Home

LevelOne GNS-4001

1. Information TCP IP Windows UNIX Linux Macintosh Web FTP SNMP Email SSL Y gt LAN port settings e Network Teaming Mode Stand Alone z O into e Wake On LAN LAN2 Disabled v gt IP Settings Obtain IP settings automatically DHCP BooTP RARP D Use the following IP settings 22 4 3 Windows Settings NAS server using SMB CIFS protocol short for Server Message Block Common Internet File System a protocol used by Microsoft to share files directories and devices with the Windows client You can configure the Windows Network Settings using the following operating mode Workgroup Mode NAS server becomes a member of a workgroup and communicates with the clients using its internal user database for authentication and do not require other authentication server present in the network Domain Mode NAS server become member of a domain and communicates with the client using the user database stored in an authentication server which must be present in the network Optionally you can register the NAS server to the domain Once registered the NAS server will be created as a machine account on the domain controller And it will use Kerberos as the authentication mechanism which provides better integration into the Windows network environment Configuring Windows Network Settings 1 Click the Enable Windows Network SMB CIFS Protocol checkbox to enable access for SMB client 2 Enter the Workgroup Doma
2. Generate transaction logs when checked it will record which files are added updated or deleted during the data replication The transaction logs are displayed on the SmartSync Summary page 9 5 Backup and Restore System Profiles To recover from system failures it requires restoring data and system configurations Tape backup and SmartSync are for restoring data while system profiles are used for recovering system configurations System profiles are the backups of all system configurations user database and security information Backing Up System Profiles To back up system configurations please open the administration page and go to Backup gt System Profile System profiles are saved manually or on a regular basis as defined on the page System profiles will be saved locally on HD The current backups are displayed on the lower page To delete a system profile check its check box and click the Delete icon Recovering the system configurations when a disaster happens If there is any system failure which causes corrupt system configurations the first step is to reset the system configurations to factory default Go to the Server Shutdown page Check the Reset configuration to factory default option and click the Reboot button The second step is to restore 7 system configurations using one of the system profiles Go to the Backup gt System Profiles Restore page Select a system profile and choose which part of the s
3. 2 5 Accessing the Administration Home Page T There are critical events Please check Web Reminder page Disc Server Cache and manage CD DVD on hard Server Settings Specify server name and date time P e YS Upgrade firmware enable UPS and disks Mount and share cached shutdown CD DVD images cf Network Settings Backup and Restore E Configure IP address file sharing Snapshot Tape backup CD DVD B Aag protocols SNMP email and SSL writing USB SmartSync and system m ne settings recovery Volume Manager Virus Protection Administer JBOD or RAID volumes and fy Real time and scheduled virus set up global hot spare disks iSCSI TREND scanning virus pattern file updates MICRO Security Manager ii Event and Log mE Share folders and assign permissions Configure event notification and view g Maintain user database and quotas event logs Status and Statistic thee Monitor system status Show active connections and open files You can configure the detail settings of your NAS server in the administration home page To access the administration home page of NAS server type the URL name of your NAS server in the address field of the web browser http 192 168 1 254 admin or run the utility NAStool provided in the CD ROM right click on a NAS server on the left hand tree view pane Select Admin page item from the right click menu to open the administration page It will prompt for username and password By fact
4. 9 Backup and Recovery 9 1 Loading and Writing CD DVD Discs Connecting a CD or DVD writer to the NAS server you will be able to load data from CD DVD discs or burn files on writeable CD DVD discs The CD and DVD burning feature turns the NAS server into a device that publishes data beyond the powerful data storage function Loading CD DVD Data The Loader function copies data from a CD or DVD disc to any location inside the NAS server This function is useful when you try to restore the archived data on CD DVD discs or simply copy files from discs to the server Note that the NAS server recognizes only data CD or DVD such as ISO 9660 level 1 2 3 including Romeo Joliet and Rock Ridge extension CD HFS CD DVD UDF High Sierra Hybrid ISO HFS Multi session CD Mixed Mode CD and UDF V1 5 V2 0 Multimedia CD formats such as audio CD or video CD are not supported To load data from CD DVD discs please insert the source disc into the CD or DVD device first Open the Administration Page and select Backup gt Loader Writer Then follow the steps below Server Network Volume Security amp Disc Server Backup Virus Scan Event Status Tape Backup SmartSync Loader Writer System Profiles USB we Summary Server Tasks SmartSync Points Add 1 Select a Source Device where you insert the disc to be loaded Above the Source Device item you will see a device list for your reference 2 Specify the desti
