneeeeeeeeeneeeesensenesensoneeeesensoneseesoneseesoneees XIV Firmware and Software Compatibility cccccesecsseeeeeeeeeneeeeseescneeeeseneeneseneones XV BS BUENO aroe xvi 1 GV AS100 1010 Controller 0 0 cece cece seen eeeeseneeaesenseaeseesonseneeaesensenesensones 1 Tel LOCUCION Reet at eee a ene a E ee eet 2 1 11 Main Feat l GS pesen a EE kisses cn eticeoeie Er EEA ONNE sors 4 112 Packing MS Utica asiceet cs occ cap meticcignceddcsaecedkevaveyddetaperetmepiunineintededewstnestecebstnteoeeneceant 5 1 1 3 GV AS100 1010 Board Layout wcctecccewicdacecsxedenctenedadedsxedexcdenedadedexedexodeuesuerienes 6 ke JM MTO e E E E E E S T 1 2 1 Connecting Card REAdePs ccccccecccecceeeceeceeeceeeceeceeeeeceeeaueseeseeeseeseeesees 8 1 2 1 A Wiegand Readers GV AS100 Only ccc cecccecceceeeeceeeeeeseeeseeeeeeaeeees 8 T2 1B TOO OS CAC CS a T E ae 9 1 2 1 C Network Readers GV AS1010 Only ccc ccecc cece cece eeeeeseeeeeeeeeeseees 10 1 2 2 Connecting Input Devices 1 0 0 ccc ccccccc cece seca eeseeceeeseeeeeeeeeeeeseeseeeseeeeeesaes 11 1 2 3 Connecting Output DeVICES ccc ccc cece cecceeeeeeceeeseeeeeeseeceeeseeseeeseeeseeeaes 12 1 24 CONIC CHING ihe PO asta te ts tet eae aa S are 14 1 2 4 A Connecting GV AS100 to PC ccc ccccceceeeeceeeeeeseeeaeeseeeaeeteeeaeeeeees 15 1 2 4 B Connectin
42. the door is held open over the set period of time Forced Open This alarm activates whenever the door is opened by force This alarm activates whenever fire is detected Access Denied This alarm activates whenever entry is denied due to using the wrong card or entering the wrong password Tamper This alarm activates whenever the sensor for tampering alarm is triggered For GV AS210 2110 400 410 4110 810 8110 the tampering alarm sensor needs to be installed separately and the triggering conditions depend on the type of sensor installed e g opening of the controller s cabinet 166 E The Web Interface e When Parking Control is selected in the Function Setting page Figure 9 9 these options become available Held Open See the same option above e When Elevator Control is selected in the Function Setting page Figure 9 9 these options become available Tamper See the same option above Common Password When Fixed Card Common Mode is selected as Authentication Mode in the Function Setting page Figure 9 9 you can gain access by using a card or entering this Common Password door s password Common Password Common Password Password Confirm Figure 9 11 Click Submit button to save the changes or click Cancel button to return the changes to its previous state 167 C GeoVision 9 2 2 B GV EV48 The Parameter Setting page allows you to specify which elevator floors are restrict
43. time clock circuitry When the power in the battery becomes low the message Low Battery will appear on GV ASKeypad In this case please replace the battery All settings on GV AS400 will disappear about 10 hours after the battery stops working and GV AS400 will be restored to default settings Battery amp i Figure 5 12 Note 1 Make sure the plastic insulation film under the battery is removed 2 Itis recommended to replace the battery annually 101 C GeoVision 5 3 Other Settings 5 3 1 Web Setting Switch When the Web Setting switch is set to the ON position you can modify Advanced Settings and Extended Reader settings of GV AS400 through its Web interfaces When the switch is set to the OFF position Advanced Settings and Extended Reader settings are not accessible For details on Advanced Settings and Extended Reader settings see 9 2 Advanced Settings and 9 3 1 Extended Reader Web Setting Switch Figure 5 13 5 3 2 Resetting the GV AS400 1 Toreset GV AS400 press the Reset button in the upper center of GV AS400 circuit board for three seconds 2 Toreset the Ethernet module of GV AS400 press the EM Reset button located on the Ethernet module for three seconds
44. to Chapter 9 The Web Interface for details on the setup pages of the Web interface Through the Web interface you can configure general settings specify which floors are restricted and establish connection with associated readers 140 GV EV48 Controller 7 5 GV EV48 Specifications 1 RS 485 interface only for GV Readers and GV GF Fingerprint Readers max 2 readers 10 90 RH non condensing All specifications are subject to change without notice 141 8 Installing on a Network E Installing on a Network You can install GV AS1010 1110 210 2110 400 410 4110 810 8110 and GV EV48 on a network and set up general settings doors gates elevators readers and input output devices through its Web interface Through the network connection you can also connect GV AS GV EV Controller to GV ASManager for more comprehensive management Note To access the Web interface of GV AS100 110 120 and allow communication with GV ASManager over the network a GV ASBox or GV ASNet is required Refer to Chapter 10 Optional Devices for more details The GV AS GV EV Controller must first be assigned an IP address to make it accessible on the network 1 Connect the network cable to the Ethernet port on GV AS GV EV Controller 2 Use a computer on the same LAN with the controller to assign an IP address e The default address is httos 192 168 0 100 e The default Username and Password for login are admin Note t
45. to GV AS100 110 120 GV ASManager will load its parameters to the GV AS Controller That means some of the Parameter Settings you have configured here may be rewritten by GV ASManager later 214 10 Optional Devices Events Set the parameters for the events Events Door A Gate B Anti passback No Gate Open Time 5 1 255 Lock Reset Time 5 1 255 Held Open Time 5 5 9999 Held Open Time 10 5 9999 Fire Action Unchange Fire Action Unchange Alarm Continuous Time 5 1 10 Alarm Continuous Time 5 1 10 Figure 10 17 e When Door Entry Exit Control or Parking Entry Exit Control is selected in the Function Setting page Figure 10 15 these options become available O S Anti Passback Enables or disables the Anti Passback function The option is only available for Door Gate A Gate Open Time Sets the time 1 to 255 sec that a parking gate remains open after which the gate will automatically be locked The option is only available when Parking Entry Exit Control is selected Lock Reset Time Sets the time 1 to 255 sec that a door remains open after which the door will automatically be locked The option is only available when Door Entry Exit Control is selected Held Open Time Sets the time 5 to 9999 sec that a door gate can be held open before an alarm is generated Fire Action Locks or unlocks the door gate when a fire condition occurs Otherwise remains the door s current state by selecting Unch
46. when the 410 4110 810 correct card is presented to open 8110 All Outputs the locking device Event Alarm Output is triggered when the GV AS400 defined alarm events occur Output 01 08 Entry Card Output is triggered when the correct card is presented to enter the door Exit Card Output is triggered when the correct card is presented to exit the door Unlock Alarm Output is triggered when the door is unlocked GV AS400 Beeper Beeper These Output Functions are only Output 09 16 available for Output 9 16 of GV GreenLED mak GreenLED A6400 because these outputs on Red LED GV AS400 cannot accept external power supply 179 Q GeoVision e When Gate is selected as Output Type these Output Functions become available GV AS210 2110 Gate Electric Lock See the same function above 410 4110 810 Event Alarm 8110 All Outputs Entry Card Output is triggered when the correct card is presented to enter GV AS400 the parking gate Output 01 08 Exit Card Output is triggered when the correct card is presented to exit the parking gate Open Alarm Output is triggered when the parking gate is open GV AS400 See the same function above Output 09 16 Green LED Red LED e When Relay is selected as Output Type these Output Functions become available GV AS210 2110 Relay Electric Lock See the same function above 410 4110 810 8110 All Event Alarm Outputs Entry Card Output is trig
47. will be unrestricted and accessible without card or password Authentication Mode configured in Function Setting page will only be applied to output pins that are not selected To select all output pins or to clear all selections click Toggle All Note For GV EV48 24 Floors output pins 25 48 are not functional Click Submit button to save the changes or click Cancel button to return the changes to its previous state Output NC NO Sets the output pins to NC or NO 169 C GeoVision 9 2 3 Card Setting In the left menu click Card Setting to set the built in card reader of GV AS1010 and GV AS1110 to read UID unique identification or GID GeoVision ID on GV AS ID F Card Key Fob Note The Card Setting page is only available for GV AS1010 and GV AS1110 Card Configuration Card Identify Identification type Unique Identification UID Figure 9 13 To use GeoVision Identification GID make sure there are two numbers on your GV AS ID Cards Key Fobs as shown below If there is only one number on your GV AS ID Cards Key Fobs GID is not supported and you must select Unique Identification UID GID UID Figure 9 14 170 E The Web Interface 9 2 4 Card Information In the left menu click Card Information to see the cards added by GV AS1010 and GV AS1110 Note The Card Information page is only available for GV AS1010 and GV AS1110 Card Information Card Database 1 lofl Card Number Card Typ
48. 0 0 cece cecc cece eee eeeeeseeeaeenes 193 10 1 4 B Connecting a Wiegand Reader ccccecceecceeeeeceeeeeeseeeseeseeeaeeees 194 10 1 4 C Connecting GV Readers and GV GF Fingerprint Readers 195 10 1 4 D Connecting Input DeVICES cc ccecccccc eee eeeceeeeeeceeeeeeceeeseeeeeeseesees 196 10 1 4 E Connecting Output Devices ccc ccc cece eeeceeee eee eeeeeseeeseeseeeaeeees 197 10 1 4 F Connecting Backup Battery cccccccecceeeceeeeeeseeeeeeseeeseeseeeaeeees 199 10 1 4 G Other Settings ce ccccccccecceeeceeceeeceeceeeceeceeeseeseeseeceeseeeseeeeenaes 200 10 1 4 G a Web Setting SWItch cc cceccccccecseeceeeseeeeeeseeeeeeseeeeeeseees 200 10 1 4 G b Resetting the GV ASBOxX cccccccccecceeeseeeeeeseeeeeeseeeeeeseees 200 10 1 4 G c Restoring Factory Defaults ccc cccccecceeeeeeeeeeneeeeeeaeees 200 10 1 5 GV ASBOX Specifications cccccessessersusssssesccsccsccescessursuscessursursaneaseess 201 10 2 Optional GV ASNET ersinnen a A EO AAEE 202 10 21 Main Features setae teceatoe cu rersseeseeawesacesccneecde ces E RNANA E E NEN EEEE 202 E Pag L erea a E E TR 202 10 2 3 GV ASNet Overview cccccccceccecceeceeeceeeeeesaeeeeeceeeeeecaeeseeseeseeaeeseeegeesas 203 10 24 Installat O Ol er E OEE 204 10 2 4 A Connecting GV AS100 110 120 0 cccccecc cece eeceeeeeeseeeaeeees 204 10 2 4 B Connecting GV Readers and GV GF Fingerprint Readers 205
49. 10 120 to see how to connect to GV ASBox or GV ASNet 2 2 4 B Connecting GV AS1110 to PC The figure below illustrates the network connection between GV AS1110 and the computer TCP IP GV AS1110 Figure 2 11 Note GV AS1110 is only compatible with GV ASManager V4 2 3 or later 46 GV AS110 1110 Controller 2 2 5 Connecting the Power The supplied AC adaptor can be connected to any power source supplying from 100 to 240V Connect 12V and GND wires to the supplied power adapter and then connect the power adapter to a power source The table below shows the pin assignments of the power connectors on GV AS110 and GV AS1110 GV AS110 Definition GV AS1110 Definition Red oo 12V DC 7 5V 12V DC Black GND GND Note Power should only be applied to the unit when all connections are completed and tested 47 C GeoVision 2 3 Programming Mode After powering on GV AS110 1110 you must create two cards first an Enroll Card and a Delete Card The Enroll Card is used for adding new cards and the Delete Card is used for deleting cards Either card will allow you to program the various configurations on GV AS110 1110 Note Cards complying with ISO 14443A standard for smart card technology can be formatted as an Enroll Card or Delete Card To create the Enroll Card and the Delete Card 1 Power on the unit The LED flash
50. 64 bits The connected Wiegand reader can either work with GV AS100 GV AS110 GV AS120 to carry out entry and exit applications on a single door or be installed on another door for the two door application The table below shows the pin assignments of the Wiegand input on GV ASBox Please consult the documentation of your Wiegand reader for wiring GND GND for the Power Supply DO Wiegand Data 0 Wiegand Data 1 12V 12V Power Supply To define the reader you need to use the GV AS100 GV AS110 GV AS120 Web interface See 10 3 2 B Parameter Setting 194 10 Optional Devices 10 1 4 C Connecting GV Readers and GV GF Fingerprint Readers You can connect up to 4 units of GV Readers and GV GF Fingerprint Readers to GV ASBox Multiple GV Readers and GV GF Fingerprint Readers can be connected with a single RS 485 cable to separate RS 485 interfaces on GV ASBox Since Wiegand communication distance is shorter than RS 485 s you can choose GV Reader and GV GF Fingerprint Reader supporting RS 485 communication to add another door control and meet the need of long distance installation Use the RS 485 B B to connect to GV Readers and use the RS 485 interface to connect GV GF Fingerprint Readers Refer to the figure below to see where the RS 485 interfaces are located When multiple readers are connected together an extra power supply to each unit is required Use the auxiliary power output of 12V and GND on GV ASBox to power on
51. 78 m Device Port Keeps the default value 4000 Or modify it to match that of GV ASManager m SD Card Indicates capacity of the SD card inserted and allows you to format the SD card To safely remove the inserted SD card click Unmount To check and repair the SD card click Check These functions are only available for GV AS210 2110 410 4110 810 8110 m Mac Address Indicates the MAC address of the network medium Firmware Version Indicates the current firmware version of the controller m Reboot System Performs a warm boot of the controller This operation will keep the current configuration Default Value Resets all configuration parameters to their factory settings This may take 5 seconds to complete Backup Configuration To backup controller settings click the Download Backup button A bin file will be exported You can then import the file to other controllers to avoid setting each controller individually Note that network settings such as IP address and hardware ID will NOT be included in the backed up file Restore Configuration To import controller settings click Browse to select the bin file previously exported and click the Upload button Note The Backup Configuration and Restore Configuration functions are only available for GV AS210 2110 410 4110 810 8110 V1 23 or later and GV EV48 V1 12 or later 155 C GeoVision 9 1 2 Upgrading Firmware Follow the steps below to update
52. 85 GV AS100 Wiegand RS 485 Reader x4 GV ASBox IN Reader OUT TCP IP AAAA ARAARA ARAA A AAA PABBSADADDDASA ADD 080A POA B OPS BRAGAT ADO ARNA aABaREREBRRRERES aba EA GV ASManager Figure 1 2 Through GV ASBox Door GV ASNet Wiegand RS 485 RS 485 GV AS100 Reader x2 IN Reader OUT GV ASManager Figure 1 3 Through GV ASNet Q GeoVision 1 1 1 Main Features GV AS100 1 door one way and two way control expandable to 2 doors with optional GV ASBox 1 000 40 000 cards standalone networked or RS 485 mode Easy programming from keypad Built in 3 digital inputs and 2 relay outputs 1 Wiegand output 26 64 bits and 1 RS 485 interface for extra reader programming Built in 13 56 MHz Reader Built in tampering alarm sensor IP54 compliant housing Anti Passback APB support GV AS1010 1 door one way and two way control 1 000 40 000 cards standalone networked mode Easy programming from keypad Function keys on keypad to register attendance data for GV TAWeb Built in 3 digital inputs and 2 relay outputs 1 RS 485 interface for connecting to up to 2 readers 1 network interface for connection with GV ASManager and TCP IP reader Built in 13 56 MHz Reader Built in tampering alarm sensor IP54 compliant housing Anti Passback APB support 1 1 2 Packing List GV AS100 GV AS100 Po
53. ADA BAB DAAD PRPBBAPRPABHBBAB BOB o EAA Figure 7 6 Note GV EV48 is only compatible with GV ASManager V4 1 or later 137 C GeoVision 7 3 Other Settings 7 3 1 Web Setting Switch When the Web Setting switch is set to the ON position you can modify Advanced Settings and Extended Reader settings of GV EV48 through its Web interfaces When the switch is set to the OFF position Advanced Settings and Extended Reader settings are not accessible For details on Advanced Settings and Extended Reader settings see 9 2 Advanced Settings and 9 3 1 Extended Reader Web Setting Switch _ E OFF DC12V EE on Micro SD Ethernet Ls ON OFF Figure 7 3 2 Resetting the GV EV48 To reset GV EV48 press the Reset button on the right side of GV EV48 circuit board for Reset Button Web Setting E OFF DC12V EE on three seconds Micro SD Ethernet Figure 7 8 138 GV EV48 Controller 7 3 3 Restoring Factory Defaults To restore GV EV48 to factory default settings press the Default button for 10 seconds Load Default Terminal RS485 Resistor Figure 7 9 139 C GeoVision 7 4 The Web Interface You can install GV EV48 on a network and configure GV EV48 through its Web interface Refer to Chapter 8 Installing on a Network for detailed instructions on setting up a fixed or dynamic IP address to access GV EV48 Refer
54. AS110 1110 GV MountA900 is a mounting plate that allows you to attach GV AS110 1110 to a US single gang power box e Dimensions 100 x 68 mm 3 9 x 2 7 in e Weight 55 g 0 12 Ib The push button switch can be integrated with access control system allowing door exit by momentarily activating or deactivating the electric locking device Both American standard and European standard push buttons are available The GV IB25 65 85 Infrared Button detects infrared movement within 3 to 12 cm and allows you to open the door with a wave of hand Three types of electric locks are available electromagnetic lock electric bolt and electric strike GV AS ID Cards and GV AS ID Tags are ideal for business and residential environment where access control is important for security reasons 125 kHz and 13 56 MHz cards and tags are available xiii C GeoVision Installation Considerations 1 There are distance limitations for Wiegand and RS 485 communications Please note e Wiegand interface Recommended Wiegand cable Wiegand cable a twisted pair of 24 AWG wires 100 meters 328 1 feet for GV AS2110 4110 8110 30 meters 98 43 feet for other GV AS Controllers e RS 485 interface 600 meters 1968 50 feet Recommended RS 485 cable standard 485 cable a twisted pair of 24 AWG wires 2 GV ASManager software is used to manage GV AS GV EV Controllers There is a limit for the number of controllers connected to GV ASManage
55. Configurations GV AS110 Through GV ASBox or GV ASNet GV AS110 can communicate with GV ASManager over the network Using GV ASBox or GV ASNet you can also access the Web interface of GV AS110 Refer to Chapter 10 Optional Devices to see how to connect a GV ASBox or GV ASNet and how to access the Web interface of GV AS110 GV AS1110 GV AS1110 can communicate with GV ASManager over the network The network interface also allows you to access the Web interface of GV AS1010 Refer to Chapter 8 Installing on a Network for detailed instructions on setting a fixed or dynamic IP address to access GV AS1110 Refer to Chapter 9 The Web Interface for details on the setup pages of the Web interface Through the Web interface you can configure general settings input output devices associated doors gates and connected readers 56 GV AS110 1110 Controller 2 6 GV AS110 1110 Specifications GV AS110 32 bit RISC microprocessor 1 000 40 000 cards standalone networked or RS 485 mode 13 56 MHz for IS014443A Mifare DESFire Mifare Plus and Mifare Classic 10 90 RH non condensing 57 GeoVision GV AS1110 32 bit ARM7TDMI 1 000 40 000 cards standalone networked mode 13 56 MHz for IS014443A Mifare DESFire Mifare Plus and Mifare Classic roo All specifications are subject to change without notice 58 3 GV AS120 Controller C GeoVision 3 1 Introduction Working as a standal
56. D H goaz ATMODODOOCOODAADD C a NY PC GV AS410 4110 810 8110 Figure 6 8 Note GV AS410 810 is only compatible with GV ASManager V4 0 or later and GV AS4110 8110 is only compatible with GV ASManager V4 2 3 or later 122 6 GV AS410 4110 810 8110 Controller 6 3 Other Settings 6 3 1 Web Setting Switch When the Web Setting switch is set to the ON position you can modify Advanced Settings and Extended Reader settings of GV AS410 4110 810 8110 through its Web interfaces When the switch is set to the OFF position Advanced Settings and Extended Reader settings are not accessible For details on Advanced Settings and Extended Reader settings see 8 2 Advanced Settings and 9 3 1 Extended Reader OFF __y Web Setting ON Switch Figure 6 9 6 3 2 Resetting the GV AS410 4110 810 8110 To reset GV AS410 4110 810 8110 press the Reset button on the right side of GV AS410 4110 810 8110 circuit board for three seconds Ethernet kfc cfc J14 Reset Button Figure 6 10 123 C GeoVision 6 3 3 Restoring Factory Defaults To restore GV AS410 4110 810 8110 to factory default settings press the Default button for 10 seconds E Load Default Button KQ CON12 J s N Tele a lt o lt Figure 6 11 124 6 GV AS410 4110 810 8110 Controller 6 4 GV AS410 4110 810 8110 Kit Optional GV AS410 4110 810 8110 K
57. Device ASBOX Output 1 e Extend Reader No Funcion x Figure 10 23 Input Function Here you can define each sensor input that is connected GV ASBox and select the most fitting Input Type No 3 Figure 10 24 and Input Function No 4 Figure 10 24 to describe the sensor input Through the sensor input an alarm event can be detected and it can then trigger the alarm device Input Function 1 ASBOX Input 1 F Normal Input palf Disable Latch ASBOX Input 2 Normal Input J Disable Latch Bi ASBOX Input 3 z Relay A I Fire Zone ASBOX Input 4 Relay A Tamper Zone ASBOKX Input 5 Normal Input J Disable Latch we ASBOX Input 6 s Normal Input Disable Latchf as ASBOX Input 7 r Normal Input fif Disable Latch ASBOX Input 6 e Normal Input faif Disable Latch a Figure 10 24 221 Q GeoVision Below is the explanation based on the numbers marked on the above figure 1 ASBOX Input Edit the name of the Input 2 NO NC Configure the input to NC normally closed or NO normally open mode 3 Input Type Configure the input type to define the type of sensor that is connected to the input of GV ASBox Options available for the input type change based on your settings of Door Gate A and Door Gate B in the Function Setting page Figure 10 15 4 Input Function Configure the input function Options available for the input function change based on the settings of Input Type above e When Door
58. E 66 3 2 4 A RS 485 Connection ccccccececceeeceecceecaeeceecaeeceesaeeceecaeeceesaseceesaeeeass 66 3 2 4 B Network Connection cccccccecceecceceeeeceeeeeeceeeseeeeeeseeeeeeseeeseeseeeaeesees 68 329 Connecting ING POWGT scesi EE E niasa 68 329 FOOT AMIMIING MOOG ass boosts oats es ce ak aceite cae cetaceans a a ade 69 320 1 AdGING and Deleting Cards siosana n a 69 Simo ea LA Addn a C arde a a E E EEAS 70 Ord 1D Deleting a Card eerren ea E R se asetarsceidees 70 3 4 LED Stats aNd BCCDCM rioter dura tans Queanedeaheantartosaate S 71 3 0 Web Based CONMMOUPANOMS ecane ein bic e a a 72 3 0 GV AS 20 SPOCIICALONS se titccssdc tccetetecasaadadtaseeehotasaasabtosetebidawaadatdasoeetadoseassdtapeaatstens 73 4 GV AS210 2110 Controller ccc cece eee eeeeeeseneenesenseneseeseneenesnesensoneseesenees 74 A I AVMFOOU GUGM eanan a E E EE sete sdacsuacusacsxe E 15 AAA VIAN E CONULCS 2225 erste de stale A 15 AL PACKIN EIS reget te eo oe eee ete eee er 15 42 MAST AM AU OWMiesteas tetera tite ec suseetc tet ccnt a a 77 4 2 1 Connecting Card RE ders cccccccccceccseeceeeseeceeeeeeceeeseeceeeseeseeseeeueseeesaees 77 eZ TA Wiegand Reade Serana a a a ee ae T1 A2 Ves RS 489 IROACCIS aienea a a aa a ai 78 4 2 2 Connecting Input DEVICES ce cccec cece ecceeceeeceeceeeceeceeeceeceeeseeseeeeeseeseees 19 4 2 3 Connecting Output DeVICES cc cccccecceeceeeceeceeeceeceeeseesaeeseeseeeseeseesa
59. Fixed Card PIN Grants access after the user presents the card and then enters the card s PIN code Ignores the authentication schedule of GV ASManager Fixed Card Common Grants access after the user presents the card or enters the door s password Enter the door s password after the LCD displays Common Password Ignores the authentication schedule of GV ASManager Local Unlock Mode Remains open The held open state cannot be cleared through GV ASManager Local Lock Mode Remains locked The locked state cannot be cleared through GV ASManager 2 GeoVision GV ASBox Enables or disables the connection to GV ASBox GV ASNet GV AS100 only Control Type AS100 1010 Function Door Entry Type Sets GV AS100 1010 as entry reader of a door Door Exit Type Sets GV AS100 1010 as exit reader of a door Parking Entry Type Sets GV AS100 1010 as entry reader of a parking gate Parking Exit Type Sets GV AS100 1010 as exit reader of a parking gate Elevator Type GV AS100 1010 reader is installed in the elevator for access control Anti Passback Enables or disables the Anti Passback function Master PIN Change Changes the PIN code of the Master Card GV AS100 only Enroll Pin Change Changes the PIN code of the Enroll Card GV AS1010 only Delete Pin Change Changes the PIN code of the Delete Card GV AS1010 only Local Rest Time Sets the time 1 to 255 sec that a door gate rema
60. Function e GV RK1352 R1352 DFR1352 Select the checkbox and type the Serial Number of the reader Note that the ID number located next to the serial number field need to match the reader s ID number defined through the GV RK1352 Config AP e GV Reader 1251 Reader 1352 V2 Select the checkbox and leave the serial number field blank Note that the ID number located next to the serial number field need to match the reader s ID number defined by the dip switches on the reader e GV CR420 Type the Barcode of GV CR420 Select the checkbox only if the GV CR420 is connected to the controller through RS 485 connection For network connection do not select the checkbox Note that only GV CR420 V1 0 is compatible with GV AS100 110 120 and you must also enable network connection to the controller on the Web interface of the GV CR420 228 10 Optional Devices GeoFinger Function For GV GF1901 GF1902 GF1911 GF1912 select the checkbox and type the XID Number located on the back of the reader Click Submit to detect the readers If any GV Reader GV GF Fingerprint Reader is detected a green mark will appear in the Status field if not a red mark will appear 229 11 Troubleshooting 11 Troubleshooting Q1 GV ASManager cannot connect to GV AS GV EV Controller over the Internet There are several causes for this problem such as IP address conflict incorrect connection settings and network failure Follow the steps below to
61. I O Configuration page appears The page defines the inputs and outputs on the GV I O Box which is connected to GV AS400 The options in this page are the same as those mentioned in Input Setting and Output Setting pages Note The Extended I O setting page is only available for GV AS400 AS400 Extend IO 2 Configuration Input Function Input Mode Lateh Enable 1 NOW D 02 NO 03 NO 04 NO Output Function Trigger 3 Output Mode Trigger 1 Trigger 2 Trigger 4 4 Normal NiO Sec 1Normal WO w Sec 1 Normal NAO w 03 Sec 1Normal NAS v Sec Figure 9 30 189 10 Optional Devices 10 Optional Devices 10 1 Optional GV ASBox The optional GV ASBox is the I O and network expansion module for GV AS100 GV AS110 and GV AS120 With the GV ASBox additional network connectivity 8 inputs 8 outputs and 1 Wiegand reader can be added to GV AS100 GV AS110 or GV AS120 10 1 1 Main Features e Add TCP IP networking capability to GV AS100 110 120 e Extend GV AS100 110 120 from 1 door to 2 door controller e Support 1 Wiegand reader of 26 to 64 bits e Support 8 digital inputs and 8 relay outputs e 4 special outputs for lighting control and energy saving e Access GV AS100 110 120 s features through Web based interfaces e Route digital I O controls from GV AS100 110 120 to avoid tamper and enhance security level e Support 4 units of GV Readers and GV GF Fingerpri
62. IN3 10 fa RelayC p 04 AS210_IN4 NO Door D ha Tamper Zone Figure 9 19 1 Input Type Configure the input type Input Type defines the type of sensor that is connected to the input of GV AS Controller Options available for the input type change based on your settings of Door Gate in the Function Setting page Figure 9 9 2 Input Function Configure the input function Options available for the input function change based on the settings of Input Type above Note If you set the Input Type to All Zone the Input Function will automatically be set to Fire Sensor When triggered fire sensors on all doors associated with that controller will be triggered Normal Input Enable Latch The Normal Input is used for a normal Disable Latch detection mode in which the input is set to trigger an output Instead of constant output alarm in N O and N C the Enable Latch option provides a momentary alarm when triggered Fire Zone Depending on the type of sensor and the location where it is installed select the most T Z APEE suitable Input Function name to describe the Exit Button sensor When the sensor is activated an Door Contact alarm event may occur and it can also trigger alarms For the type of alarm see Alarm 9 2 2 Parameter Setting For example when the Door Contact sensor detects unauthorized access a Force Open type of event occurs and the event may trigger the Force Open alarm 175 C GeoVi
63. Note Press to display the symbol x 5 5 2 A Setting Parameters Through GV ASKeypad you can program GV AS400 IMPORTANT Once connecting to GV AS400 GV ASManager will load its parameters to GV AS400 That means some of configurations you have configured may be overwritten by GV ASManager later 1 Press the code 738 2 Press the default PIN code 1234 3 To set parameters e Use the Up and Down arrow buttons to select options or change doors for settings e Press to start setting or apply settings e Press to return to the home page Set Local Time Sets the time and specify the time zone of GV AS400 Set AS400 ID Sets the ID of GV AS400 from 1 to 1000 Set Auth Mode Sets an authentication mode for each door For types of authentication modes see 8 2 Advanced Settings Press the Right and Left arrow buttons to change modes 106 5 GV AS400 Controller AS400 Function Sets the function for each door For types of functions see 8 2 Advanced Settings Press the Right and Left arrow buttons to change functions Master PIN Change Changes the PIN code of GV AS400 Lock Reset Time Sets the time 1 to 255 sec that a door can remain open after which the door will automatically be locked Set Held Open Sets the time 5 to 9999 sec that a door can be held open before Time an alarm is generated Set Alarm Event Enables or disables the alarm settings for each door For the types of alarm events see 8 2 Advanced S
64. RS485 RS485 Figure 4 3 PIE ph 42 GND ad 12V eH l Wiegand D aed 12y e240 de C PIA eh RS 485_A TERM a RS 485_B TERM Not Functional a A Extend lt A Reader A Not gt J Functional 12V GND o 1C iim B Wry When the RS 485 connection between GV AS210 2110 and the reader is over 600 meters turn ON the RS485 A Terminal switch to avoid unstable signals E GV AS210 2110 Controller 4 2 2 Connecting Input Devices Up to 8 input devices can be connected to GV AS210 2110 Connect the input wires to DI1 8 and connect GND wires to com A or com B Multiple GND wires can be connected to the same com A B interface All inputs are dry contact that can be configured as normally open NO or normally closed NC on the Web interface To change the input status refer to 9 2 4 Input Setting Input Device Figure 4 4 19 C GeoVision 4 2 3 Connecting Output Devices Up to 8 output devices can be connected to GV AS210 2110 Check if your output device meets the following absolute maximum ratings before connecting it to outputs 1 8 Breakdown Voltage 110V AC 250V AC 30V DC Continuous Load Current 3A AC 3A DC Note Absolute Maximum Ratings are those values beyond which damage to GV AS210 2110 circuit board may occur Continuous operation of GV AS210 2110 at the absolute rating level may affect GV AS210 2110 reliability To connect an output device Conn
65. To change the input status refer to 9 2 4 Input Setting Ethernet Device Figure 6 4 119 C GeoVision 6 2 3 Connecting Output Devices Up to 24 output devices can be connected to GV AS410 4110 810 8110 Check if your output device meets the following absolute maximum ratings before connecting it to output terminal block Breakdown Voltage 110V AC 250V AC 30V DC 30V DC Continuous Load Current 3A AC 3A DC Note Absolute Maximum Ratings are those values beyond which damage to GV AS410 4110 810 8110 circuit board may occur Continuous operation at the absolute rating level may affect GV AS410 4110 810 8110 s stability To connect an output device Connect the point on the output device to COM on GV AS410 4110 810 8110 connect the two points of the output device and the external power supply together and connect the point on the external power supply to the NO or NC of GV AS410 4110 810 8110 based on the state of the output device NO OUT4 cok NC NO OUT Ee NC External Power NO o OUT2 COM Output NCH 2 Device NO OUT cok O NC Figure 6 5 Note If instead of connecting an external power supply you want to connect the output devices to the power outputs on the GV AS410 4110 810 8110 note that the maximum current of the voltage output is 12V 0 9A 120 6 GV AS410 4110 810 8110 Controller 6 2 4 Connecting Bac
66. Two Person Entrance Exit mode the door unlocks only when two person A card is also presented together The Security Card is used for launching the Security Mode in which no cards can be granted access and no one can program the unit Only the Security Card will be able to disable the Security Mode 3 Present the card you want to add to the GV AS110 1110 4 The GV AS110 1110 will produce a long beep if the card has been added successfully and three short beeps if the adding procedure has failed If you do not want to customize a password you can simply present the Enroll Card and then present the card you would like to add The default password will be 1234 and the card will automatically be set to a Normal Card 49 C GeoVision 2 3 1 B Deleting a Card 1 Present the Delete Card 2 Present the card you want to delete 3 The GV AS110 1110 will produce a long beep if the card has been deleted successfully and three short beeps if the deleting procedure has failed 50 GV AS110 1110 Controller 2 3 2 Programming the GV AS110 1110 The command codes used to program various functions on GV AS110 1110 are listed below All command codes will start with an asterisk gt to clear all previous commands and end with a number sign to send the command After typing the command code present the Enroll Card or the Delete Card IMPORTANT Once connecting to GV AS110 1110 GV ASManager will load its parame
67. Update DHCP Client O Enable Account Setting Advance Setting Disable Function Setting IP Address Subnet Mask e Parameter Setting e Time Setting Input Setting Default Gateway Output Setting Domain Name Server Figure 11 2 device e g 192 168 0 XXX Controller ID 1 Network TCP IP IP 192 168 0 XXX Port 4000 User admin Password admin Crypto key 12345678 8 ASServer fd SPOR Sa amp o Device view Controller List Device eq TESTIS1 Controller Doo 4 Door B Please Enter ID ID Controller 1 Mame In the IP address field give the controller an IP address that is NOT used by another On the GV ASManager enter the following settings Controller Setup General Setup Gate 1 Gate 2 Gate 3 Gate 4 General Controller Name Controller_T aipei Controller ID Interlock _ DoorA DoorB C Doort DoorD GMT mo Wi o F Enable Daylight Saving Data Group Data Group 4 v Connection Network IFR 192 168 0 100 4000 admin Port User Password eeece Crypto Key Figure 11 3 232 11 Troubleshooting 7 The connection between the GV ASManager and controller should be established and the connection icon should appear If disconnection happens after you connect the hub or switch to the network then it should be othe
68. V AS110 1110 to GV MountA900 by securing the screws for holes B as shown below US single gang power box 23
69. Y 3 3 1 Adding and Deleting Cards Using the two cards you can add new cards to GV AS120 and delete existing cards on GV AS120 Note 1 GV ASManager cannot manage the cards enrolled on GV AS120 since the card data will not be transmitted to GV ASManager 2 The cards added through GV ASManager cannot be deleted on GV AS120 69 C GeoVision 3 3 1 A Adding a Card Up to 1 000 cards can be enrolled on GV AS120 directly without needing additional software When working with GV ASManager software GV AS120 can support up to 40 000 cards 1 Present the Enroll Card 2 Present the card you want to add to the GV AS120 3 The GV AS120 will produce a long beep if the card has been added successfully and three short beeps if the adding procedure has failed The default password will be 1234 and the card will automatically be set to a Normal Card You can change the password and set the card to different card types such as Patrol Card or Two person A B Card using GV ASManager Refer to the Adding Cards section in GV ASManager User s Manual for more details Note GV AS120 does not support cards set up as Security Cards 3 3 1 B Deleting a Card 1 Present the Delete Card 2 Present the card you want to delete 3 The GV AS120 will produce a long beep if the card has been deleted successfully and three short beeps if the deleting procedure has failed 70 3 GV AS120 Controller 3 4 LED Status and Beeper Normally th
70. ader interfaces e Wiegand Compatible with any Wiegand card readers of 26 to 64 bits e RS 485 Only compatible with all GV Readers and GV GF Fingerprint Readers 4 2 1 A Wiegand Readers GV AS210 2110 provides 4 Wiegand inputs Wiegand A to Wiegand D Connect up to 4 Wiegand readers ranging from 26 to 64 bits to the Wiegand interfaces Please consult the documentation of your Wiegand reader for wiring Connect to Wiegand compatible readers Wiegand A Wiegand B Wiegand C Wiegand D Figure 4 2 T C GeoVision 4 2 1 B RS 485 Readers For long distance connection and non Wiegand card readers you can establish RS 485 connection with any GV Readers and GV GF Fingerprint Readers Up to 8 readers can be connected together with a single RS 485 cable to the RS 485 interface on GV AS210 2110 When multiple readers are connected together an extra power supply to each unit is required Use 12V power output and GND on the power terminal or the Wiegand connectors to power on each unit Connect each reader to the power terminal or Wiegand connectors for power supply Up to 8 GV Readers anc GV GF Fingerprint Readers GND Note Each set of 12V power output and GND can provide power for up to 2 readers The 2 sets on the power terminal can support up to 4 readers If you wish to connect more readers and the Wiegand interfaces are already occupied you can connect the iF 78 readers to external power source
71. al settings input output devices associated doors gates and connected readers 129 GeoVision 6 6 GV AS410 4110 810 8110 Specifications Control Mode GV AS410 4110 GV AS810 8110 4 doors by Wiegand 4 doors by Wigand RS Two Way Control A485 and Network 8 doors by Wiegand RS 485 and Network 1 RS 485 interface only for GV Readers and GV GF Fingerprint Readers max 8 readers 8 Wiegand interfaces 26 64 bit format Wiegand Interface 12V DC power supply 200mA TCP IP Interface 1 TCP IP interface for GeoVision network readers Communication Protocol TCP IP GV AS410 810 Built in battery GV AS4110 8110 Replaceable button cell Input 16 inputs dry contact NO NC Output 24 relay outputs 30V DC 3A 110 250V AC 3A Operating Temperature 0 65 C 32 149 F Operating Humidity 10 90 RH non condensing RS 485 Interface Battery Dimensions W X H X D 210 x 187 x 40 mm 8 27 x 7 36 x 1 57 in Weight 900 g 2 Ib Certification CE FCC RoHS All specifications are subject to change without notice 130 7 GV EV48 Controller C GeoVision 7 1 Introduction GV EV48 is an elevator controller designed to control access of 1 elevator with a maximum of 48 floors Up to 2 GV Readers GV GF Fingerprint Readers can be connected to GV EV48 using RS 485 connection and network connection GV EV48 can recognize identification cards and grant access to the authorized floors only 7