5. 255 255 255 0 Link down 192 168 1 4 255 255 255 0 192 168 1 1 100Mbps full duplex e Network Teaming Mode Stand Alone e Obtain TCP IP settings from Dynamic DHCP e WINS Server IP Address None e DNS Server IP Address 192 168 1 1 e DNS Suffix None e NTP Time Serer IP Address None 4 2 TCP IP Settings TCP IP handles network communications between network nodes that are connected to the network It is important to setting up correct TCP IP setting that for NAS server to function properly Network Teaming Mode The NAS server provides two on board 10 100 1000 or Gigabit Ethernet ports LAN1 amp LAN2 You can configure the Ethernet ports using the following operating modes Stand Alone Each LAN1 amp LAN2 are configured with a unique IP address which are independent to each other Fault Tolerance Uses LAN2 to take over for the LAN1 if LAN1 is fail to connect to the network which designed to ensure server availability to the network Load Balancing Offers increased network bandwidth by allowing transmission to multiple 21 destination addresses using both LAN1 and LAN2Z If the traffic of one of the LAN port starts to get congested requests are then forwarded to the other LAN port with more capacity until the traffic of both LAN ports start to get balance Note that only the LAN1 Ethernet port receives incoming traffic Load Balancing also incorporates Fault Tolerance protection Link Aggregation combines both LAN1
6. Help opens a new browser window with help information When the user page is opened the file browsing window shows all the shares in the server All the File Browsing folders and files are presented as hyperlinks If a folder is clicked it will show its content in the same window When a file is clicked it will either open the file in another browser window or pop up a dialog box for download To move to the upper level of directory click the Up Directory icon Fa To delete files or folders check the checkboxes in the Delete column And click the Delete icon to delete them To rename a file or folder click the Rename icon Zz input the name and press the Enter key If a user has the Full Control access right for a file or folder he can modify its ACL by Q clicking the ACL icon inthe Permission column 60 8 4 Accessing from MacOS After setting the NAS server to operate in the workgroup mode or the domain mode follow the steps below to configure for MacOS user access 1 Enable the Macintosh Network support the AFP protocol Open the administration page and enter the Network gt Macintosh menu Check the Enable Macintosh Network check box and specify the security policy and the AppleTalk zone Then click Apply In the workgroup mode you can only select Local account authentication as the security policy In the domain mode you can select either one 2 Create local user accounts or retrieve domain
7. Status Snapshot Tape Backup Tape Library SmartSync Loader Writer System Profiles gt Write data to CD or DVD discs e Device List Model Name Function ___ Status CD10 DVD RW CH9 Slave RICOH DVD RW MP5240 Loaderriter Ready e Target Device Ci cb10 Source Folders Select Folders Total file size 0MB calculate e Writer Format ISO 9660 with Joliet and Rock Ridge extensions e Disc Yolume Label e Overwrite Options 7 Erase disc before writing I Write disc at low speed 1 Click the Writer tab in Backup gt Loader Writer menu 2 Select the Target Device where you want to burn the blank CD DVD disc s Above the Target Device item you will see a device list for your reference 3 Specify the source folders Please click Select Folders and specify which folders to burn 4 Specify the volume label of the CD or DVD disc 5 Check the overwrite option if you want erase a rewriteable disc first before burning 6 Click Apply to start burning CD or DVD discs E CD10 Task Status Microsoft Internet E plot o x Current Task Writer Device Model PIONEER DVD RW D R 108 Disc Label 123 Disc Format TS0 9660 with Joliet and Rock Ridge exten Task Status Proceeding Task Phase Analyzing volume Start Time 2005 04 07 14 56 29 Remain Time 00 00 00 Processed Folders 0 0 Processed Files 0 0 Size Processed 0 0 MB Source Folders rck acldeep5level frck cdimag
8. Volume Security Disc Server Backup Virus Scan Event Status information File Folder Share ACL Account Quota 17 User Quota Folder Quota Setting the quota limit to 0 will remove the quota limit for that folder i e unlimited disk usage V Enable user quota control Set all quotas to meg set a Recalculate User Name Quota Limit 51 7 Disc Sharing and Data Archiving Disc Server creates and manages CD and DVD disc images for easy and fast disc sharing It relieves the efforts of handling huge amount of discs Thousands of discs can be kept online for user access To protect those disc images all NAS servers are equipped with a robust RAID sub system which features hot spare disks and strong data protection 7 1 Creating Disc Images Using the local optical device to duplicate disc images The simplest and fastest way to create a disc image is to use the CD or DVD device of NAS server to duplicate the inserted discs Usually a CD can be duplicated in 5 to 10 minutes To configure a device so that it can automatically duplicate any inserted discs please go to the Disc Server gt Disc Caching menu page of the administration page In the Device List table click the hyperlink text in the CD Device s Function column and change the CD function to Disc Mirroring The Disc Mirroring Settings section will appear on the page Select a folder as the target location The folder is called Disc Image
9. levelone GNS 4001 4 Bay Gigabit Network Storage User Manual Ver1 0 Electronic Emission Notice Federal Communications Commission FCC This equipment has been tested and found to comply with the limits for a Class A digital device pursuant to Part 15 of the FCC Rules These limits are designed to provide reasonable protection against harmful interference when the equipment is operated in a commercial environment This equipment generates uses and can radiate radio frequency energy and if not installed and used in accordance with the instruction manual may cause harmful interference to radio communications Operation of this equipment in a residential area is likely to cause harmful interference in which case the user will be required to correct the interference at his own expense CE Notice This device complies with the EMC directive of the European Community and meets or exceeds the following technical standard EN 55022 Limits and Methods of Measurement of Radio interference Characteristics of information Technology Equipment This device complies with CISPR Class A standard Warning This is a Class A product In a domestic environment this product may cause radio interference in which case the Safety Information To reduce the risk of fire or electric shock install the unit in a temperature controlled indoor area free of conductive contaminants Do not place the unit near liquids or in an excessiv
10. 4 You will prompt for the administrator password to proceed 5 Select a location where you want to save and specify the name of the export file 6 Click Save To import system settings into NAS Servers 1 Right click any NAS Server and select Import System Settings 2 Or go to Server gt Import System Settings menu 3 You will prompt for the administrator password to proceed 4 You have the option to select a server or an export file as the source 5 Click Next 6 Select the type of system settings you want to import into the target server The detail content of the system settings are displayed in the preview text box beside each selection 7 Click OK NAS Server will reboot automatically 106 Browsing amp Administering Servers Browsing Servers Below is the main window of NAStool Upon execution NAStool brings up Windows Explorer for you to drag amp drop files into My Container for later image building You can disable this option by choosing Tool gt NAStool Options and un checking the option Open Windows Explorer when NAStool starts ini x File Edit View Miror Server Tool Help Stee F220 BRON 4 Desktop Item Name 3 My Computer b System ErrTest D INASUTILCD317 L System Image oO My Container B System Imaged 92 99 NAS Network DL Other 89 NAS Servers g 215 3 9 281km 9 4200TS 9 AlvinNaS AlvinNAs2 J angelnasl ier yy System Enr Test Systerm Image B
11. in the last 30 days the auto scanning will be skipped so that the auto scanning will not be activated too often To enable the feature please click the Configure hyperlink on the Volume Scan page Set the Disk Auto scanning item to Enabled 36 Server Network Volume Security Disc Server Backup Virus Scan Event Status Information Create Delete Expand Migrate Scan iSCSI Recycle Bin we Refresh List of Volumes Volume Name Schedule Free Space Total Space 00500 Weekly 722GB 100 List of Hard Disks No Device Options Configure e Disk Auto scanning Disabled 5 6 Assigning Hot spare Disks The hot spare disks are global which means they are not bound to any specific RAID volumes Whenever a RAID volume goes degraded because of a bad hard disk a hot spare disk will be taken immediately to recover that RAID volume To assign hot spare disks please go to the Volume Create page Specify the volume type as Hot spare Assign the free disks as hot spares by using the dual window panes Click Apply to submit changes To remove disks from the hot spare list please go to the Volume gt Delete page Select the hot spares to be deleted in the Remove Hot Spare Disks table and click Delete Server Network Volume Security amp Disc Server Backup Virus Scan Event Status information Create Delete Expand Migrate Scan iSCSI Recyc