72. alIDDNS Server IP Device Name Figure 8 3 3 Inthe DHCP Client section click Disable Type the static IP address information including IP Address Subnet Mask Default Gateway and Domain Name Server 4 Click Submit When the setting is complete the Status field will indicate Register Success Then GV AS GV EV Controller can be accessed with this fixed IP address Note If you like to use the domain name instead of IP address you may use Domain Name Service as well For details on domain name service see 7 2 DHCP Connection 145 C GeoVision 8 2 DHCP Connection If your network environment is using the dynamic IP address from a DHCP server use one of the following DDNS servers to map a dynamic IP address to a static domain name or device name e For LAN connection GV LocalDDNS Server is provided e For Internet connection two DDNS servers are supported GeoVision DDNS Server and Dynamic Network Services Inc DynDNS 8 2 1 Connection over LAN GeoVision s GV LocalDDNS Server can map the changing IP address of your controller to a device name allowing you to access the controller using the device name The Local DDNS Server can be installed in either GV ASManager or a separate computer The wiring of the LocalDDNS application is illustrated as below Card Reader BAR B SAAS ADGAALED ODER A ABB Boos SpE SERCO RESO ana Peal Ac BOBRERGOBABAES DAA ELA
73. anaeentvet ate esoaeks 92 92 leo ROO ONC AUCI Suction e cua geet a oe eo ee 93 2 2 2 Connecting INpUt DEVICES rehini a e aeai 94 5 2 9 C nnecting OUIDUL Device S sser docamsdentdasan aanendsenidanes 95 5S2 SA OPU T AB xran a e e e aE 95 Q GeoVision B ae 1016 0 Ceo aca e R 96 5 2 4 Connecting the POWEDL cccccceccseccseceeeceeceeceeceeecseceeeseecuesaeeceesaeeseesaeesaes 98 9 2 9 COMMCCHIG the PC casein AE AE A EATR 99 5 2 6 Connecting the External I O BOX cccccccccccecceeceeeceeeeeeceeeseeseeeseeeeeeseeseees 100 92 FPN NE BaO erien ee eee eee eee E 101 wo ONE N e EE E E 102 5 3 1 Web Setting Switch cssectacetuecs aresnsctutedecedstiesusetadedanatutiantiladedwensedneetedatelacwacedes 102 5 3 2 Resetting the GV AS400 a annannnnannannnnennannnnnnnnnnnrnrrnrnnnnnnnrnrenrnnrnrrnrnnenee 102 5 3 3 Restoring Factory DefaultS cccccccccecceecseeceeceeeseeseeeseeseeseeseeeseeseeesees 103 24A Toe A dolem al clg ic 6 ae ee eee eee E ee ec ees 104 5 5 Optional GV ASKeypad ccccceccecceeceeeeeeeeeeeeeeeseeteceeeeeeeeeeeeeeeeeeeeeeeeeeesseteeeeeeeees 105 29A MIS UU Oeste se secs ee rere E eeuts sone E EOE EEE 105 2o SOD cratic perch e corse ata a E E A E 106 5 5 2 A Setting Parameters sire caceceeraccineenesdcnuvgnweente eeeacevbemanmeditigiebecbisendebaguecw 106 5 9 2 B Displaying System Information ccc cece cecc seca eeceeeeeeseeceeeaeeeeeeaeeees 107 9 6 GV AS Power BOI ici
74. and 10V to 13V DC Additionally GV AS Power Board supports the battery backup to ensure the normal operations of vital output devices during power failure 5 6 1 Main Features e 2 power outputs of 24V AC DC e 6 power outputs of 10V to 13V DC e Support for battery backup e Support for AC and DC power inputs 108 5 GV AS400 Controller 5 6 2 Connecting Output Devices GV AS Power Board provides two types of power outputs 24V AC DC 10V to 13V DC The figure below illustrates the locations of these power outputs 24V AC DC 10 13V DC Vout Switcr 10 13V DC Figure 5 18 e 24V AC DC GV AS Power Board provides two power outputs of 24V AC DC The power current AC or DC is based on the input power source and Vout Swtich you turned on If the input power source is AC but the Vout Switch is switched to DC Output the two power outputs of 24V DC will be enlarged to 30V DC e 10V to 13V DC GV AS Power Board provides six power outputs of 10V to 13V DC in order to power on the output devices of low current Before connecting any output devices note the following electrical specifications Voltage Output Maximum Absolute Combined Absolute Combined Current Maximum Wattage 2 Power Outputs 1 85A each 1 85A 24V AC Power In 24V AC DC 2A 24V DC Power In 6 Power Outputs 1 85A each 2A 24V AC Power In 10 to 13V DC 4A 24V DC Power In 63W 109 C GeoVision To connect an output device Co
75. and tb al aroemeds adda adieiabuassagobasedae 170 O24 CAG IMMORAL ON saia a 171 Q GeoVision go HME PN eE ee ee panne eee sane eeaneeep cena cee acne eee 172 220 AD UE S CIN E E E E OE 174 9 2 7 OUND SeN seeen EE EAG EAE paG aOR AEE ENEAN NERES 177 9 2 7 A Output FUNCTION SettiINGS cece cecceeceeseeceeeseeseeeseeceeeseeseeeeeees 179 9 2 7 B Output Condition Settings cccccecccccceeceeeceeeeeeceeeeeeceeeeeeseeeeeeeeeees 181 92 0 Wiegand FICO IY aa secs rnsirantessccenepanousuacestgeecenoaguencstgiseccoegecnesatginedaceageoees 183 929 FUNCION KOY teat see sectors eee ed bet wee eee ect ate me he edie ned tiem se eemteteneeneeees 184 9 210 Urgent Card seserian isan 185 9 9 Extended DEVICE seiss mcimr rinisur AN EE A E EE KR ENERE EERE 186 Sete eel Mi EXLENdEd ROAdGT ae ee eee ee ee ees 186 9 3 2 Extended O eeeen ene eee E AE eee ee eee eee eee 189 10 Optional Devices 2 0 00 cece ccceccceee eee eeeeeeeeneeeeseneeneeeesensonecaesansenesensoneneesensonesensones 190 10 7 Optional GV ASBOX sicosisccsacersnccaiensasangucuncsGiousueatsecusenGheniGecewiatdvan seasons EATON EERS 191 OE Maim Features oseceeeteceaton cu rarssegasecawesacesccneecda aan E RANEA NEN EEE ENERE 191 TO VEZ PACKING LIS ur E 191 10 1 3 GV ASBox Board LayOut ccc ccccccceecc eee eeceeeeeeceeeeeeceeeseeeeeeeeeaeeseegeeees 192 TOL UAR Installato een aauswsusesesoeaeenosaneeeunteuseosesuuareneboueaceee 193 10 1 4 A Connecting GV AS100 110 12
76. anged Alarm Continuous Sets the time 1 to 10 sec that the alarm will continuously go off Time before it ends e When Elevator Control is selected in the Function Setting page Figure 10 15 these options become available Siete meena el eh ee Relay on Time Sets the time 1 to 255 sec that an elevator door remains open after which the door will automatically be closed See the same option above Alarm Continuous Time 215 Q GeoVision Alarm Select Yes or No to enable or disable the alarm function If you have defined the alarm conditions in Output Function of the In Out Function page Figure 10 23 remember to activate the corresponding alarms here otherwise even though the alarm conditions are met the expected alarm will not be triggered The default settings for all the alarms are set to NO Gate B Held Open Held Open Forced Open Forced Open Fire Alarm Fire Alarm Access Denied Access Denied Tamper Tamper Figure 10 18 e When Door Entry Exit Control or Parking Entry Exit Control is selected in the Function Setting page Figure 10 15 these options become available OE e Held Open This alarm activates whenever the door is held open over the set period of time Forced Open This alarm activates whenever the door is opened by force This alarm activates whenever fire is detected Access Denied This alarm activates whenever entry is denied due to using t
77. ate in the Function Setting page Figure 9 9 The number of door gate settings available varies among different models 164 Parameter Part1 Configuration Events Door 1 Anti passback NO 5 1 255 10 5 9999 Fire Action I ne Lock Reset Time Held Open Time Alarm Continuous Time 5 1 10 Alarm Door 1 Held Open Forced Open Fire Alarm Access Denied Tamper Tailgating Common Password Door 1 Common Password Password Confirm Gate 2 Anti passback Relay On Time Held Open Time Fire Action Alarm Continuous Time Gate 2 Held Open Fire Alarm Access Denied Tamper Gate 2 Common Password Password Confirm Figure 9 10 NO 5 1 255 10 8 9999 Unchange w E im E The Web Interface Interlock When the option is enabled the two mentioned doors will be interlocked allowing only one door to be opened at a time Note The Interlock function is not available on GV AS1010 1110 210 2110 410 4110 810 8110 Events Set the parameters for the events e When Door Control is selected in the Function Setting page Figure 9 9 these options become available Anti Passback Enables or disables the Anti Passback function Lock Reset Time Sets the time 1 to 255 sec that a door remains open after which the door will automatically be locked Held Open Time Sets the time 5 to 9999 sec that a door can be held open before an alarm is generate
78. ations 1 000 40 000 cards standalone networked or RS 485 mode 13 56 MHz for IS014443A Mifare DESFire Mifare Plus and Mifare Classic roo All specifications are subject to change without notice 13 4 GV AS210 2110 Controller 4 GV AS210 2110 Controller 4 1 Introduction 4 1 1 Main Features e One way control 4 doors e Two way control 2 doors by Wiegand only 4 doors by Wiegand RS 485 and network e Support 4 Wiegand card readers of 26 to 64 bits e Support 8 GV Readers GV GF Fingerprint Readers through RS485 connection e Built in 8 digital inputs and 8 relay outputs e Suitable for door parking and elevator access control e Support for tampering alarm 4 1 2 Packing List e GV AS210 2110 e Power Adaptor 12V DC 3A e Power Cord e Battery Cable e Micro SD Card 2 GB 15 C GeoVision 4 1 3 GV AS210 2110 Board Layout 76 Dit of DI2 lt DI3 Di4 lt comA 1 comA OF DIS lt DIG a DI7 lt Dis Pr com EB gt J com E Micro SD Ethernet Q GeoVision GV AS210 2110 po A LED1 Power Red LED2 Dis Charging Green LED3 Charging Yellow fo B fo C Figure 4 1 Only available ir GV AS2110 RTC Battery fo D RS 485_A TERM RS 485 B TERM a Extend Reader Power Jack 4 GV AS210 2110 Controller 4 2 Installation 4 2 1 Connecting Card Readers GV AS210 2110 supports two types of card re
79. atus and beeper under different conditions are listed below GV AS110 Security Mode disabled Returns to the LED status of One long beep the previous mode Tamper Forced Open Flashes green and red Constant beep until alarm Alarm cancelled Fire Alarm Constant beep until alarm cancelled Held Open Alarm Unchanged Constant beep until alarm cancelled Access Denied Alarm Flashes red momentarily Short beep for the number of seconds specified Access Denied Denied Flashes red momentarily red Flashes red momentarily Two short beeps short Two short beeps Access Flashes green momentarily One short beep Enroll Card Flashes green momentarily Two long beeps Delete Delete Card Flashes red momentarily Two long beeps La card Displays green LED One long beep successfully momentarily Enroll Delete card failed Displays red LED Three short beeps momentarily Firmware update Flashes red green and blue Firmware update failed Flashes purple Constant beep EJ Gv as110 1110 Controller Factory default Flashes blue GV AS1110 Condition LED Access Granted Flashes green momentarily Access Denied Flashes yellow momentarily Enroll Card Flashes green purple momentarily Delete Card Flashes yellow purple momentarily One long beeps All alarms Flashes yellow momentarily Beeps until alarm cancelled Ready Blue Connected N A Purple Disconnected Security Mode Yellow enabled 55 C GeoVision 2 5 Web Based
80. b Setting n i Ej na ee i Default O O ae Gale Gel O oF DC12V On Off GeoVision Figure 10 9 DC Power Input 12V Connects to power supply AS100 GV AS110 GV AS120 6 Psisannsassa corens BOVASTIDGKASTTOOVASIAN e remane enn nsss o _ Demutouton Reses an contgrratons totay aes Power LED Shows the power source and battery charging status of the GV ASNet See 9 2 4 C Other Settings for more details 203 C GeoVision 10 2 4 Installation This section describes how to connect other devices to GV ASNet 10 2 4 A Connecting GV AS100 110 120 The table and figure below show the pin assignments of related connectors on the rear view of the GV ASNet for connection to GV AS100 110 120 RS485 Terminal 12 Vout Battery Figure 10 10 12 12V Power Supply to 12V GND for Power Supply to GV AS100 110 120 GV AS100 110 120 RS485A GV AS100 110 120 RS485A GV AS100 110 120 Connection Connection Note 1 By default RS 485 A Term and RS 485 B Term are set to OFF 2 When the distance between the GV ASNet and the GV AS100 110 120 is over 600 meters RS 485 A Term must be switched to ON When the distance between the GV ASNet and the GV Readers is over 600 meters RS 485_B Term must be switched to ON 204 10 Optional Devices 10 2 4 B Connecting GV Readers and GV GF Fingerprint Readers You can connect up to 2 units of GV Readers and GV GF Fingerprint Readers to GV ASN
81. ck means that a card used on an entry door cannot access the same entry door again unless it has been used on a corresponding exit door For details on setup see Chapter 6 Anti Passback on GV ASManager User s Manual For all zone fire sensor function the fire sensors on all associated controllers will be triggered when the fire sensor on one door is triggered For this function to work you must set the Input Type to All Zone For details see the nput Setting section later in this chapter Enable Disable Enables or disables the Anti Passback function and fire sensor function m Info IP Enter the IP address of the next corresponding controller Click Submit button to save the changes or click Cancel button to return the changes to its previous state Note The all zone fire sensor function is only supported by GV AS210 2110 410 4110 810 8110 firmware V1 23 or later 163 C GeoVision 9 2 2 Parameter Setting In the left menu click Parameter Setting for GV AS Controllers or click Elevator Parameter for GV EV48 The Parameter Configuration page appears IMPORTANT Once connecting to GV AS GV EV Controller GV ASManager will load its parameters to the controller That means some of the Parameter Settings you have configured here may be overwritten by GV ASManager later 9 2 2 A GV AS1010 1110 210 2110 400 410 4110 810 8110 The contents of Parameter Setting change based on your settings for Door G
82. cscos cece cexesendsaxcwounerusceudecusemssaensweudsesiectpndsoncnecceetoneatens 121 6 26 Connecting the PO esinsin aeaa E E A wooed EREKET RTO TE 122 D O NOr GNO aa E E E E E E E EE en 123 6 3 1 Web Setting Switch cance cecert a cesaateacesdaetahegdabaenteansinmeedabiatuceetenan adanmteanttaceles 123 6 3 2 Resetting the GV AS410 4110 810 8110 ccc ceeceeeeeeeeeeeees 123 6 3 3 Restoring Factory Defaults ccccccccecceccceeceeceeeeeeceeeeeeseeeseeseeeeeeseeesaees 124 6 4 GV AS410 4110 810 8110 Kit Optional ccc cecc eee eeeceeeeeeseeeeeeeeees 125 0AT FACKING EIS hc care Sach cae a a ee eee bee ee ee 125 642 OVE NVI EW o acted aw ra ited iaaSadeeeeg ae r ean 125 6 4 4 GV AS410 4110 810 8110 Kit Specifications cece eee eee eeees 128 60 The WeDIMena E errn eea ut ond dcinecins accutane gcsarmadeasuebeeens tesadeas eed 129 6 5 GV AS410 4110 810 8110 Specifications n0nn0nanonnenennennnenrennnonrnrnnrerrennne 130 To GV EV4SS COMTOUGR ainoina aa 131 121 NTOJUC CIOM a a teiciaedantndenbeiaeeauuudeseedt 132 fekt MaN Feature rnd E aan ntederes 132 Ted Z IACI Listers A EE 132 Ce ASAA e eee E ee 134 7 2 1 Connecting RS 485 Card Readers ccccccccceccseeceeeeeeseeeeeeseeeeeeseeeeesaees 134 1 22 CONMNECUNG OUIDUL REIAY orei cero teeceateecsaccnscsiensinutemsntetoanctanciecenndead 135 7 2 3 Connecting Backup Battery cccccccccceccsecceeeeeeceeeeeeceeeseeseeeseeeeeeseeea
83. ct the hub or switch to the network then it should be other network problems Please contact your network administrator Q3 GV ASManager cannot receive card messages but the reader accepts the card when the connection between the GV ASManager and GV AS GV EV Controller is well established It may be due to memory failure in the GV AS GV EV Controller Reset both the controller module and the Ethernet module to factory settings Refer to Step 3 in Question 1 Q4 The GV ASManager cannot retrieve the video from the DVR for playback 1 Make sure the Remote ViewLog Service on Control Center Server is enabled on the DVR 2 Make sure the time on the GV ASManager and the DVR is consistent 3 Make sure the event file you want to play back has been created completely on the DVR For example the assigned time length of every recorded event on the DVR is 5 minutes The desired event of 5 minutes must have been displayed on the ViewLog Event List so you can access the event file for playback Q5 After add a card by presenting to the reader the message Access Denied Invalid Card still appears It may be the card format is not compatible with the GV AS GV EV Controller Make sure the card format is 26 64 bits Otherwise send us the related information of your card format so that we can customize the format for you 234 11 Troubleshooting Q6 The GV ASManager cannot receive card messages from the GV Reader connected to t
84. d Fire Action Locks or unlocks the door when a fire condition occurs Otherwise remains the door s current state by selecting Unchanged Alarm Continuous Sets the time 1 to 10 sec that the alarm will continuously go off Time before it ends e When Parking Control is selected in the Function Setting page Figure 9 9 these options become available Anti Passback See the same option above Relay On Time Sets the time 1 to 255 sec that a gate remains open after which the gate will automatically be closed Held Open Time See the same option above Fire Action Alarm Continuous Time 165 C GeoVision e When Elevator Control is selected in the Function Setting page Figure 9 9 these options become available Option Description Relay on Time See the same option above Fire Action Alarm Continuous See the same option above Time Alarm Select Yes or No to enable or disable the alarm function If you have defined the alarm conditions in the Input Setting page Figure 9 18 remember to activate the corresponding alarms here otherwise even though the alarm conditions are met the expected alarm will not be triggered The default settings for all the alarms are set to NO Note The Tailgating alarm is currently not functional e When Door Control is selected in the Function Setting page Figure 9 9 these options become available Option Description Held Open This alarm activates whenever
85. d authentication mode for the use of the Doors Gates For GV EV48 select an authentication mode to apply to all floors of the elevator Function Select the function for the reader connected to the Door Gate Door Control The reader is installed in a general door for access control Parking Control The reader is installed in a parking place for access control Elevator Control The reader is installed in an elevator for access control Authentication Mode Select the authentication mode for the Doors Gates or Elevator Local Unlock Mode Remains open The held open state cannot be cleared through GV ASManager Local Lock Mode Remains locked The locked state cannot be cleared through GV ASManager Fixed Card Mode Gants access after the card is presented and ignores the authentication schedule of GV ASManager Fixed Card PIN Mode Grants access after the user presents the card and enters the card s PIN code and ignores the authentication schedule of GV ASManager Fixed Card Common mode Grants access after the user presents the card or enters the door s password and ignores the authentication schedule of GV ASManager Authentication Schedule Mode Follows the authentication schedule set on GV ASManager 162 9 The Web Interface Series Function APB amp Fire This option lets you set the Anti Passback function and fire sensor function across multiple door controllers The Anti Passba
86. d type and create a PIN code for the security card 2 To access security mode press the code 276 x ARM The LCD displays Start Arm Enter PIN Code 3 Press the PIN code of the security card The LCD displays Start Arm Enter Security Card 4 Present the security card The security mode is enabled 1 3 4 B Disabling the Security Mode To disable the security mode press any key enter the PIN code of the security card and present the security card 26 FEB Gv as100 1010 Controller 1 3 5 Setting Parameters You can define the parameters of some features on GV AS100 1010 IMPORTANT Once connecting to GV AS100 1010 GV ASManager will load its parameters to GV AS100 1010 That means some of the parameters you set up here may be overwritten by GV ASManager later 1 Press the code 738 SET 2 Present the Master Card and enter its PIN code The LCD displays Set Local Time 3 Press 0 to change the options Press to select the option for further programming Set Local Time Sets the time time zone and enables daylight saving Set AS100 1010 ID Sets the ID of GV A100 1010 from 1 to 255 Set AS1010 IP Sets the IP of GV AS1010 GV AS1010 only Set Auth Mode Sets an authentication mode for the door gate a Auth Schedule Follows the authentication schedule set on GV ASManager Fixed Card Mode Grants access after the card is presented Ignores the authentication schedule of GV ASManager