12. it will create one automatically Adding Backup Tasks To arrange backup schedules please open the Administration Page and go to Backup gt Tape Backup page Click the Backup tab You will see a list of scheduled tasks on that page Server Network Volume Security amp Disc Server Backup Virus Scan Event Status Tape Backup SmartSync Loader Writer System Profiles USB ye There is no available device To add a task click the Add Task button Then follow the steps below 1 Select a tape drive for backup 2 Input the tape label for identifying tapes It will append backup start date time to the tape label when running a backup task 3 Specify whether it will be a full or incremental backup task A full backup task copies all selected folders and files into tapes An incremental backup task only copies modified or newly created files since last backup It checks archive bits and only back up those with archive bits set 4 Choose which folders to back up Click the Select Folders hyperlink and select what to back up Your selection will be copied to the lower list box which indicates the folders to back up 5 Specify backup schedule You can start the backup immediately or arrange a schedule The 66 schedule can specified at any weekday or a day of a month 6 Specify whether to overwrite the tape If yes the backup task will rewind the tape to the beginning and overwrite it with backup files If not i
13. 0 NASUTILCD317 System ErrTest CPP40 R My Container System ErrTest CPP40 R 99 NAS Network System ErrTest CPP40 R System ErrTest CPP40 R System ErrTest CPP40 R System ErrTest CPP40 R System ErrTest CPP4o R System ErrTest ppp IMG System ErrTest ttt IMG System Imaget02 O Other a cktarget It displays all the disc images path name size status and file system 108 Tool Bar Functions The tool bar provides an easy access to the main functions of NAStool The following explains what the tool bar icons represent w iD m Fan We K ae a Gy Refresh manually updates the directory content of My Computer or NAS Network Up Directory moves the cursor one level up H e Tree View Mode expands or shrink the directory tree in the tree view pane to the left List View Mode changes the view mode of items in the list view pane to the right ZF Load Container loads a container file into My Container me Mirror CD starts the Mirror CD wizard for duplicating CD images into the NAS Server 4 Ha f Save Container saves data in My Container into a container file Build Image starts the Build Image wizard to build a CD image from My Container into a NAS Server S Quick Setup configures some fundamental parameters of a selected NAS Server You can configure an un initialized or initialized server a i Wizard brings u
14. 5 Creating Share and Assigning Share Permissions for the details of share permissions and NFS security settings You can also go to the Disc Server Disc Shares page to share a single disc Click the Create Disc Share button Specify the share name and click Apply to create the share Select the disc to share in the Share Target tab and click Apply To share multiple discs To share multiple discs go to the Disc Server Disc Shares page Click the Create Group Share button Specify the share name and click Apply to save settings Select the discs to share in the Share Target tab and click Apply Use the Share Permissions tab or the Unix Linux Setting tab if you want to restrict user access To share a disc image folder To share a disc image folder go to the Disc Server Disc Images gt Disc Image Folder menu of the administration page Click the Create hyperlink in the Share column Specify the share name and click Apply Use the Share Permissions tab or the Unix Linux Setting tab if you want to restrict user access You can also go to the Disc Server Disc Shares page to share a disc image folder Click the Create Disc Folder Share button Specify the share name and click Apply to create the share Select the disc image folder to share in the Share Target tab and click Apply Server Network Volume Security amp Disc Server Backup Virus Scan Event Status Information Disc Images Disc Caching Disc Shares D
15. FTP session the server always checks ACL when it receives any FTP requests such as ls put get etc Local accounts and domain accounts are both supported depending on the security policy After setting the NAS server to operate in the workgroup mode or the domain mode follow the steps below to configure for FTP access 1 Enable the FTP Data Access feature Open the administration page and enter the Network gt FTP menu Check the Enable FTP Data Access check box and specify the security policy In the workgroup mode you can only select Local account authentication as the security policy In the domain mode you can select either one Then specify the FTP home directory as volume01 and click Apply to save the settings 2 Create local user accounts or retrieve domain accounts from the domain controller depending on whether the NAS server is in the workgroup mode or the domain mode 3 Configure the folder security settings of volume01 to control user access Click the Set hyperlink to specify the access rights ACL for the FTP home directory volume01 These will be the accounts which are allowed to login the NAS using ftp software Note that the Inherited List will be cleared if you uncheck the Inherit from parent folder check box and click Apply button Now run an FTP client to connect to 192 168 170 172 Login as the user you assign in step 3 above Then you will be able to access volume01 8 6 Accessing from NFS Clients The se