87. dd one more card reader to GV AS110 and two more card readers to GV AS1110 for entry and exit applications GV AS110 comes with built in RS 485 and Wiegand interface while GV AS1110 comes with TCP IP network port GV AS110 1110 has the capability to store up to one thousand cards When GV AS110 1110 is being used as a standalone unit the programming is either done on the keypad or from the software GV ASManager GV AS110 1110 is suitable not only for any normal door control but also for parking gate and elevator control GV AS110 1110 is an economic solution for access control Door BEREERRERRERRET RAR ARAR I 5 E 2 3 2 ERERRARBERARAY afa BORI GV ASManager GV HUB GV COM oer GV NET IO Card V3 1 a e megan ai GV ASM ale GV AS1110 Network Reader x2 IN IN or OUT Figure 2 1 35 GeoVision GV AS110 can make network connection to GV ASManager using the optional GV ASBox or GV ASNet With GV ASBox two door control is also possible as illustrated below GV AS110 Wiegand Reader IN OUT Wiegand RS 485 Reader x4 TCP IP GV ASManager Figure 2 2 Through GV ASBox Door GV ASNet GV AS110 Wiegand Reader IN OUT RS 485 Reader x2 GV ASManager Figure 2 3 Through GV ASNet 36 GV AS110 1110 Contr
88. e 255 12899 Normal Per Page 1 1 Figure 9 15 171 C GeoVision 9 2 5 Time Setting In the left menu click Time Setting to set up system time local time and daylight saving time period Time Configuration System Local Time Local Time 2014 12 24 15 08 00 Time Zone 8 00 Local Time Disable Setup Current local time Hour Min 0 T 0 F TimeZone Year Month Date 2009 January 1 Date Hour Min Sec Q F o oF O T Time Davlight Savings Time DST Disable Enable The da Start Date Month y the week Hour Time 0 0 January Sunday O0 e First A a Stop Time 0 0 January First Sunday Submit Cancel Figure 9 16 System Local Time m LocalTime Displays the current date and time of the controller Time Zone Displays the current time zone of the controller 172 9 The Web Interface Local Time m Disable Disable the manual configuration of time and date m Setup Enable the manual configuration of Time Zone Date and Time for the controller You can click the Current local time button to set synchronize the controller s date and time with the PC s current date and time Daylight Savings Time DST m Disable Disable the manual configuration of DST Time Zone Enable the manual configuration of DST by setting the Start Time and Stop Time for the DST period Click Submit button to save the changes or click Cancel button t
89. e GV AS120 Web interface The default value is NO To change the input status see 9 3 2 F In Out Function The table below shows the wire assignments of input connectors on GV AS120 Yellow Door Sensor IN1 LRed Button IN2 Brown IN COM GND 64 3 GV AS120 Controller 3 2 3 Connecting Output Devices GV AS120 supports 1 type of output Door outputs e g electronic lock The table below shows the wire assignments of output connectors on GV AS120 Purple Door COM Check if your output device meets the following absolute maximum ratings before connecting it to the Door outputs Breakdown Voltage 250V AC 220V DC Continuous Load Current 1A 30V DC 0 3A 125V AC Note Absolute Maximum Ratings are those values beyond which damage to GV AS120 circuit board may occur Continuous operation of GV AS120 at the absolute rating level may affect GV AS120 s reliability To connect an output device The example below illustrates the connection of a locking device to GV AS120 Connect the point on the locking device to the Door COM wire on GV AS120 connect the two points of the locking device and the external power supply together and connect the point on the external power supply to the Door NO or Door NC wire on GV AS120 based on the state of the locking device e E External 2 Power Locking Device Orange Door NC Purple Door COM Figure 3 5 65 C GeoVision 3 2 4 Connec
90. e LED on GV AS120 is blue during standby mode and the LED flashes green when a card is granted access or when the operation was successful A red LED indicates access denied or the operation was unsuccessful The LED status and beeper under different conditions are listed below Condition LED Tamper Forced Open Flashes green and red Constant beep until alarm Alarm cancelled Held Open Alarm Unchanged Constant beep until alarm cancelled Access Denied Alarm Flashes red momentarily Short beep for the number of seconds specified Access Denied Flashes red momentarily Two short beeps Access Granted Flashes green momentarily One short beep Enroll Card Flashes green momentarily Two long beeps Enrolled Deleted card Displays green LED One long beep successfully momentarily Enroll Delete card failed Displays red LED Three short beeps momentarily Firmware update Flashes red green and Silent blue Firmware update failed Flashes purple Constant beep Factory default Flashes blue Silent Delete Card Flashes red momentarily Two long beeps 71 C GeoVision 3 5 Web Based Configurations Through GV ASBox or GV ASNet GV AS120 can communicate with GV ASManager over the network Using GV ASBox or GV ASNet you can also access the Web interface of GV AS120 Refer to Chapter 10 Optional Devices to see how to connect a GV ASBox or GV ASNet and how to access the Web interface of GV AS120 72 GV AS120 Controller 3 6 GV AS120 Specific
91. e following types of GV AS GV EV Controllers GV AS Controllers See p 1 See p 58 2 Wiegand only See p 73 4 nT a RS 485 Network 4 E only See p 112 8 Wiegand RS 485 Network GV EV Controllers 2 RS 485 or Network see p 130 viii Important Notes for Maintaining Power Supply To make sure GV AS EV Controllers can function properly during a power outage be sure to replace the internal battery on the controllers when needed It is also recommended to install a backup battery for compatible GV AS Controllers Refer to the following sections for instructions on how to install a backup battery E GV AS100 110 120 through GV ASBox See 10 7 4 F Connecting Backup Battery E GV AS100 110 120 through GV ASNet See 70 2 4 F Connecting Backup Battery E GV AS210 2110 See 4 2 4 Connecting Backup Battery E GV AS400 See 5 6 4 Connecting Backup Battery E GV AS410 4110 810 8110 See 6 2 4 Connecting Backup Battery E GV EV48 See 7 2 3 Connecting Backup Battery The table below lists the types of internal batteries used by different GV AS EV Controllers GV AS EV Controllers GV AS100 400 2110 4110 8110 GV AS1010 110 1110 120 210 410 810 GV EV48 Replaceable Button Cell GV AS100 400 2110 4110 8110 For GV AS100 400 2110 4110 8110 you can replace the battery on your own when you see low battery messages and icons in GV ASManager fy File Monitoring Vie
92. e of GV AS100 1010 m Capacity Displays the total number of events that can be recorded on GV AS100 1010 The maximum number is 65536 GV AS100 1010 will overwrite the oldest events when the limit is reached When GV AS100 1010 is connected to GV ASManager the event data will be uploaded to the server and the buffer of GV AS100 1010 will be cleared Stored Displays the number of events that has been recorded ID amp IP Address Displays the ID and IP address of GV AS100 1010 Display Version Displays the firmware version of GV AS100 1010 29 C GeoVision 1 3 7 Restoring Factory Defaults The restore function is used to clear all configured options and cards from GV AS100 1010 memory and bring back the unit to factory defaults IMPORTANT Restoring default settings will delete all cards enrolled on GV AS100 1010 1 Press the code 737 RES 2 Present the Master Card or Enroll Delete Card and enter PIN Code The LCD displays Default Setting 1 Yes 2 No 3 Press 1 The LCD displays Default Setting Memory Test 4 When the unit returns to factory defaults the LCD displays Enter Master Card 30 FEB Gv as100 1010 Controller 1 4 Web Based Configurations GV AS100 Through GV ASBox or GV ASNet GV AS100 can communicate with GV ASManager over the network Using GV ASBox or GV ASNet you can also access the Web interface of GV AS100 Refer to Chapter 10 Optional Devices to see how to co
93. eatessadeetendacdaeecaceueowacerdcarhtebuesheensct 47 Lo Ir VOC Fala MIN WIG OG eera EE aoa geet E EEEE OERE 48 2 3 1 Adding and Deleting Cards ccccccccccceccseeceeeeeceeseeeceecaeeseeseesaeeseesaeesaes 48 ZO TA Adding a Cald osare E E E 49 Pike Wed l Deling a Card eors n me e e ante NA ER 50 2 3 2 Programming the GV AS110 1110 00 ccc ccc eeceeeeeeeeeeseeeeeeseeeeeeseeees 51 2 4 LED Status and Beeper onennononennensnnnnerrnrersrrrrrrnrerrrrersrrnrersrrrrersrrnrerrrrnrererrnrerrnne 54 2 5 Web Based Configurations cccccccceccsecceeceeeceeeeeeceeeceeceesuecseeseesaeeseeseeeceesaeegaes 56 2 6 GV AS110 1110 Specifications servic caatia vanaataairs cottne penance mnatue voeandedemgnadenceaeieaneas 57 3 GV AS120 C ntrollet gaiaiaciaccenenesreeieccteaeesacovtearacavesbecapanaeinateusanctesabacaseuabrsertaaneciaes 59 ATOU ON E E E E E E EE EEE 60 3 1 1 Main Features sort cccce ae anteenteedeaccdinacameene eeunte sheets tars ecaatessecpaseusceeeta es eqteesuentasecbeae 62 aL PACKING LS en E E nee a ee eee 62 Ie Aaa Mace cette eeesiee E A E E E E EEEE 63 3 2 1 Connecting a Wiegand Reader ccccccecceecceeeeecseeceeeeeeeeeeeeeceeeeeeseeeaeeeaes 64 3 2 2 Connecting Input Devices 20 0 0 ccc cecc ccc cecceeceeec ceases eeeeeceeeeeseesaeeseeeaeesaes 64 3 2 3 Connecting Output DEVICES cece cccceecceeceeeceecaeeceeeeeecesaeeseesaeeseesaeesaes 65 32A COMMECHING tothe PC earair rnr TEER R ERER EIR
94. ect None to Toggle disable the Pulse select between Normal Lighting Input 1 and roe Ltn ane Pulse Lighting output Click Reset button to return the Normal Toggle Pulse Normal Lighting Toggle Lighting or Pulse Lighting triggered state to be normal Note The Reset button is more commonly used for the Toggle or Toggle Lighting output Because once triggered the output will go on forever A Reset button is needed to turn it off Click Submit button to save the changes or click Cancel button to return the changes to its previous state 22 7 C GeoVision 10 3 2 G Extended Reader In the left menu click Extend Reader This Extend Reader Configuration page appears GeoVision Basic Setting Network Setting Other Setting Firmware Update Account Setting Advance Setting Function Setting Parameter Setting Status Monitor Card Information Time Setting In Out Function Extend Device Extend Reader Extend Reader Configuration GV Reader Function Serial Number Function Setting Status ID 0 No Functio ID 1 No Functio ID 2 No Functio ID 3 No Functio GeoFinger Function Serial Number Function Setting Status No Functio No Functio No Functio No Functio Figure 10 28 Define the readers connected to GV AS100 110 120 and then use the Function drop down list to select which door that the GV Reader GV GF Fingerprint Reader is installed GV Reader
95. ect the point on the output device to COM on GV AS210 2110 connect the two points of the output device and the external power supply together and connect the point on the external power supply to the NO or NC of GV AS210 2110 based on the state of the output device NC2 P External COM2 en Device COM S Sy NO1 Figure 4 5 Note If instead of connecting an external power supply you want to connect the output devices to the power outputs on the GV AS210 2110 note that the maximum current of the voltage output is 12V 0 9A 80 4 GV AS210 2110 Controller 4 2 4 Connecting Backup Battery You can connect any battery of 12V 12Ah to GV AS210 2110 to provide backup power when the main power supply fails When the main power supply is removed and the battery voltage level is above 10 2V the battery will support normal operation of the controller Power Jack Battery 12V 12Ah Figure 4 6 4 2 5 Connecting the Power You can connect GV AS210 2110 to power directly using the supplied 12V DC adaptor After power is connected the power LED on GV AS210 2110 should glow Note Power should be applied to the unit when all connections are completed and tested gt Power Source 12V DC 3A power adaptor Power Jack fe GV AS210 GV AS2110 Figure 4 7 81 C GeoVision 4 2 6 Connecting the PC Connecting GV AS210 2110 to a computer allows you to access its Web inter
96. ecurity Mode simply press the PIN code of the Security Card and present the Security Card Two Person 873 When Two Person Entrance mode is enabled Entrance both Two Person A Card and Two Person B Card Disable gt 0 must be presented to unlock the entrance Enable gt 1 To enable Two Person Entrance press x 8731 Two Person 879 When Two Person Exit mode is enabled both Exit Disable gt 0 Two Person A Card and Two Person B Card must be presented to unlock the exit Enable gt 1 To enable Two Person Exit press x 8791 Select Input Specify the input contact type of the door sensor Contact Type in the first blank digit button in the second blank digit and fire sensor in the third blank digit The default value is normally opened NO Note that the third digit fire sensor is not functional for GV AS1110 so you can press either 1 or 0 For example to set the input contact type for door sensor to be normally open NO button to be normally closed NC and fire sensor to be normally open NO press x 426101 Load Default x 3624 To restore GV AS110 to factory default press 362 All configured settings will be cleared and all cards will be deleted from GV AS110 1110 Note The Parking Entry Type and Parking Exit Type only work when the sensor input of Car Detection is activated 53 C GeoVision 2 4 LED Status and Beeper Normally the LED on GV AS110 1110 is blue during standby mode The LED st
97. ed Paraineter Configuration Events Relay On Time 1 255 Common Password Common Password Password Confirm Unmanaged output Checked output pins are in unmanaged mode Toggle All Out Out Out Out25 Out33 Out41 Out Outl0 Outls Out26 Out34 Out4 Outs Outll Out19 Out Out35 Out43 Out4 Out Out20 Out28 Out36 Out44 Outs Outls Out 1 Out29 Outs Out45 Out6 Outl4 Out2 Out30 Out38 Out46 Out OutlS Out23 Out31 Out39 Out4 Out amp Outl6 Out24 Outs Out40 Out4 Output NC NO NO Submit Cancel Figure 9 12 Events e Relay On Time Type a time period between 1 255 seconds After access is granted by swiping a card or entering the password the elevator button will remain accessible for the time period specified After the specified time period the elevator buttons for restricted floors will be locked again 168 E The Web Interface Common Password When Fixed Card Common Mode is selected as Authentication Mode in the Function Setting page Figure 9 9 you can gain access by using a card or entering this Common Password elevator s password Note Users typing the correct Common Password will be granted access to all floors enabled on GV ASManager To apply access control to specified floors you will need to use the identification card or type the card s PIN code Unmanaged Output Elevator floors of the selected output pins
98. ed instructions The Web interface is divided into three sections Basic Setting Advanced Setting and Extended Device 10 3 1 Basic Setting The Basic Setting section consists of four setup pages Basic Setting Network Setting There are different methods to install GV ASBox and GV ASNet on the network See Chapter 8 Installing on a Network Other Setting See 9 1 1 System Setup Firmware Upgrade See 9 1 2 Upgrading Firmware Account Setting see 9 1 3 Changing Login ID and Password 209 C GeoVision 10 3 2 Advanced Settings You can execute and edit door Wiegand operations and settings turn on Alarms view status display card information stored in GV AS100 110 120 set the device time and edit the input output functions The changes in some of the Advanced Setting page will effect the options available on other pages The diagram below shows the relationships between each Advanced Setting page The Relationship Diagram between each Advanced Setting Page Advanced Setting j Affects Function Setting Affects Parameter Setting Status Monitor Affects Card Information Time Setting In Out Function Figure 10 14 Note The Status Monitor and In Out Function pages are only available when connecting through a GV ASBox 210 10 Optional Devices 10 3 2 A Function Setting In the left menu click Function Setting This AS100 AS110 AS120 Function Configuration page appears Note T
99. ees 136 1 24 CONNECUING ING FONO aiena a a idee take 136 L2 o CONMCCUNG INEP osineen tidesbiiele cha ademet elemental chads 137 VO Oer Seling Serer a T 138 7 3 1 Web Setting Switch 0 00000000000000000000a1n00n0rannunnnrannnrnnrannannnrarnnnnenannnnnennnnne 138 E32 Resetting Ne GV HE VGC wise snesote tetintestadodentetinbeutedoiantudinies a 138 7 3 9 REStONING Factory Defaults cncccasuiSceriindeben dee nedecaiievte Neches e een 139 TA INS WV CD IMC ACC siiin E 140 TD GVAEV 4S SDCCHICALONS nrinn eaa a a samxadances arab dcunadsncaaienldcass 141 8 Installing On a NETWOrK sacs cetecncweesamstecesnsteaineineamannasneieeom ete eanetenineiens 142 oE F KeEd IP COMECON eenia EA 144 82 DHCFR COMMECHO Makati crareasstennc ere r 146 G22 COMME CHOMMOVER LAN cesena E S EA 146 8 2 2 Connection over INternet ccc cecc cece secs eee eeeeeceeeseeceeeseeseeeseeseeeseeeeeseees 149 9 TNE Web NMC N AGC cnuennnnnona na a 152 J BaSe SGUN S eonen a a a a ee 154 JT System S etU a sen ig nsdn aia aonecseeebascuade 154 92 gt WO GTAGING ir IMIWAl O sciinde E E 156 9 1 3 Changing Login ID and Password cccccecceecceeceeeceeceeeeeeeeeeseeeseeeaeesees 158 I2 Advanced Sein Siena a ge auiesd ceded eeaentsantane 159 92A FUNCION S CUNO iesea a a ee 161 9 2 2 Parameter SOM srice a e 164 9 2 2 A GV AS1010 1110 210 2110 400 410 4110 810 8110 164 92 2B AY meh 416 ern a 168 92 Or Card SEUNG anea pd sac lag ctarsedt
100. ees 80 4 2 4 Connecting Backup Battery ccccccccccecceccceeceeeeeeseeeeeeseeeeeeseeeseeseeeseesaees 81 42 9 COMMECINAG IMG POWER isrener chee metetasnaaeeles 81 4 2 0 Connecting ING IPC scgaietecenctcaieestictocesciecnucphicbacesdiensasdiatuecneocasuteccesaudedaeebetaame 82 4 2 7 Fitting the Battery GV AS2110 Only cece secs eeec eee eeseeeeeeseeeeeeaeeseees 83 AS OE CRUG 9 saat panacea aca etceact en toa nice contact E nea mata 84 Goal VV CD SCAG SWIKGMa sinsionsiccebeen tad a t e 84 4 3 2 Resetting the GV AS210 2110 00 0 cecccecceeeceeceeeeesaeeseeseeeeeeseeseesaees 84 4 3 3 Restoring Factory Defaults ccc cccccecceeeseeeeeceeseeeeeeseeeeeeseeeseeseeeaeesaes 85 AA The Web INCI ACCS x 2a arnt ec te aa a let soeeuteeseeentatabars tar Geat 86 4 5 GV AS210 AS2110 Specifications siiisdciisiavenstiserderisiawonstdeundacaadpodensonndwabansanvenerees 87 5 GV AS400 Controller ccc cesccceceeeceneeeeeneeneceeeeesenecnesenseneeeesonseeesenseneoneseesones 88 Oe Tt UNI OGUGCIO Met ce crcastecte cart scconssennc caspacieenesbess E Saideasacascsanateidenteccdaanetdegates 89 O lel Mam Feature S airar dice clades a a oy Ai smas wate eased anes E 89 Sh Z PACKING pl ned ee ce eee ee ee eee ene renner 89 OZ MIS CAN ANION e sc ohee sete ah y cisd ohne aaee obi chic r ooarueeuat uanamosaeeee ee 91 22 SCONNMECING Card REAdE S sisaan E E 91 5 2 1 A Wiegand FROAGEIS oxi 5e0 di pccnc eee doe cere eit decree eelaet d
101. efine the reader see the Door Gate Function option in 2 3 2 Programming the GV AS110 1110 Note 1 Network connection with readers is not supported for GV AS110 2 GV AS1010 does not support network connection with GV GF1911 1912 TCP IP Network Reader GV AS1010 Figure 1 8 EJ Gv as100 1010 Controller 1 2 2 Connecting Input Devices GV AS100 1010 supports 3 types of inputs 1 Sensor inputs e g door status sensor 2 Button inputs e g door opener 3 Fire Sensor inputs e g fire detector All inputs are dry contact and can be configured as normally open NO or normally closed NC through the GV AS100 1010 keypad The default value is NO To change the input status see the Set Contact Type option in 7 3 5 Setting Parameters The table below shows the pin assignments of input connectors on GV AS100 and GV AS1010 GV AS100 in Function 13 Fire Sensor IN3 14 INCOM GV AS1010 in Function e rore a Input Button Input Sensor 11 C GeoVision 1 2 3 Connecting Output Devices GV AS100 supports 2 types of outputs 1 Alarm outputs e g siren or bell 2 Door outputs e g electronic lock The table below shows the pin assignments of output connectors on GV AS100 1010 GV AS100 GV AS1010 Pin Function e Aan com Check if your output device meets the following absolute maximum ratings before connecting it to the Door outputs Breakdown Voltage 240V AC
102. en working with GV ASManager GV AS100 1010 can support up to 40 000 cards GV AS100 1 Press the code 227 x CAR 2 Present the Master Card and enter its PIN code The LCD displays Add New Card 3 Press The LCD displays Enter New Card 4 To add a card you can either press the card number or present the card to the unit The LCD displays the card number and these options 1 N 2 A 3 B 4 S N stands for a normal card A stands for a two person A card B stands for a two person B card S stands for a security card 5 Select a card type and enter and confirm a PIN code for the new card The LCD displays Store New Card 1 Yes 2 No 6 Press 1 to save and exit GV AS1010 1 Present the Enroll Card and enter its PIN code The LCD displays Enter New Card 2 To add a card you can either press the card number or present the card to the unit The LCD displays the card number and these options 1 N 2 A 3 B 4 S N stands for a normal card A stands for a two person A card B stands for a two person B card S stands for a security card 3 Select a card type and enter and confirm a PIN code for the new card The LCD displays Store New Card 1 Yes 2 No 4 Press 1 to save and exit 24 EJ Gv as100 1010 Controller 1 3 2 B Deleting a Card GV AS100 1 Press the code 227 x CAR 2 Present the Master Card and enter its PIN code The LCD displays Add New Card 3 Press 0 The LCD displays Del Card Data 4 Press
103. es blue 2 Present a card to be the Enroll Card 3 Present a card to be the Delete Card After 1 to 2 minutes the LED should be a constant blue light to indicate READY 2 3 1 Adding and Deleting Cards Using the two cards you can add new cards to GV AS110 1110 and delete existing cards on GV AS110 1110 Note 1 GV ASManager cannot manage the cards enrolled on GV AS110 1110 since the card data will not be transmitted to GV ASManager 2 The cards added through GV ASManager cannot be deleted on GV AS110 1110 48 2 3 1 A Adding a Card GV AS110 1110 Controller Up to 1 000 cards can be enrolled on GV AS110 1110 directly without needing additional software When working with GV ASManager software GV AS110 1110 can support up to 40 000 cards 1 Present the Enroll Card 2 Enter a 4 digit PIN code for the new card reenter the same 4 digit PIN code and then enter the command code for a desired type of card listed below The LED will blink green and red for about 10 seconds You must finish entering the PIN code twice and the card command code within the 10 seconds Z Normal Card Two person A Card Two person B Card Security Card The door unlocks after a card is presented Normal Cards will not be granted access when Two Person Entrance Exit or Security Mode is enabled In the Two Person Entrance Exit mode the door unlocks only when two person B card is also presented together In the
104. et Multiple GV Readers and GV GF Fingerprint Readers can be connected with a single RS 485 cable to the RS485 B and B on GV ASNet You will need to connect the GV Readers or GV GF Fingerprint Readers to external power supply The figure and table shows the pin assignments for related connectors R5485 Terminal 12 Vout Battery AB ERIE GV Reader GV GF GV Reader GV GF RS485B Fingerprint Readers RS485B Fingerprint Readers Connection Connection To define each GV Reader and GV GF Fingerprint Reader you need to use the GV AS100 110 120 Web interface See 10 3 2 G Extended Reader 205 C GeoVision 10 2 4 C Connecting Backup Battery You can connect any battery of 12V 12Ah to GV ASNet to provide backup power when the main power supply fails When the main power supply is removed and the battery voltage level is above 10 2V the battery will support normal operation of the GV ASNet RS485 Terminal 12 Vout Battery A B AB O O Default O OF Battery 12V 12Ah Figure 10 12 206 10 Optional Devices 10 2 4 D Other Settings The figure below shows the location of the Web Setting Switch Default Button and Power Status LED RS485 Terminal A B AB 4 Web Setting Default CO O L Front View Rear View Figure 10 13 10 2 4 D a Web Setting Switch When the Web Setting switch is set to ON you can modify Advanced Settings of GV AS100 110 120 through the Web interface When the switch
105. ettings Press the Right and Left arrow buttons to select one event type Set Fire Action Locks or unlocks the door gate when a fire condition occurs Set Wiegand Sets the door gate to be exit or entry For the same function see Function 8 2 Advanced Settings 5 5 2 B Displaying System Information To display system information press the code 347 To change options or view the status of each door use the Up and Down arrow buttons Door s Auth Mode Displays the authentication mode of each door Displays what kind of event happened at each door Memory s State Displays the memory usage of GV AS400 m Capacity Displays the total number of events that can be recorded on GV AS400 The maximum number is 65536 GV AS400 will overwrite the oldest events when the limit is reached When GV AS400 is connected to GV ASManager the event data will be uploaded to the server and the buffer of GV AS400 will be cleared m Stored Displays the number of events that has been recorded ID amp IP Address Displays the ID and IP address of GV AS400 Display Version Displays the firmware version of GV AS400 107 C GeoVision 5 6 GV AS Power Board GV AS Power Board is designed for GV AS400 to provide additional power supply for output devices such as locking devices and lights Because GV AS400 circuit board only supplies 12V power combining with GV AS Power Board GV AS 400 can directly drive output devices of 24V AC DC
106. f Cards Network Setting Other Setting Firmware Update 1 228 31386 Account Setting Card List Page 1 Advance Setting Function Setting Parameter Setting Status Monitor Card Information Time Setting IniQut Function Figure 10 21 Card Database Shows the number of cards currently stored in GV AS100 110 120 Card List Displays the list of cards stored in GV AS100 110 120 If there are many pages you can choose to jump to any page by entering the page number in the Page field Click Previous Page button to go to the previous page of the Card List or click Next Page button to go to the next page of the Card List 219 C GeoVision 10 3 2 E Time Setting In the left menu click Time Setting This Time Configuration page appears L GeoVision Basic Setting e Network Setting Time Configuration System Local Time Local Time 2004 12 31 20 16 31 Time Zone 4 00 e Other Setting e Firmware Update f Local Time e Account Setting Advance Setting Disable e Function Setting Setup e Parameter Setting Timez Hour Min e Status Monitor arable 0 sj 10 v Month 2009 January e Card Information Year Date Hour Min 0 v 0 lM e In Out Function Time Extend Device e Extend Reader Daylight Savings Time DST Disable O Enable Month January v Date Hour 31i 0 v 31i 0 Iv Start Time Stop Time January Figure 10 22 System Local Time
107. f alarm conditions see Step 2 Configuring the Doors in Chapter 4 of GV ASManager User s Manual 1 GV AS100 1010 Controller C GeoVision 1 1 Introduction Working as a standalone solution GV AS100 1010 is a card reader with a LCD display and also a single door controller It is possible to add one more card reader to GV AS100 and two more card readers to GV AS1010 for entry and exit applications GV AS100 1010 has the capability to store up to one thousand cards When GV AS100 1010 is being used as a standalone unit the programming is either done on the keypad or from the software GV ASManager GV AS100 1010 is suitable not only for any normal door control but also for parking gate and elevator control Door RS 232 PIRPOPRARARRREN RAR RA oct ARRRRRRERRED SR BRR GV ASManager GV HUB l Wiegand RS 485 GV COM GV AS100 Reader GV NET IO Card IN OUT Door Network BABS DADDD AOBA A Baas B0000000000n0 DOD AOON HRRRRRARRRRABL ORT RRR ERIE ERETEN DAD By GV ASManager GV AS1010 RS 485 Network Reader x2 IN IN or OUT Figure 1 1 EJ Gv as100 1010 Controller GV AS100 can make network connection to GV ASManager using the optional GV ASBox or GV ASNet With GV ASBox two door control is also possible as illustrated below Door RS 485 Wiegand RS 4
108. face and connect it to GV ASManager if the computer is installed with GV ASManager The computer running GV ASManager software can be used to monitor the access information and alarm messages from GV AS210 2110 If connection with GV ASManager is interrupted GV AS210 2110 stores this information on the supplied micro SD card The data stored will be sent to GV ASManager when connection resumes Network Figure 4 8 Note GV AS210 is only compatible with GV ASManager V4 0 or later and GV AS2110 is only compatible with GV ASManager V4 2 3 or later 82 4 GV AS210 2110 Controller 4 2 7 Fitting the Battery GV AS2110 Only GV AS2110 includes a replaceable cell button battery When the power in the battery becomes low a Low Battery message and icon will appear in GV ASManager When this happens replace the battery All settings on GV AS2110 will disappear about 10 hours after the battery stops working and GV AS2110 will be restored to default settings Only available p in GV AS2110 aa RTC Battery GeoVision GV AS2110 Figure 4 9 Note 1 Make sure the plastic insulation film under the battery is removed 2 Itis recommended to replace the battery annually 83 C GeoVision 4 3 Other Settings 4 3 1 Web Setting Switch When the Web Setting switch is set to the ON position you can modify Advanced Settings and Extended Reader of GV AS210 2110 th
109. ferent absolute maximum ratings listed below Additionally you can wire the light switch to the outputs 5 8 for lighting control When the access is granted the light is turned on when the exit is granted the light is turned off See To combine door access with relay activation below Output 5 8 Auxiliary Power Output ke on 1 s Figure 10 5 Outputs 1 4 Absolute Maximum Ratings Breakdown Voltage 271V AC 30V DC Continuous Load Current 5A NO 3A NC Note Absolute Maximum Ratings are those values beyond which damage to GV ASBox circuit board may occur Continuous operation of GV ASBox at the absolute rating level may affect GV ASBox reliability Outputs 5 8 Absolute Maximum Ratings Breakdown Voltage 240V AC 30V DC Continuous Load Current 16A NO 8A NC Note Absolute Maximum Ratings are those values beyond which damage to GV ASBox circuit board may occur Continuous operation of GV ASBox at the absolute rating level may affect GV ASBox reliability 197 GeoVision To connect an output device GV ASBox provides two auxiliary power outputs of 12V DC at a maximum current of 1A If your output device requires higher current you must have the power supplied from an external power supply Connect the point on the output device to COM on GV ASBox connect the points on the output device and the external power supply together and connect the
110. g GV AS1010 to PC ccc ccccceeceeeeeeceeeeeeeeeeaeeeeeseeesees 16 1 2 4 C Switches GV AS100 Only ccc cecc cece eeceeeeeeeeeeeeeeeeseeeseeeeeeeseeeseeess 17 1 29 GONMCGCHNG the POWER sissien tele secewensecieneleseeoensieneiesies 17 TZO PRNO MO BaNG ois cas erasers needs esas decade E sees ss 18 1 2 7 Using the Function Keys GV AS1010 Only cece eccceeeeeseeeeeeseeeeeesees 19 1 3 Programming MOEe cccccccceccecceeceeceece eee eeeeeseeseeseeseeceeeaeeeeeseeseeseeseeteeeeeeeeseeeaes 20 1 3 1 Quick Reference of Programming Table ccccccceecceeceeeceeeeeeceeeeeeeees 22 1 3 2 Adding and Deleting a Card ccccceccccccecceecceeceeceeceeeceeceeeceeseeseeseeeaeesaes 24 ies am Aa lt 0 9 15162 Or 6 anor e ee te E E eee ere nen ent een ae eee eee 24 1 3 2 B Deleting a Card simarin ae d eNe anean nika iann 25 t3 Resetting Ne APB FUNCION secsesssereas a 25 1 3 4 Accessing the Security Mode ccccccecceeceeeceeceeceeseeeceeseeeceeseeeeeeaeeeaes 26 1 3 4 A Enabling the Security Mode ccccccccccecceeceeceeeeeeceeeeeeseeceeeseeeeeeseees 26 1 3 4 B Disabling the Security Mode ccc cece cccceccseeceeeaeeceeeeeseeeeeeeseeseeesees 26 tSo SEWING Parametrs secre encctinewtccherens aisea asea 27 Q GeoVision 1 3 6 Displaying System Information cccccc cece eccceeceeeceeeeeeceeeeeeseeseeeeeeseeseeeeees 29 1 3 7 Restoring Factory Defaults
111. gand connectors to power on each unit Up to 8 GV Readers and GV GF Fingerprint Readers Each unit needs extra power supply from Wiegand connectors Figure 5 3 To connect GV Readers Refer to the following pin assignment for GV Reader wiring Electric Wires on GV Reader RS 485 on GV AS400 Ra o o ooo a Blue RS 485 Light Blue RS 485 93 C GeoVision 5 2 2 Connecting Input Devices GV AS400 provides up to 16 inputs All inputs are dry contact that can be configured as normally open NO or normally closed NC Each input has an LED indicator that turns ON to provide a visual indication that the input device is activated wlelele lelvlele lelviele vlvele elvlele lelviele olvii olviolo R amp 485 Figure 5 4 Use the switch as shown below to change the input state for NO or NC When the switch is pushed up the state is NC When the switch is pushed down the state is NO SW2 is used for inputs 1 to 8 and SW3 is for inputs 9 to 16 EGE ON NC state LE OFF NO state 8 Figure 5 5 Besides having the on board capability of monitoring 16 inputs GV AS400 can be expanded to 64 inputs if 4 units of GV IO Boxes 16 Ports are connected For details see 5 2 6 Connecting External I O Box Note GV AS400 does not support input devices of wet contact 94 5 GV AS400 Controller 5 2 3 Connecting Output Devices GV AS400 provides up to 16 outputs They are divided into two
112. gered when the correct card is presented to enter GV AS400 the elevator Output 01 08 Exit Card Output is triggered when the correct card is presented to exit the elevator GV AS400 Relay See the same function above Output 09 16 Green LED Red LED 180 E The Web Interface 9 2 7 B Output Condition Settings This section explains the output functions available when Output Type is set to Normal Toggle or Pulse AS810 Outputl Outputl6 Configuration Output Function 3A 30VDC 1L10VAC 250VAC AS810_Out1 Door Gate Relay Condition x 2 Input Reader Condition x 2 Output Type Relay 2 Access Granted w Fire Alarm Available in Pulse Figure 9 23 There can be a maximum of 4 conditions that can be set up to trigger an output 2 conditions are Door Gate Relay conditions and 2 conditions are Input Reader conditions Each condition is related to each other through AND OR AND means that all conditions with AND must be triggered before the output is triggered OR means that only 1 of the condition with OR is needed to be triggered before the output is triggered It is also valid to have certain conditions as AND and certain conditions as OR For Pulse output type the output is triggered for the amount of time set in the Sec field seconds In the Output Condition settings these Output Type and Output Condition become available Output Type Output Condition Normal Access Granted Access Granted Acces
113. groups outputs 1 8 and outputs 9 16 located at opposite sides of GV AS400 The two groups of outputs have different absolute maximum ratings If the current of the output device exceeds 130mA you will need to connect the device and an external power supply to outputs 1 8 If the current of the output device is under 130mA you can use outputs 9 16 which only accept the 12V DC internal power supply from GV AS400 circuit board In a real application you may connect door locks to outputs 1 8 and connect LED and Beeper wires of the card reader powered by GV AS400 to outputs 9 16 Each output has an LED indicator that turns ON to provide a visual indication that the output device is activated Besides having the on board capability of monitoring 16 outputs GV AS400 can be expanded to 64 outputs if 4 units of GV IO Boxes 16 Ports are connected For details see 5 2 6 Connecting External I O Box 5 2 3 A Outputs 1 8 Check if your output device meets the following absolute maximum ratings before connecting it to any of outputs 1 8 Breakdown Voltage 110V AC 250V AC 30V DC Continuous Load Current 3A AC 3A DC Note Absolute Maximum Ratings are those values beyond which damage to GV AS400 circuit board may occur Continuous operation of GV AS400 at the absolute rating level may affect GV AS400 reliability 95 C GeoVision To connect an output device Connect the point on the output device to COM on GV AS400
114. guration page appears The contents of Parameter Setting change based on your settings for Door Gate A and Door Gate B in the Function Setting page Figure 10 15 Note The Door B settings and Input Name settings are only available when connecting through GV ASBox AS100 AS110 AS120 Configuration GeoVision Events Basic Setting e Network Setting e Other Setting e Firmware Update e Account Setting Advance Setting Function Setting Status Monitor Card Information Time Setting In Out Function Extend Device e Extend Reader DoorA Anti passback Lock Reset Time Held Open Time Fire Action Alarm Continuous Time Alarm DoorA Held Open Forced Open Fire Alarm Access Denied Tamper Common Password DoorA Common Password Password Confirm AS100 Input Name Input 1 Name Input 2 Name Input 3 Name Input 4 Name No w 5 1 255 5 5 9999 Unchange oO 5 NO INO x INO x INO x L NO y 1 10 eoseosooe eeeeceeeee AS100 Input 1 AS1 00 Input 2 g AS100 Input 3 AS100 Input 4 Figure 10 16 Door B Anti passback Lock Reset Time Held Open Time Fire Action Alarm Continuous Time Door B Held Open Forced Open Fire Alarm Access Denied Tamper Door B Common Password Password Confirm No x 5 1 255 5 5 9999 Unchange x 5 1 10 IMPORTANT Once connecting
115. he wrong card or entering the wrong password Tamper This alarm activates whenever the controller is being physically tampered with e g opening of the controller or sustaining strong impact GV AS100 110 120 have built in sensors for tampering alarm e When Elevator Control is selected in the Function Setting page Figure 10 15 these options become available Option Description See the same option above 216 10 Optional Devices Common Password When Fixed Card Common Mode is selected as Authentication Mode in the Function Setting page Figure 10 15 you can gain access by using the card or entering this Common Password door s password Common Password Door A Gate B Common Password TLLLLLLI Common Password Titiiiit Password Confirm MTTitititt Password Confirm TECTITI Figure 10 19 AS100 Input Name This option is only available for GV ASBox Rename the input names by clicking Submit button to save the changes or click Cancel button to return the changes to its previous state 217 C GeoVision 10 3 2 C Status Monitor In the left menu click Status Monitor to see the status of each input output and alarm Note The Status Monitor page is only available when connecting through a GV ASBox e Control Mode Memory Status C GeoVision Door Local Unlock Mode Used Capacity 36 65535 Door Contact A o Events 49700 Input 1 Alarm Tamper Exit Button A l Forced Open FireAlarm AS100 Input
116. he GV AS GV EV Controller through RS 485 interface 1 Make sure the GV Reader is correctly wiring to the controller and Switch 4 on the GV Reader is set to OFF 2 Make sure the correct GV Reader ID is set on the controller Q7 can t change the Advanced Settings on the Web interface of the GV AS GV EV Controller The Submit button is missing To modify the Advanced Settings make sure the Web Setting Switch on the controllers is set to ON For the location of the Web Setting Switch refer to the Web Setting Switch section of each GV AS GV EV Controller or GV ASNet GV ASBox Q8 After installing GV ASManager the message d3dx9_40 dIl cannot be found appears Make sure DirectX End User Runtimes is installed and restart the computer afterwards To install DirectX End User Runtimes insert the supplied Software DVD to your computer and select Install DirectX End User Runtimes November 2008 Q9 How can find more help Visit our website at http www geovision com tw Write to us at support geovision com tw 235 Appendix Appendix A GV MountA900 for GV AS110 1110 Optional GV MountA9g00 is an optional mounting plate that allows you to attach GV AS110 1110toa US single gang power box e Dimensions 100 x 68 mm 3 9 x 2 7 in e Weight 55 g 0 12 Ib Connecting GV MountA900 1 Attach GV MountA900 to the US single gang power box by securing the screws for holes C as shown below 2 Attach G