16. Folder which is a folder especially for storing disc images In addition to create a new disc image it can also replace an existing disc image with the duplicated one If the disc image being replaced is shared the duplicated disc image will inherit all the share settings and permissions The CD replacement will happen once and it will return to the previous settings The disc image s name can be either inherited from the CD label or user defined A user defined name will only apply once to the next duplicated disc image If you set the CD function to Direct Access it will mount any disc inserted in the CD DVD device The mounted disc will appear as a folder under the default CDROM share Server Network Volume Security amp Disc Server Backup Virus Scan Event Status Information Disc Images Disc Caching Disc Shares Disc Recording Data Archiving Quick Setup To change the CD function to Disc Mirroring or Loader Wniter please click the hyperlink in the Function column To configure the disc mirroring settings please select a CD device first Device List There is no available device Copying disc images via network filing protocols or Smart Sync The disc images are stored in the disc image folders Administrators can also copy or sync the disc images from one NAS server to another using Windows Explorer MacOS Finder or Smart Sync When disc images are copied to a disc image folder the NAS
17. Load In the Status Load CPU amp Memory You can see the CPU usage and memory usage here Total memory and the current free memory are also shown here Network The network throughput in percentage are showed on here 84 Server Network Volume Security amp Disc Server Backup Virus Scan Event Status Environment Open Files Connections Access Counts Load we gt Fan Status e CPU Fan Control Full speed e CPU Fan Speed 6618 RPM gt Thermal Status e CPU Temperature 45 C 113 F e System Temperature 35 C 95 F gt System Voltages Vcore 1 06V e Vee 4 95V e Vio 1 02V e 12V 12 28V e Voo 3 36V eVis 1 76V e Vss 4 84V Refresh 10 4 Saving System Settings and Status as HTML Files For maintenance or technical support purpose it is helpful and sometimes necessary to have an overview of all system settings current system status and event better all event logs It also helps a lot if a server itself can send out these files by email The NAS server does all the above within several mouse clicks First of all you have to create a system folder which is used for storing these files The system folder is also required when performing tape SMB permissions DISC and system profiles backup To create the system folder please open the Administration Page and go to the Server Maintenance menu On the menu page select a volume to contain the system folder And click Apply to cr
18. Log In the Event Security Log menu you can 1 Select the number of most recent events show on a screen 2 Select the severity level for the events you want to see 3 Click netresn or button to refresh the screen 4 Click Clear or Darton to clear the log 5 Select the protocols and click the Refresh button to show the corresponding events Default event represent general security event of your NAS server that is not related to any protocols 82 Server Network Volume Security amp Disc Server Backup Virus Scan Event Status Configuration Web Reminder System Log Device Log Security Log l x Web Reminder fail 2011 12 09 13 47 12 The HardNisk CH4AVNC WNANNNHI HX 0111PV0 nnt fail mexsanes from S M A R T informatinn Server Network Volume Security Disc Server Backup Virus Scan Event Status Configuration Web Reminder System Log Device Log Security Log y 9 System Log fc Eo Legend l Information W Warning E Error i pm ooo ee 1 2012 01 13 15 47 51 Set dynamic IP address by DHCP for LAN 2 192 168 1 4 00 1f 2012 01 13 15 14 45 Change system date time to 2012 01 13 15 14 S 1 2012 01 13 15 15 21 __ Change system date time to 2012 01 13 15 15 S I 2012 01 13 15 15 21 Change time zone setting to GMT 08 00 Taipei S 1 2012 01 13 15 08 08 Set static IP address for LAN 1 192 168 1254 S 1 2012 01 13 15 07 58
19. Modify if the volume has been shared On the Property page check the Windows Network SMB CIFS checkbox and click Apply 5 Set the share permissions After sharing the volume specify the access rights of local users groups and domain users groups Now Windows users can access the NAS server They can run the Windows Explorer and open the path of nasserver The shared folder volume01 will appear in the window Windows users can also map a network drive to nasserver volume01 or use the net use command in the Command Prompt window The command will be like net use n nasserver volume01 8 3 Accessing from Web Browsers In addition to the administration homepage the NAS server provides the user homepage for normal users to access data in the server With a web browser users can download files create folders upload files and modify ACL To enable user access from web please follow the steps 1 Enable the user homepage Open the administration page and enter the Network gt Web menu Check the Enable Web Data Access check box Specify whether to allow local accounts only or allow both local and domain accounts to access the user page Check other parameters and click Apply 2 Create local user accounts or retrieve domain accounts from the domain controller depending on whether the NAS server is in the workgroup mode or the domain mode 3 Share the volume to network users Go to the Security File Folder menu Find the volume01 en