117. he Wiegand settings and Door Gate B settings are only available when connecting through GV ASBox AS100 AS110 A5120 Function Configuration GeoVision Basic Setting Network Setting Other Setting ASBox Wiegand Firmware Update ASBox Wiegand Door Gate B Account Setting Door Gate A Advance Setting Function Door Entry Control Function Setting Authentication Mode Authentication Schedule Mode Parameter Setting Status Monitor Door Gate B ee Function Door Entry Control Time Setting In Out Function Authentication Mode Authentication Schedule Mode Extend Device Anti Passback Extend Reader Enable Disable Disable Info IP Delete MasterCard Delete Figure 10 15 ID Enter the ID number for GV AS100 GV AS110 or GV AS120 This ID is used by GV ASManager to differentiate among multiple units of GV AS100 110 120 ID number can only be between 1 and 255 211 GeoVision ASBox Wiegand This option is only available for GV ASBox Select the function for Wiegand Input on GV ASBox from the drop down list m No Function Wiegand Input is not in use Door Gate A Entry Wiegand Input becomes the entry point for Door Gate A Door Gate A Exit Wiegand Input becomes the exit point for Door Gate A Door Gate B Wiegand Input becomes Door Gate B Door Gate A Select the function type and authentication mode for the use of Door Gate A m Function Select the function f
118. he computer used to set the IP address must be on the same network or subnet sequence assigned to the controller 3 GV AS GV EV Controller is able to support two network environments Fixed IP for a static IP address and DHCP for a dynamic IP address assigned by an ISP or DHCP server Based on your network environment refer to the next two sections for setup 143 C GeoVision 8 1 Fixed IP Connection If your network environment supports a static IP address the wiring is illustrated as below Door Elevator Figure 8 1 To assign the GV AS GV EV Controller to a fixed IP 1 Open an Internet browser and type the default IP address https 192 168 0 100 This dialog box appears Welcome to G 45Box WebControl Remember my password Figure 8 2 144 E Installing on a Network 2 Click default value admin for both User name and Password and click OK This page appears L GeoVision Basic Setting e Network Setting e Other Setting e Firmware Update e Account Setting Advance Setting Function Setting Parameter Setting Status Monitor Card Information Time Setting In Out Function Extend Device e Extend Reader Network Configuration Machine Name Machine Name Controller 10 DHCP Client O Enable Disable IP Address Subnet Mask Default Gateway Domain Name Server Domain Name Service Disable Send to Loc
119. ine Name Controller 10 DHCP Client O Disable IP Address Subnet Mask Default Gateway Domain Name Server Domain Name Service O Disable Send to LocalIDDNS Server IP 192 168 O 10 Device Name user Send to DDNS GeoVision DDNS M GeoVision DDNS Host Name Figure 8 5 147 C GeoVision 6 Click Submit to send the information to the LocalDDNS Server When the setting is complete the Status field will indicate Register Success Then the controller can be accessed with the device name Note 1 148 The default value of Device Name is user If more than one controller is connected to the GV ASManager assign each controller a different device name To access the Device Name on GV ASManager open the Controller Setup dialog box and select LocalDDNS in the Network drop down list Controller Setup General Setup Door A Door B Door C Door D General Controller Name Controller 1 Controller ID Interlock Door Door Doore Doord GMT o w 0 _ Enable Daylight Saving Setup Connection O COM Port COM 1 G Network Local GOONS Server IP Port User Password Crypto Key Figure 8 6 E Installing on a Network 8 2 2 Connection over Internet DDNS Dynamic Domain Name System provides another way of accessing GV AS GV EV Controller when using a dynamic IP DDNS assigns a domain name to the controller so the GV ASManager can always acce
120. ing remote fingerprint enrollment type the IP address and port of the GV ASManager s GeoFinger Server You can also complete this step on the Web interface of each GV GF 1921 1922 individually as shown below 187 C GeoVision Other Configuration GeoFinger Server configuration from 1025 to 65535 Controller address configuration Controller is connected IP address 492 ee 5 57 Dynamic Domain Name user dipmap com Figure 9 29 Note 1 To allow network connection you must also enable network connection to the controller on the Web interface of the GV CR420 or GV GF 1921 1922 2 Refer to the table for connecting GV CR420 and GV AS Controllers through network Not Supported MAC Address Barcode Not Supported GF1901 GF1902 GF1911 GF1912 Function Define the GV GF1901 1902 1911 1912 connected to the controller e GV GF1901 GF1902 Select the RS 485 checkbox and type the XID Number located on the back of the reader e GV GF1911 GF1912 Select the RS 485 checkbox only if the GV GF1911 1912 is connected to the controller through RS 485 connection If the reader is using network connection do not check the RS485 box Type the XID Number located on the back of the reader Click Submit to detect the readers If the reader is detected the Connection Status field will be green 188 E The Web Interface 9 3 2 Extended I O In the left menu click Extended I O The Extended
121. ins open after which the door will automatically be locked Set Held Open Sets the time 5 to 9999 sec that a door gate can be held open Time before an alarm is generated set Alarm Event Enables or disables the alarm settings Set Fire Action Locks or unlocks the door gate or remains the current state when a fire condition occurs Set Contact Type Sets the inputs to be normally open NO or normally closed NC Set Function Key Define the function keys to indicate the start time or end time of the attendance activities below GV AS1010 only Work Time Away Overtime Break Time Note The Parking Entry Type and Parking Exit Type only work when the sensor input of Car Detection is activated When the card is present but the sensor inputs are not activated the message No Car In Zone will appear in the GV AS100 1010 s LCD 28 FEB Gv as100 1010 Controller 1 3 6 Displaying System Information To display system information press the code 347 DIS Door s Auth Mode Displays the authentication mode of the door Door s Event Displays what kind of event happened at the door ASBox Comm State Displays the connection status with GV ASBox GV ASNet GV AS100 only m User Disenable The connection to GV ASBox GV ASNet is not enabled Comm Fail The connection to GV ASBox GV ASNet failed Comm Normal The connection to GV ASBox GV ASNet succeeded Memory s State Displays the memory usag
122. it is a cabinet containing a GV AS410 GV AS4110 GV AS810 or GV AS8110 a power adapter board a power supply and a casing for backup battery The power supply provides power to GV AS410 4110 810 8110 and up to 8 output devices 12V 0 9A per device GV AS410 4110 810 8110 Kit is an optional device 6 4 1 Packing List e GV AS410 Kit GV AS4110 Kit GV AS810 Kit GV AS8110 Kit US standard or EU standard e tron box key e ron box screw x 6 e Self adhesive cable tie mounts x 6 e Power cord for battery 6 4 2 Overview Ja A an e My SCCICH OD ee vo 7 9 ee F Haha Ox ee a COA Q A r jeencany p d re am s aC te 50 2 r ZP o e e A RA BI RE RA BA EA RE q a on gt GV AS410 GV AS4110 GV AS810 GV AS8110 Power Supply US or EU standard 8 oo Power Adapter Board Casing for Backup Battery Figure 6 12 125 C GeoVision 6 4 3 Connecting the GV AS410 4110 810 8110 Kit Up to 8 output devices can be powered by the power adapter board Connect each output device to one terminal block on the board 126 Connect the COM pin on GV AS410 4110 810 8110 s output terminal block to the corresponding pin on the power adapter board Connect the NC NO pins according to the state of the output device NO OUT2 COM NC NO OUT1 COM GV AS410 4110 810 8110 NC ON ON W Power Adapter Board Figure 6 13 6 GV AS410 4110 810
123. k function 1 Wiegand interface 8 additional inputs and outputs to GV AS100 GV AS110 and GV AS120 Only works with GV AS100 110 120 This device can add Network function to GV AS100 GV AS110 and GV AS120 xii Only works with GV AS100 110 120 GV Hub can convert the standard RS 232 signal of up to 4 controllers to RS 485 allowing the controllers to connect to computers Only works with GV AS100 110 120 GV COM can convert the standard RS 232 signal of one controller to RS 485 allowing the controller to connect to a computer Only works with GV AS100 110 120 GV Net IO Card can convert the standard RS 232 signal of one controller to RS 485 allowing the controller to connect to a computer Only works with GV AS400 Includes the options of 4 8 and 16 ports Can expand GV AS400 s capability to up to 64 inputs and 64 outputs Only available for GV AS410 4110 810 8110 Includes a GV AS410 4110 810 8110 a power adapter board a power supply and a casing for backup battery The power supply provides power to the controller and up to 8 output devices 12V 9A Only available for GV AS400 410 4110 810 8110 and GV EV48 With the cabinet GV AS GV EV Controllers can be mounted directly to a wall or recessed into the wall Two types of cabinet dimensions are available W x H x D e 383 5 x 443 5 x 112 2 mm 15 1 x 17 5 x 4 4 in e 300 x 420 x 86 mm 11 8 x 16 5 x 3 4 in Only available for GV
124. kup Battery You can connect any battery of 12V 12Ah to GV AS410 4110 810 8110 to provide backup power when the main power supply fails When the main power supply is removed and the battery voltage level is above 10 2V the Discharging LED will light and the battery will support normal operation of the GV AS410 4110 810 8110 Black Figure 6 6 6 2 5 Connecting the Power You can connect GV AS410 4110 810 8110 to power directly using the supplied 12V DC adaptor After power is connected the power LED on GV AS410 810 should glow Note Power should only be applied to the unit when all connections are completed and tested Power LED J 12V DC 5A power adaptor E Figure 6 7 Power Source 121 C GeoVision 6 2 6 Connecting the PC Connecting GV AS410 4110 810 8110 to a computer allows you to access its Web interface and connect it to GV ASManager if the computer is installed with GV ASManager The computer running GV ASManager software can be used to monitor the access information and alarm messages from GV AS410 4110 810 8110 If connection with GV ASManager is interrupted GV AS410 4110 810 8110 stores this information on the supplied micro SD card The data stored will be sent to GV ASManager when connection resumes Network Ethernet AODOOAGDDOAODODOODZ BBB AAAD OaD DADADDODNO TADBASADBOAA
125. n a RS 485 to RS 232 converter is required e Network connection an optional GV ASBox or GV ASNet is required GV AS1110 Network connection 2 2 4 A Connecting GV AS110 to PC RS 485 Connection between GV AS110 and PC The figure below illustrates the RS 485 connection between GV AS110 and the computer For this connection a RS 485 to RS 232 converter between GV AS110 and the computer is required You can use GV accessories such as GV Hub GV COM and GV NET IO Card as the RS 485 RS 232 converter GV HUB GV COM PC GV AS110 GV NET IO Card Figure 2 9 The table shows the wire assignments of RS 485 connection on GV AS110 RS485 RS485 Note When connecting multiple GV AS110 through RS 485 connection you can use the keypad on GV AS110 to program every unit s ID See 2 3 2 Programming the GV AS110 1110 45 C GeoVision Network Connection between GV AS110 and PC The figure below illustrates the network connection between GV AS110 and the computer For this connection a GV ASBox or GV ASNet is required GV ASBox GV ASNet Power In GV AS110 Figure 2 10 Connect two power wires and two RS 485 wires from GV AS110 to GV ASBox GV ASNet The table below shows the wire assignments of RS 485 connection on GV AS110 Ra pw ooo o Black GND See 9 1 4 A Connecting GV AS100 110 120 or 9 2 4 A Connecting GV AS100 1
126. n an Internet browser and type the default IP address https 192 168 0 100 The login dialog box Figure 8 2 appears 2 Inthe User Name and Password fields type default value admin and admin respectively Click OK The Network Configuration page Figure 8 10 appears 3 Click Enable and select Send to DDNS 4 Type Host Name User Name and Password that are registered on the DDNS Server If you select GeoVision DDNS the system will automatically bring up the Host Name L GeoVision Basic Setting Network Setting Other Setting Firmware Update Account Setting Advance Setting Function Setting Parameter Setting Status Monitor Card Information Time Setting In Out Function Extend Device Extend Reader Network Configuration Machine Name Machine Name Controller 10 DHCP Client Enable Disable IP Address Subnet Mask Default Gateway Domain Name Server Domain Name Service Disable Send to LocalDDNS Server IP Device Name Send to DDNS GeoVision DDNS GeoVision DDNS Host Name User Name Password Figure 8 10 5 Click Submit When the setting is complete the Status field will indicate Register Success Then GV AS GV EV Controller can be accessed with the domain name 151 9 The Web Interface 9 The Web Interface After installing the GV AS GV EV Controller on the network you can configure the controller settings on the Web interface The
127. ne nsnswinnnsce te E E EERE Earangi 108 9 0 1 Main FEAE S saree cesce rset pecs area ee eeucaace e AEEKO REK ORENT 108 5 6 2 Connecting Output DOVICES cece ceccceeceeceeeceeeceeceeeseesaeeseeseeeseesaeesaees 109 5 6 3 Connecting the POWED c cccccccsecceccseeceeeseeceeeeeceeeseeceeseeseeseeeseeseeesaees 110 5 6 4 Connecting Backup Battery ccccccccccceccseeceeeeeeceeeseeeeeeseeseeeseeeeeseeeaees 111 5 7 GV AS400 Specifications iacadacniscnndcwwacednneinianiamarwnnaud sdensanarwiaweleceeacwenewbeniehecagcoeneees 112 6 GV AS410 4110 810 8110 Controller cc eccee cee eeeeeceeeeeeeeeeeeeeeeeeeeees 113 Ol MOU a E E E E E A ee 114 6 1 1 Main Features s iedecincataxtcndeedesapdancnnsare nesanessecieseeneiatessentaeeseveeataus ectasteentenecion 114 OTL Packing EiS iesire N EE ENa EEEE 114 SR e E a E E ee E E E ee eee 116 6 2 1 Connecting Card REAdETSS cccccccecceecceeceeeceeeeeeceeeeeceeeseeceeeeeeseeseeesaees 116 6 2 1 A Wiegand REA Cels cccccceccecceeceeceeceeceeceecaeceeeceeceesueceeseesenseesansaes 116 6 2 12 IRO 465 PREAGENS aee E a ai 117 6 2 2 Connecting Input Devices ec ccecc eee neeceeceeeceeeaeecaeeeeesaeeseeseeeeeeseeeaees 119 6 2 3 Connecting Output DeVICES ccc cceccseeceeceeceeeseeceeeseesaeeseeseeeeeeseeesees 120 6 2 4 Connecting Backup Battery cccccccccecceecceeeeeeceeeeeseeeseeseeeseeeeeeseeeees 121 6 2 9 Connecting the POWEN wc
128. necting Card Readers GV AS400 supports two types of card reader interfaces Wiegand and RS 485 The Wiegand interface is compatible with any Wiegand card readers of 26 to 64 bits The RS 485 interface is only compatible with GV Readers and GV GF Fingerprint Readers The card readers of the two interfaces can be used together to work with GV AS400 Connecting GV Readers Connecting Wiegand compatible readers Figure 5 2 GeoVision 5 2 1 A Wiegand Readers GV AS400 provides 8 Wiegand inputs Wiegand A to Wiegand H for connection of Wiegand readers ranging from 26 to 64 bits The table below shows the pin assignments of Wiegand inputs on GV AS400 Please consult the documentation of your Wiegand reader for wiring GND GND of the Power Supply DO Wiegand Data 0 Wiegand Data 1 12V 12V Power Supply If your Wiegand reader is equipped with LED or beeper that can be controlled externally you can connect the control wires to outputs 9 16 on GV AS400 For the connection see 5 2 3 B Outputs 9 16 92 5 GV AS400 Controller 5 2 1 B RS 485 Readers For long distance connection and non Wiegand card readers you can choose the RS 485 connection Up to 8 units of GV Readers and GV GF Fingerprint Readers can be connected together with a single RS 485 cable to the RS 485 interface on GV AS400 When multiple readers are connected together an extra power supply to each unit is required Use 12V power output and GND on the Wie
129. nnect a GV ASBox or GV ASNet and how to access the Web interface of GV AS100 GV AS1010 GV AS1010 can communicate with GV ASManager over the network The network interface also allows you to access the Web interface of GV AS1010 Refer to Chapter 8 Installing on a Network for detailed instructions on setting a fixed or dynamic IP address to access GV AS1010 Refer to Chapter 9 The Web Interface for details on the setup pages of the Web interface Through the Web interface you can configure general settings input output devices associated doors gates and connected readers 31 C GeoVision 1 5 GV AS100 1010 Specifications GV AS100 8 bit RISC microprocessor 1 000 40 000 cards standalone networked or RS 485 mode 13 56 MHz for IS014443A Mifare DESFire Mifare Plus and Mifare Classic 1 RS 485 interface only for 1 GV Reader or GV GF Fingerprint Reader 10 90 RH non condensing 32 FE Gv as100 1010 Controller GV AS1010 32 bit ARM7TDMI 1 000 40 000 cards standalone networked mode 13 56 MHz for IS014443A Mifare DESFire Mifare Plus and Mifare Classic Fingerprint Readers max 2 readers i 10 90 RH non condensing All specifications are subject to change without notice 33 2 GV AS110 1110 Controller GV AS110 1110 Controller 2 1 Introduction Working as a standalone solution GV AS110 1110 is a card reader and also a single door controller It is possible to a
130. nnect the point on the output device to COM on GV AS400 connect the two points of the output device and GV AS Power Board together and connect the power output on GV AS Power Board to the NO or NC on GV AS400 based on the state of the output device GV AS Power Board Q GV AS400 M eee Figure 5 19 5 6 3 Connecting the Power GV AS Power Board accepts the power input of either 24V AC or 24V DC You can use the supplied 24V DC power adaptor to connect to a power source After wiring the power source to the proper connectors on GV AS Power Board turn the Vout Switch to the power current that is connected DC Power Input AC Power Input Vout Swtich Figure 5 20 Note 1 If the power input is 24V AC and the Vout Switch is set to DC Output the voltage of GV AS Power Board supplies will be enlarged to 30V DC 2 Power should only be applied to the unit when all connections are completed and tested 110 5 GV AS400 Controller 5 6 4 Connecting Backup Battery GV AS Power Board supports any battery of 12V 12Ah to provide battery backup when the mains supply fails When the mains supply is removed and the battery voltage level is above 10 2V the battery will support normal operation Se TTL Battery 12V 12Ah Battery foe Black Figure 5 21 Note An internal battery verification will cut the battery power if the battery voltage level falls below 10 2V 111 GeoVision
131. nt Readers 10 1 2 Packing List e GV ASBox e Power Adaptor 12V DC e Power Cord e Battery power cable 191 C GeoVision 10 1 3 GV ASBox Board Layout me lt A Web Setting 5 O zZ LLI Q U O x C GeoVision Weigand GV AS100 110 120 4 GV Readers RS 485_B TERM_ SW1 Figure 10 1 192 10 Optional Devices 10 1 4 Installation This section describes how to connect other devices to GV ASBox 10 1 4 A Connecting GV AS100 110 120 The table and figure below show the pin assignments of related connectors on GV ASBox for connection to GV AS100 GV AS110 and GV AS120 g g Y y WHL g S8r Su WHAL Y S8r Sa SJ pe Y A9 E L OZL OLL OOLSW AD Figure 10 2 42y_ 12V Power Supply to ax GV AS100 110 120 p GV Readers GV AS100 110 120 Connection Connection GND GND for Power Supply to A GV AS100 110 120 GV Readers GV AS100 110 120 Connection Connection Note 1 By default RS 485_A Term and RS 485_B Term are set to OFF 2 When the distance between the GV ASBox and the GV AS100 110 120 is over 600 meters RS 485 A Term must be switched to ON When the distance between the GV ASBox and the GV Readers is over 600 meters RS 485_B Term must be switched to ON 193 GeoVision 10 1 4 B Connecting a Wiegand Reader GV ASBox provides one Wiegand input for connection of the Wiegand compatible reader ranging from 26 to
132. o return the changes to its previous state 173 C GeoVision 9 2 6 Input Setting In the left menu click Input Setting to define the input devices connected to the GV AS Controller The number of input devices supported varies among different models Note The Input Setting page is not available for GV EV48 For GV AS1010 and GV AS1110 the Input Setting page allows you to set the input sensors to NO or NC AS1010 Input Configuration Input Configuration Input Function Input Function 01 Door Car Sensor 02 Door Gate Button 01 Door Car Sensor 03 Fire Sensor 0 Door Gate Button GV AS1010 GV AS1110 Figure 9 17 For other GV AS Controller models additional advanced settings are available Input Configuration Input Function 01 AS810_IN1 AS6810_IN2 Normal Input AllZone Normal Input Latch Enable Figure 9 18 Ass10_IN3 Ase10_IN4 Ase10_INS AS8710_ING Ass10_INF Ase10_INe Note The NO NC option is only available for GV AS1010 1110 210 2110 410 4110 810 8110 For GV AS400 inputs can be set to NO or NC using a physical switch on the GV AS400 board Input devices connected to GV AS100 110 120 will use NO Normally Open circuit 174 9 The Web Interface AS210 Input Configuration Input Function 1 Input Type 2 Input Function 01 AS210_IN1 NO iw Door A vil Door Contact s 02 AS210_IN2 10 Gate B Car Detection 03 AS210_
133. oVision Set Alarm x723___ Event Held Open gt 0 Forced Open gt 1 Tamper gt 2 Fire Alarm gt 3 Access Denied gt 4 Alarm Time 1 10 sec Door Gate 343 Function Door Entry Type 0 Parking Entry Type gt 1 Door Exit Type 2 Parking Exit Type gt 3 Elevator Type gt 4 Set 526 Authentication Schedule Mode gt 0 Mode Fixed Card Mode gt 1 Local Lock Mode gt 2 Local Unlock Mode 3 Fixed Card PIN gt 4 Fixed Card Common 5 52 For the first blank digit enter a number from options 0 to 4 For the second blank digit type 1 to enable the option and O to disable the option For the third and fourth blank digits type the number of seconds the alarm will sound For example to enable the fire alarm for 3 seconds press 233103 Door Entry Type Sets GV AS110 1110 as entry reader of a door The Wiegand reader connected will be set as exit reader Parking Entry Type Sets GV AS110 1110 as entry reader of a parking gate Door Exit Type Sets GV AS110 1110 as exit reader of a door The Wiegand reader connected will be set as entry reader Parking Exit Type Sets GV AS110 1110 as exit reader of a parking gate Elevator Type GV AS110 1110 reader is installed in the elevator for access control For example to set the GV AS110 1110 as an exit reader of a door press 34323 Schedule Mode Follows the authentication schedule set on GV ASManager Fixed Card Mode Grants access after
134. oller 2 1 1 Main Features GV AS110 1 door one way and two way control expandable to 2 doors with optional GV ASBox 1 000 40 000 cards standalone networked or RS 485 mode Easy programming from keypad Built in 3 digital inputs and 2 relay outputs 1 Wiegand output 26 64 bits for extra reader programming Built in 13 56 MHz Reader Built in tampering alarm sensor IP54 compliant housing Anti Passback APB support GV AS1110 1 door one way and two way control 1 000 40 000 cards standalone networked mode Easy programming from keypad Built in 2 digital inputs and 1 relay outputs 1 network interface for connection with GV ASManager and TCP IP reader Built in 13 56 MHz Reader Built in tampering alarm sensor Weather proof and IP66 compliant housing for outdoor use Anti Passback APB support 37 C GeoVision 2 1 2 Packing List e GV AS110 GV AS1110 e Power Adaptor 12V DC 1 25A e Power Cord e Screw x2 e Screw Anchor x 2 e Front Cover Plate x 2 e Enroll Card e Delete Card e GV AS ID F Card x 20 38 GV AS110 1110 Controller 2 2 Installation The wire assignment of the GV AS110 cable data are illustrated below Front View 42 5 0 Figure 2 4 Rear View Wire color Definition Rea VDC Brown IN COM GND Purple Gray Brown White GV AS110 Black White Light Green Q GeoVision cv as110 FE Wieganc DATAO Wieganc DATA Input Door Purple
135. one solution GV AS120 is a card reader and also a single door controller It is possible to add one more card reader to GV AS120 for entry and exit applications GV AS120 has the capability to store up to one thousand cards When GV AS120 is being used as a standalone unit the programming is done from the software GV ASManager through the RS 485 connection GV AS120 is suitable not only for any normal door control but also for parking gate and elevator control GV AS120 is an economic solution for access control Door a ial RS 232 RS 485 GV ASManager GV HUB GV COM GV AS120 Wiegand Reader GV NET IO Card IN OUT Figure 3 1 60 GV AS120 Controller GV AS120 can make network connection to GV ASManager using the optional GV ASBox or GV ASNet With GV ASBox two door control is also possible as illustrated below Door Door RS 485 Wiegand RS 485 GV AS120 Wiegand Reader Reader x4 GV ASBox IN OUT TCP IP GV ASManager Figure 3 2 Through GV ASBox Door RS 485 GV AS Net GV AS120 Wiegand Reader Reader x2 IN OUT TCP IP GV ASManager Figure 3 3 Through GV ASNet 61 Q GeoVision 3 1 1 Main Features e 1 door one way and two way control expandable to 2 doors with optional GV ASBox e 1 000 40 000 cards standalone networked
136. ontrol is selected in the Function Setting page Figure 10 15 these Input Type and Input Function become available Normal Input Enable Latch See the same Input Type above Disable Latch Relay A or B Fire Zone See the Door A or Door B Input Type above Tamper Zone For example the Tamper Zone sensor is installed on GV ASBox So whenever there is any attempt to open the Box the Tamper event occurs and it may trigger the Tamper alarm Note For alarm outputs the corresponding alarms must be enabled YES in the Parameter Setting page Figure 10 16 If alarms are set to be disabled NO the alarm function here will not work when triggered Output Function Here you can define each output device that is connected to GV ASBox such as locking devices various alarms or Exit Button Only Output 5 to Output 8 can be connected to Lights Select from the drop down list to configure Output Type No 1 Figure 10 25 Depending on the chosen Output Type either Output Function No 2 Figure 10 25 or Output Conditions No 3 Figure 10 25 will become available Output Function A As80xouieutt_2 Output Function asBoxoOutput2 3 Output Conditions Output Type Figure 10 25 223 C GeoVision Output Function Settings When Output Type No 1 Figure 10 25 is set to be Door Gate or Relay the options similar to the figure below become available Output Function 1 ASBOX Output 1
137. or GV AS100 110 120 on Door Gate A Door Entry Control Sets GV AS100 110 120 as entry reader on the Door A The Wiegand reader connected on GV AS100 110 120 will be set as exit reader Door Exit Control Sets GV AS100 110 120 as exit reader on the Door A The Wiegand reader connected on GV AS100 110 120 will be set as entry reader Parking Entry Control Sets GV AS100 110 120 as entry reader on the parking Gate A Parking Exit Control Sets GV AS100 110 120 as exit reader on the parking Gate A Elevator Control GV AS100 110 120 is installed in the elevator for access control Note The Parking Entry Control and Parking Exit Control only work when the sensor input of Car Detection is activated When the card is present but the sensor input is not activated the message No Car In Zone will appear in the GV AS100 LCD Authentication Mode Select the authentication mode for the Door Gate A 212 Local Unlock Mode Remains open The held open state cannot be cleared through GV ASManager Local Lock Mode Remains locked The locked state cannot be cleared through GV ASManager Fixed Card Mode Grants access after the card is presented and ignores the authentication schedule of GV ASManager 10 Optional Devices Fixed Card PIN Mode Grants access after the user presents the card and then enters the card s PIN code and ignores the authentication schedule of
138. or RS 485 mode e Built in 2 digital inputs and 1 relay output e 1 Wiegand output 26 64 bits for extra reader programming e Built in 13 56MHz Reader e Built in tampering alarm sensor e Weather proof and IP66 compliant housing for outdoor use 3 1 2 Packing List e GV AS120 e Power Adaptor 12V DC 1 25A e Power Cord e Screwx3 e Screw Anchor x 2 e Security Torx e Enroll Card e Delete Card e GV AS ID F Card x 20 62 GV AS120 Controller 3 2 Installation The wire assignment of the GV AS120 cable data are illustrated below Front View Rear View Figure 3 4 Definition Yellow Door Sensor IN1 63 Q GeoVision 3 2 1 Connecting a Wiegand Reader GV AS120 provides one Wiegand input for connection to the Wiegand reader ranging from 26 to 64 bits Through the Web interface of GV AS120 you can set the Wiegand reader as the entry or exit reader To define the reader see 9 3 2 A Function Setting The table below shows the wire assignments of the Wiegand input on GV AS120 Please consult the documentation of your Wiegand reader for wiring You will need to set up a separate power source to power the Wiegand reader Green Wiegand Data 0 Wiegand Date 1 3 2 2 Connecting Input Devices GV AS120 supports 2 types of inputs 1 Sensor inputs e g door status 2 Button inputs e g door opener All inputs are dry contact and can be configured as normally open NO or normally closed NC through th
139. point on the external power supply to the NO or NC of GV ASBox based on the state of the output device External Power Supply Output Device Q NOS COM5 NCS NO6 COM6 NC6 Figure 10 6 To combine door access with relay activation You can combine door access with relay activation for light control machine control etc so that these will only be active when access is granted For example the light is turned on when a user is granted access to a room the light is turned off when the user exits from the room For this function wire the relay switch to output 5 8 198 10 Optional Devices 10 1 4 F Connecting Backup Battery You can connect any battery of 12V 12Ah to GV ASBox to provide backup power when the main power supply fails When the main power supply is removed and the battery voltage level is above 10 2V the battery will support normal operation of the GV ASBox Battery 12V 12Ah Default Battery Figure 10 7 199 C GeoVision 10 1 4 G Other Settings The figure below shows the location of the Web Setting Switch Reset Button and Default Button AO NO TI L D og U A f Reset EN Default Figure 10 8 10 1 4 G a Web Setting Switch When the Web Setting switch is set to ON you can modify Advanced Settings of GV AS100 GV AS110 and GV AS120 through the Web interface When the switch is set to OFF Advanced Settings are not accessible For details on Advanced
140. r GV AS110 2 GV AS1110 does not support network connection with GV GF1911 1912 TCP IP Network GV AS1110 Reader Figure 2 41 Q GeoVision 2 2 2 Connecting Input Devices GV AS110 supports 3 types of inputs while GV AS1110 supports 2 types of inputs 1 GV AS110 1110 Sensor inputs e g door status sensor 2 GV AS110 1110 Button inputs e g door opener 3 GV AS110 only Fire Sensor inputs e g fire detector All inputs are dry contact and can be configured as normally open NO or normally closed NC through the keypad The default value is NO To change the input status see the Select Input Contact Type option in 2 3 2 Programming the GV AS110 1110 The tables below show the wire assignments of input connectors on GV AS110 and GV AS1110 GV AS110 Door Sensor IN1 LRed Fire Sensor IN3 Brown IN COM GND GV AS1110 Green IN COM GND Blue Door Sensor IN1 Purple Button IN2 42 GV AS110 1110 Controller 2 2 3 Connecting Output Devices GV AS110 supports 2 types of outputs while GV AS1110 supports 1 type of output 1 GV AS110 only Alarm outputs e g siren or bell 2 GV AS110 1110 Door outputs e g electronic lock The table below shows the wire assignments of output connectors on GV AS110 and GV AS1110 GV AS110 Purple Alarm COM Gray Alarm NO Brown amp White Door COM GV AS1110 Check if your output device meets the following absolute maximum ratings before
141. r based on communication modes e Through network connection up to 1000 GV AS GV EV Controllers can connect to GV ASManager e Through RS 485 connection up to 16 GV AS100 110 120 Controllers can connect to the same COM port on a computer running GV ASManager Note For GV AS100 400 2110 4110 8110 it is highly recommended to replace the button cell battery included on the circuit board annually XIV Firmware and Software Compatibility The GV AS GV EV Controllers firmware versions compatible with GV ASManager V4 0 V4 2 3 are listed below V1 06 V1 08 V1 06 V1 07 N A V1 04 V1 06 V1 1 V1 22 V1 1 or earlier V1 22 N A V1 1 V1 11 V1 23 V1 23 V1 23 V1 12 XV C GeoVision Definition Xvi GV AS100 1010 110 1110 120 have built in sensors to detect whether the controller is being physically tampered with i e opening of the controller or sustaining strong impact For GV AS210 2110 400 410 4110 810 8110 the tampering alarm sensor needs to be installed separately and the triggering conditions depend on the type of sensor installed The GV AS Controller also provides output relays for activating and deactivating electric lock siren and emergency door release when tampering is detected by the sensors For configuring input sensors and outputs see Chapter 9 The Web Interface or Web Interface through Optional Devices in Chapter 10 for GV AS100 110 120 For settings o
142. r if the computer is installed with GV ASManager The computer running GV ASManager software can be used to monitor the access information and alarm messages from GV AS400 If connection with GV ASManager is interrupted GV AS400 stores this information on the supplied micro SD card The data stored will be sent to GV ASManager when connection resumes Network mM GV AS400 Figure 5 10 99 Q GeoVision 5 2 6 Connecting the External I O Box To enhance the controller s I O capability up to 4 units of GV IO Boxes can be optionally connected to GV AS400 The choices of the GV IO Boxes include e GV IO Box 4 Ports 4 ports of inputs and outputs respectively e GV IO Box 8 Ports 8 ports of inputs and outputs respectively e GV IO Box 16 Ports 16 ports of inputs and outputs respectively Connect GV IO Box to the RS 485 connectors as illustrated below Multiple GV IO Boxes of different port types can be connected on a single RS 485 cable to work with GV AS400 9LINO RS 485 for external GV IO Box connections Figure 5 11 The RS 485 cable has the limit in communication distance As the distance becomes greater the communication signal may become weak In this case decrease the resistance value by using the switch as shown below Resistance Value 100 5 GV AS400 Controller 5 2 7 Fitting the Battery GV AS400 includes a cell button battery providing power to GV AS400 settings and real
143. r network problems Please contact your network administrator Q2 The connection established between the GV ASManager and GV AS GV EV Controller is interrupted This may be due to IP address conflict Follow these steps to troubleshoot the problem 1 Disconnect the hub or switch which connects to the GV ASManager and the controller from the network 2 Run Windows Command Prompt Take Classic Windows Start Menu for example click Start select Accessories and click Command Prompt 3 Type arp d and press Enter eo C WINDOWS system32 cmd exe Microsoft Windows HP Version 5 1 2600 CG Copyright 1985 2681 Microsoft Corp C Documents and Settings joyce gt arp dua Figure 11 4 4 Give the GV ASManager a fixed IP address that is NOT used by another device See Figure 11 1 5 Open the browser and enter the assigned IP address of the controller The Network Configuration page appears See Figure 11 2 6 Inthe IP address field give the GV AS GV EV Controller an IP address that is NOT used by another device e g 192 168 0 XXX 7 On the GV ASManager enter the following settings See Figure 11 3 Controller ID 1 Network TCP IP IP 192 168 0 XXX Port 4000 233 C GeoVision User admin Password admin Crypto key 12345678 8 The connection between the GV ASManager and GV AS Controller should be established and the connection icon should appear If disconnection happens after you conne
144. rough its Web interfaces When the switch is set to the OFF position Advanced Settings are not accessible For details on Advanced Settings see 8 2 Advanced Settings Web Setting Switch Ethernet ON OFF Figure 4 10 4 3 2 Resetting the GV AS210 2110 To reset GV AS210 2110 press the Reset button in the lower left of GV AS210 2110 circuit board for three seconds Reset Button Micro SD Ethernet Web Settinc Wiegand A Figure 4 11 84 E GV AS210 2110 Controller 4 3 3 Restoring Factory Defaults To restore GV AS210 2110 to factory default settings press the Default button for 10 seconds Power Jack Load Default Button Figure 4 12 85 C GeoVision 4 4 The Web Interface You can install GV AS210 2110 on a network and configure GV AS210 2110 through its Web interface Refer to Chapter 8 Installing on a Network for detailed instructions on setting a fixed or dynamic IP address to access GV AS210 2110 Refer to Chapter 9 The Web Interface for details on the setup pages of the Web interface Through the Web interface you can configure general settings input output devices associated doors gates and connected readers 86 4 GV AS210 2110 Controller 4 5 GV AS210 AS2110 Specifications 1 RS 485 interface only for GV Readers and GV GF Fingerprint Readers max 8 readers Replaceable button cell 10 90 RH non condensing All
145. s Granted Select None to Toaale disable the Pulse select an Input trigger the Held Open Held Open Forced Open Forced Open Exit Button Exit Button Door Contact Car Detection 181 C GeoVision Click Reset button to return the Normal Toggle or Pulse triggered state to be normal Note The Reset button is more commonly used for the Toggle output because once triggered the output will go on forever A Reset button is needed to turn it off Click Submit button to save the changes or click Cancel button to return the changes to its previous state 182 E The Web Interface 9 2 8 Wiegand Function In the left menu click Wiegand Setting to define the connected Wiegand readers The number of Wiegand devices supported varies among different models For GV AS2110 4110 8110 connection status is available and indicated by green or red Note The Wiegand Function setting page is not available for GV AS1010 1110 and GV EV48 Use the drop down list to select the location where the Wiegand reader is installed Wiegand Configuration Wiegand Function Wiegand A Door Gate 1 Entry Wiegand B Door Gate 2 Entry Wiegand C Door Gate 3 Entry Wiegand D Door Gate 4 Entry Wiegand E Door Gate 5 Entry Wiegand F Door Gate 6 Entry Wiegand G Door Gate 7 Entry Wiegand H Door Gate 8 Entry Figure 9 24 183 C GeoVision 9 2 9 Function Key In the left menu click Function Key to define
146. ses parameter settings 737 RES Restores GV AS100 1010 to factory defaults 837 TES Tests numeral keys to see if they can be displayed properly Before programming GV AS100 1010 you also need to know the following keys Used to cancel the selection or go back to the previous page Used to save the data that was modified or programmed in the system and quit 0 Used to go to the next page 21 Q GeoVision 1 3 1 Quick Reference of Programming Table GV AS100 D Q D Q Add New Card 1 N 2 A 3 B 4 S Del Card Data Reset Card s APB Display System Door s Auth Mode Door s Event ASBox Comm State Memory s State TG pe SS SS Es ID amp IP Address po po E O y a Auth Schedule Display Version Set P Set Local Time Set AS100 ID Set Auth Mode Auth Schedule Fixed Card Mode Fixed Card PIN Local Unlock Mode Local Lock Mode ee Door Entry Type Door Exit Type Parking Entry Type Parking Exit Type Elevator Control Fixed Card Common AS100 Function Anti Passback Anti Passback Anti Passback Anti Passback Local Rest Time Set Held Open Time Set Alarm Event Oe gt po po Master PIN Change a o o Held Open Alarm Held Open Alarm Set Fire Action fo Cd re Door Car Sensor Door Gate Button Set Contact Type Q Q D er D 22 EJ Gv as100 1010 Controller GV AS1010 Card Manger Reset Card s
147. signments of RS 485 connection on GV AS120 Red 12V Black GN Blue RS485 A Light Blue RS485 A see 9 1 4 A Connecting GV AS100 110 120 or 9 2 4A Connecting GV AS100 110 120 to see how to connect to GV ASBox or GV ASNet 3 2 5 Connecting the Power The supplied AC adaptor can be connected to any power source supplying from 100 to 240V Connect 12V and GND wires to the supplied power adapter and then connect the power adapter to a power source The table below shows the pin assignments of the power connectors on GV AS120 Wire color Definition Red 12V Black GND Note Power should only be applied to the unit when all connections are completed and tested 3 GV AS120 Controller 3 3 Programming Mode After powering on GV AS120 you must create two cards first an Enroll Card and a Delete Card The Enroll Card is used for adding new cards and the Delete Card is used for deleting cards Either card will allow you to program the various configurations on GV AS120 Note The card complying with ISO 14443A standard for smart card technology can be formatted as an Enroll Card or Delete Card To create the Enroll Card and the Delete Card 1 Power on the unit The LED flashes blue 2 Present a card to be the Enroll Card 3 Present a card to be the Delete Card 4 The GV AS120 will automatically load default and the LED will flash blue and yellow After 1 to 2 minutes the LED should be a constant blue light to indicate READ
148. sion Fire Sensor See the Door Input Type above Tamper Zone For example when the Car Detection sensor detects any car driving by a Park Entry or Exit Button oe Park Exit type of event occurs and the Car Detection parking gate will respond the event accordingly Fire Sensor See the Door Input Type above Tamper Zone For example the Tamper Zone sensor is installed on GV AS Controller So whenever there is any attempt to open the GV AS Controller s cabinet the Tamper type of event occurs and the event may trigger the Tamper alarm Note ils 176 For alarm outputs the corresponding alarms must be enabled YES in the Parameter Setting page Figure 9 10 If alarms are set to be disabled NO then the alarm function here will not work when triggered After upgrading the GV AS400 from previous firmware versions to version 1 03 or later you must first load default to be able to name the sensor inputs E The Web Interface 9 2 7 Output Setting In the left menu click Output Setting The Output Configuration page appears The number of output devices supported varies among different models Note The Output Setting page is not available for GV EV48 AS810 Outputl Output1 Configuration Output Function 3A 30VDC 110VAC 250VAC AS810_0ut1 Gate1 Electric Lock AS810_0ut2 Gate 1 w Event Alarm w AS810_Qut3 Relay2 _ Electric Lock AS810_Out4
149. specifications are subject to change without notice 87 5 GV AS400 Controller 5 GV AS400 Controller 5 1 Introduction 5 1 1 Main Features e 4 doors one way and two way control e Support 8 Wiegand card readers of 26 to 64 bits e Support 8 units of GV Readers and GV GF Fingerprint Readers e Built in 16 digital inputs and 16 relay outputs e O capability expandable to 64 digital inputs and 64 relay outputs with GV IO Box connected e Suitable for door parking and elevator access control 9 1 2 Packing List e GV AS400 e GV AS Power Board e Power Adaptor 24V DC for GV AS Power Board e Power Cord e Adaptor Cable for connection between GV AS400 and GV AS Power Board e GV ASManager Software DVD 89 C GeoVision 5 1 3 GV AS400 Board Layout a gt Z SIJO Q z Zc oe OAA Wiegand A Weomde Weme Wegman Wiesande WesendF Wiegand Wiegand wlelel wlele u jolviolv jolviolv w ele u v e v 0 w elv u w olv w cass aasa asas ceas Jra cass aasa acas aens Lo TOU I UY TOUI10 TOUI11 TOUI12 TOUI13 TOUI14 TOUI19 TOU I 16 Figure 5 1 90 5 GV AS400 Controller 5 2 Installation When you wire any devices to GV AS400 circuit board please note e Carefully remove the blue terminal block and note the block s terminal markings on the circuit board After wring the necessary connections to the terminal block reinsert it onto the circuit board ojalas 5 2 1 Con
150. ss the controller by using the domain name To enable the DDNS function you should first apply for a domain name from the website of the DDNS service provider There are 2 providers listed in the controller GeoVision DDNS Server and DynDNS org To register at the GeoVision DDNS Server see the following instructions For details on DynDNS please consult them at www dyndns org l Card Reader AODAODOCOADDOOAD ADO BABA GV ASManager y Note Two DDNS servers are Door Elevator supported 1 GV Dynamic DNS Server and 2 DynDNS Figure 8 7 Registering a DDNS Domain Name To obtain a domain name from the GeoVision DDNS Server 1 Click the GeoVision DDNS button on the Network Configuration page Figure 8 5 Or open an Internet browser and type the Web address http ns dipmap com register aspx This page appears DynamicDNSO1 Register Username Somerset with sp Password ith spaces o sername will be your Re type Password eseesee Enter the characters as they are shown in the box below iSucy This step helps us prevent automated registrations lt Z AN A N J g j Se J N 7 4 Figure 8 8 149 C GeoVision 2 Inthe Username field type a name Username can be up to 16 characters with the choices of a z 0 9 and Note that space or
151. stored to default settings GV AS100 uses a 3V lithium battery that can be purchased on your own For GV AS1010 contact your sales representative to acquire replacement batteries designated for GV AS1010 Battery Battery GV AS100 GV AS1010 Figure 1 14 Note 1 Make sure the plastic insulation film under the battery is removed 2 Itis recommended to replace the battery annually FE Gv as100 1010 Controller 1 2 7 Using the Function Keys GV AS1010 Only GV AS1010 comes with four function keys On the Web interface of GV AS1010 you can define function keys Refer to the Function Key section in Chapter 9 Before employees present their access card to GV AS1010 they can press the function keys to indicate whether the card swipe is the start or end of Work Time Away Overtime or Break Time You can look up the attendance data in GV TAWeb Refer to the GV TAWeb for Workforce Schedule and Payroll chapter in GV ASManager User s Manual for details Figure 1 15 19 C GeoVision 1 3 Programming Mode After powering on GV AS100 you must create a Master Card first It is required to present the Master Card and enter its PIN code every time before programming GV AS100 For GV AS1010 you must create two cards first an Enroll Card and a Delete Card The Enroll Card is used for adding new cards and the Delete Card is used for deleting cards Either card will allow you to program the various configurations on
152. t has both Wiegand and RS 485 outputs that can be connected to any standard access control panel GV Reader 1352 V2 is a card reader that uses a 13 56 MHz frequency It has both Wiegand and RS 485 outputs that can be connected to any standard access control panel GV RK1352 is a card reader with keypad that uses a 13 56 MHz frequency The reader has both Wiegand and RS 485 outputs that can be connected to any standard access control panel GV R1352 is a card reader that uses a 13 56 MHz frequency The reader has both Wiegand and RS 485 outputs that can be connected to any standard access control panel The reader supports three operation modes Fingerprint Only Fingerprint Card and Card Only In Fingerprint Only mode the fingerprints are enrolled through GV ASManager In Fingerprint Card mode the fingerprint templates are stored on the user card In Card Only mode the users only need to swipe the card to be granted access Readers with optical and Capacitance sensors are available GV CR420 is a card reader with a built in 4MP wide angle IP camera The card reader recognizes identification cards and transmits live view through network connection The GV DFR1352 is a card reader designed to be installed on the door frame for recognizing identification cards Featured with the Wiegand and RS 485 outputs the unit can be connected to any standard access control panel Only works with GV AS100 110 120 The device can add Networ
153. ters to GV AS110 1110 That means some of settings you program here may be overwritten by GV ASManager later Set Password Lock Reset Time Held Open Time Set Fire Action GV AS110 only Local Anti Passback 4 8 digits 578 1 255 seconds 468 5 9999 seconds x 732 Unchanged 0 Unlock Door gt 1 Lock Door gt 2 527 O Disable 1 Enable You can set a password to open the door using this password The Authentication Mode must be set to Fixed Card Common mode Refer to the Set Authentication Mode function below For example to set the door s password as 12345 press x 7 912345 on the keypad Sets a time that the door gate will remain open after which the door will automatically be locked For example to set the lock reset time to be 120 seconds press 5 8120 Sets the time that a door gate can be held open before an alarm is generated If the number of seconds is less than 4 digits add zeros in front of the number to make it 4 digits For example to set the held open time to be 180 seconds enter x 4680180 This function locks or unlocks the door gate or maintains the current status when a fire emergency occurs For example to unlock door during a fire emergency press x 321 Local Anti passback prevents card sharing by not allowing a card to go through an entry twice before first exiting For example to enable Local Anti passback press 52 1 a1 Ge
154. tes the network connection between GV AS1010 and the computer TCP IP GV AS1010 Figure 1 12 Note GV AS1010 is only compatible with GV ASManager V4 2 3 or later FEB Gv as100 1010 Controller 1 2 4 C Switches GV AS100 Only Switch 1 When Switch 1 is ON GV AS100 can connect to GV ASManager GV ASBox or GV ASNet When Switch 1 is OFF the connection is unavailable By default Switch 1 is set to ON Switch 2 When the RS 485 connection between GV AS100 and computer is longer than 600 meters 1968 50 feet the RS 485 signal may become weak In this case turn Switch 2 ON to have a 120 Ohm resistor Figure 1 13 1 2 5 Connecting the Power The supplied power adaptor can be connected to any power source supplying from 100 to 240V Using the supplied power cord and adaptor connect GV AS100 1010 to the power Note Power should only be applied to the unit when all connections are completed and tested 17 C GeoVision 1 2 6 Fitting the Battery GV AS100 1010 includes a battery providing power to GV AS100 1010 settings and real time clock circuitry When the power in the battery becomes low the message Low Battery will appear on GV AS100 1010 LCD In this case replace the battery All settings on GV AS100 1010 will disappear about 10 hours after the battery stops working and GV AS100 1010 will be re
155. the card is presented Ignores the authentication schedule of GV ASManager Local Lock Mode Remains locked The locked state cannot be cleared through GV ASManager Local Unlock Mode Remains open The held open state cannot be cleared through GV ASManager Fixed Card PIN Grants access after the user presents the card and then enters the card s PIN code Ignores the authentication schedule of GV ASManager Fixed Card Common Grants access after card is presented or after the door s password is entered Ignores the authentication schedule of GV ASManager GV AS110 1110 Controller For example to enable the Fixed Card PIN mode press gt 5264 Open door ____ To open the door without presenting a card enter with eae F Enter the 8 digit card the 8 digit card number on the back of the number an number and enter its 4 individual card and its 4 digit PIN code PIN code digit PIN code x743 __ Set an ID number for GV AS110 1110 toa Enter an ID number number between 0 and 255 between 0 and 255 For example to set the ID number to be 3 press x 743003 Security Mode x276___ In the Security Mode no cards can be granted 4 digits PIN code of the access and no one can program the unit Only security card the Security Card can disable the Security Mode To enable the Security Mode press 276 enter the PIN code of the Security Card and press Present the Security Card To disable the S
156. the firmware of the controller To upgrade the firmware of GV AS400 an extra step is required You need to prepare a Jumper and plug it into JP7 or plug GV ASKeypad to GV AS400 E JPG E _ JP7 Z po a Reset Button Figure 9 3 To Upgrade Firmware 1 Inthe left menu click Firmware Update This page appears Firmware Update Firmware Update After pressing the Update button please wait while the update request is being processed After update is completed the device will reboot automatically You can re login afterwards Select Fimwar i Unload Update State Update Process Figure 9 4 2 Click the Browse button to open the firmware file bin 3 Click the Upload button This update procedure may take 60 seconds to complete 156 E The Web Interface 4 When the Update is complete a dialog box appears and asks you to reboot the system Microsoft Internet Explorer Ed P Firmware updating completed Reboot immediately Cancel Figure 9 5 5 Click OK The controller starts the Reboot operation Note 1 Make sure the controller remains powered on during the firmware upgrade 2 Itis required to reboot controller after firmware update Without rebooting the firmware update is not complete 157 C GeoVision 9 1 3 Changing Login ID and Password To change the login ID and password 1 In the left menu click Account Setting 2 On the Security Configuration
157. the function keys on GV AS1010 Note The Function Key setting page is only available for GV AS1010 AS51010 Panel Function Key configuration Function Key Configuration Work Time Start Work Time End Away Start Away End cancer Figure 9 25 Set the function keys to be the start or end of Work Time Away Overtime or Break Time When employees present their access card to GV AS1010 they can press the function keys to indicate whether the card swipe is the start or end of Work Time Away Overtime or Break Time The record can be looked up in GV TAWeb Refer to Chapter 11 GV TAWeb for Workforce Schedule and Payroll in GV ASManager User s Manual for details 184 E The Web Interface 9 2 10 Urgent Card In the left menu click Urgent Card When the battery on GV AS400 runs out of power for more than 10 hours GV AS400 will be restored to default settings causing access to be denied When this happens you can use the Urgent Cards added to the list below to be granted access Note The Urgent Card setting page is only available for GV AS400 To set an access card to be an Urgent Card type the card number in the Card Number field Up to 16 Urgent Cards can be added AS400 Urgent Card Manager Urgent Card Database No Wiegand Bit Card Number 26 Bits 30009519 26 Bits 00000455 26 Bits v 26 Bits v 26 Bits 26 Bits v 26 Bits v 26 Bits v 26 Bits 26 Bits Figure 9 26 185
158. ting to the PC The computer running GV ASManager software can be used to monitor the access information and alarm messages from GV AS120 The communication link between the computer and GV AS120 can be either through RS 485 or network For RS 485 connection a RS 485 to RS 232 converter is required such as a GV Hub GV COM or GV NET IO Card V3 1 For network connection an optional GV ASBox or GV ASNet is required 3 2 4 4 RS 485 Connection The figure below illustrates the RS 485 connection to the computer For this connection a RS 485 to RS 232 converter between GV AS120 and the computer is required You can use GV accessories such as GV Hub GV COM and GV NET IO Card as the RS 485 RS 232 converter RS 485 GV HUB GV AS 120 GV CON GV NET IO Card Figure 3 6 The table shows the wire assignments of RS 485 connection on GV AS120 Light Blue RS485 A 66 3 GV AS120 Controller To define ID number control type and authentication mode Using the GV AS120 Setting AP in the GV ASManager folder you can define the ID number of multiple GV AS120 connected through RS 485 interface as well as set the control type and authentication mode 1 Goto C Access Control ASManager and double click GV AS120 SetupAP V100 exe This dialog box appears m T GY AS Do Setting AP Y1 AX E e e GY Ab boa Setting AP E Open COM Close CUM ID Humber 1
159. tput Type and Output Function become available Electric Lock See the same function above Alarm Event 225 Q GeoVision Output Condition Settings When Output Type No 1 Figure 10 25 is set to be Normal Toggle Pulse Normal Lighting Toggle Lighting or Pulse Lighting the options similar to the figure below become available 2 x Door Gate Relay Conditions 2x Input Conditions ASBO s Output 2 DoorB Relay Aw AND Input 01 Mormal AND Access Granted Fire Event Ww OR Input O2 Available in Pulse Lighting Figure 10 27 There can be a maximum of 4 conditions that can be set up to trigger an output 2 conditions are Door Gate Relay conditions and 2 conditions are Input conditions Each condition is related to each other through AND OR AND means that all conditions with AND must be triggered before the output is triggered OR means that only 1 of the condition with OR is needed to be triggered before the output is triggered It is also valid to have certain conditions as AND and certain conditions as OR Only Output 5 8 can be connected to Lights So Normal Lightning Toggle Lighting and Pulse Lighting can only be selected from Output 5 8 For Pulse and Pulse Lighting the output is triggered for the amount of time set in the Sec field seconds 226 10 Optional Devices In the Output Condition Settings these Output Type and Output Condition options become available Normal Access Granted Sel
160. tting Elevator Parameter Time Setting Figure 9 8 160 E The Web Interface 9 2 1 Function Setting In the left menu click Function Setting The Function Configuration page appears The number of door gate settings or elevator settings available varies among different models Function Configuration ID Door Gate 1 Function Door Control ka Authentication Mode Authentication Schedule Mode Door Gate 2 Function Door Control ka Authentication Mode Authentication Schedule Mode Door Gate 3 Function Authentication Mode Authentication Schedule Mode Door Gate 4 Function Door Control v Authentication Mode Authentication Schedule Mode Door Gate 5 Function Door Control ka Authentication Mode Authentication Schedule Mode Door Gate 6 Function Door Control ka Authentication Mode Authentication Schedule Mode Door Gate 7 Function Door Control ka Authentication Mode Authentication Schedule Mode Door Gate amp Function Door Control Authentication Mode Authentication Schedule Mode Series Function APB amp Fire Enable Disable info IP 2 we a Figure 9 9 161 GeoVision Note For GV EV48 only the ID and the Authentication Mode settings are available ID Enter the ID number for the controller This ID is used by GV ASManager to differentiate among multiple units of controller ID number can only be between 1 and 1000 Door Gate Elevator Select the function type an
161. w Setup Personnel Language Tools Window Help AA VERE OH E ZR al2ae O Status ar uress Tamper Fire Alarm Held Open Tailgating Urgent Code Card Mode Card Mode Card Mode Card Mode Card Mode Card Mode Access Monitor w Event Monitor 4d gt x Info Local Time Low Battery Door AS400 Local Time 3 18 2014 4 38 56 PM GB 3 18 2014 4 42 39 PM Q GeoVision Note Make sure the plastic insulation film under the battery is removed when using GV AS100 400 2110 4110 8110 for the first time The low battery messages and icons will appear if the plastic film is not removed Built in Battery GV AS1010 110 1110 120 210 410 810 amp GV EV48 When the controller runs out of battery the local time on the controller will be reverted back to 1999 12 31 The controller time can be found on the Web interface of the controller on the Time Setting page and in the Access Monitor Alarm Monitor Event Monitor of GV ASManager Time Configuration a iira C GeoVision System Local Time Basic Setting Local Time 2014 04 25 15 42 11 e Network Setting Time Zone 8 00 Other Setting Firmware Update Local Time Account Setting Advanced Setting Disable Function Setting Setup Parameter Farti Hour Min TimeZone Parameter Part2 0 0 s e Input Setting 2009 v January 1 yl When you see the controller year shown as 1999 or 2000 disconnect the controller from
162. wer Adaptor 12V DC 1A Power Cord screw x 3 screw Anchor x 2 Master Card GV AS ID F Card x 20 GV AS1010 GV AS1010 Power Adaptor 12V DC 1 25A Power Cord screw x 3 screw Anchor x 2 Enroll Card Delete Card GV AS ID F Card x 20 FE Gv as100 1010 Controller C GeoVision oul 1 1 3 GV AS100 1010 Board Layout l Input Fire 10 GNC A 9 PWR Oul 12V n a A A Tta MNI en NP OP Ry Oy Ry oa PWR Ir 12V IN 6 R485 B oor NC 5 R6485 B 4 R485 A 3 R485 A 2 GNC gt Ec O HIE 1 PWR Ir 12V n c A tO lMj em NCOP RY NOP RIP A Loa Tampering Alarm Sensor Tampering Alarm Sensor GV AS100 GV AS1010 Figure 1 4 EJ Gv as100 1010 Controller 1 2 Installation Open the GV AS100 1010 to access the terminal block GV AS100 Pin Funcion O 12V Power sensor IN 17 Door COM RS 485 A for ASBox ASNet 43 Fire IN3 or PC connection RS 485 A for ASBox ASNet or PC connection ee p RS 485 B for GV Reader 15 Alarm COM connection RS 485 B for GV Reader 16 Alarm NO connection Wiegand Data 0 17 Door COM on 12V Power Supply 19 Figure 1 5 GV AS1010 Pin Function Pin Function Door COM Door COM Input Sensor AlarmNC 11 RS485 Alarm NC RS485 input Fire Alarm NO RS485 e amen s eo Input Sensor IN COM PWR In 12V RS485 PWR In 12V Figure 1 6 A a 6 8 9 C GeoVision 1 2 1 Connecting Card Readers 1 2 1 A Wiegand

Geovision GV-AS110

Contents

Download Pdf Manuals

Related Search

Related Contents