20. None simple and fast Once you get the image file of the new OS firmware from your vendor open the Administration Homepage of the NAS server and select the Server gt Upgrade menu Specify the full path of the image file or click the Browse button to find it Click Apply to begin The process might take several minutes The server will reboot after the firmware is upgraded Server Network Volume Security Disc Server Backup Virus Scan Event Status information General Password UPS Settings Maintenance Shutdown Upgrade You may upgrade the firmware for new functionality or improved stability when updates are available The system will automatically reboot after the new firmware is applied and all configuration settings will be maintained gt Tasks In Progress Tasks No critical task Specify a Firmware Image File Current Version 1 10 Firmware Image File 16 3 3 Shutting Down the Server Shutdown reboot and startup actions The NAS server can be shut down by pressing the power button twice at the front of the server case The whole shutdown process might take seconds to minutes until data are all safely saved to the hard disks To shut down the server from the Administration Homepage select Shutdown from the Server menu and click the Reboot or Shutdown button You can specify the actions to take during the next startup Recalculate user quota Recalculate the sto
21. Scan Event Status Tape Backup SmartSync Loader Writer System Profiles USB q Summary Server Tasks gt SmartSync Points no SmartSync point Add On the NAS server which acts as the SmartSync client set up a SmartSync task which defines the schedule settings and the source folder To set up a SmartSync task please go to the Backup gt SmartSync gt Task menu on the 13 Administration Page Click the Add Task button Server Network Volume Security amp Disc Server Backup Virus Scan Event Status x Tape Backup SmartSync Loader Writer System Profiles USB z summary Server Tasks SmartSync Tasks No SmartSync Task Add Task There are four steps to take when adding a SmartSync task Step 1 is to specify the IP address of the SmartSync server Please enter the IP address of the NAS server where you create the sync point Step 2 is to choose a sync point of Mirror mode in the SmartSync server Please also provide a user account with the privilege to replicate data to the sync point Step 3 is to complete the task settings On the page you should provide the task name select the source folder to replicate specify the schedule and configure the SmartSync options Step 4 is for confirmation showing the brief information of the task settings Making Disk to disk Backups Two or more NAS server are required one as the SmartSync server the rest as t
22. System start up F W 1 10 2012 01 13 15 06 59 Reboot system Server Network Volume Security Disc Server Backup Virus Scan Event Status Configuration Web Reminder System Log Device Log Security Log e exe _ Device log Display Severity Legend I Information W Warning E Error _batetme E 2012 01 13 15 06 46 Unmount volume successfully test 1 PNA DNA 149 12 92 99 The eecrial nimhar nf HNN amp OVNAGKTT Madal CTONNNNI NN OVTAIAR _ Server Network Volume Security Disc Server Backup Virus Scan Event Status Configuration Web Reminder System Log Device Log Security Log y Select Protocol V DEFAULT V SMB V NFS V ATALK V FTP V HTTP SYNC v iscSI Legend l Information W Warning E Error iDatefTme o oo o o o o o o Desciption i C s C CCCCCS W 2012 01 17 15 17 52 ___ The virus pattern is out of date O O W 2012 01 16 15 17 07 ___ The virus pattern is out of date O O W 2012 01 15 15 16 22 ___ The virus pattern is out of date O O W ET EN 2012 01 13 15 14 50 The virus pattern is out of date 2012 01 13 15 07 58 System start up FAW 1 10 2012 01 12 13 25 14 HTTP admin from 192 168 1 4 login failure 2012 01 14 15 15 37 The virus pattern is out of date 83 10 3 Viewing System Status System Status displays a comprehensive view of the system fan status the
23. accounts from the domain controller depending on whether the NAS server is in the workgroup mode or the domain mode 3 Share the volume to network users Go to the Security File Folder menu Find the volume01 entry and click Create in the Sharing column or click Modify if the volume has been shared On the Property page check the Macintosh Network AFP check box and click Apply 4 Set the share permissions After sharing the volume specify the access rights of local users groups and domain users groups After the configuration is done MacOS 8 or OS 9 users can use the MacOS Chooser or Network Browser to access the NAS server Mac OS X users can use the Connect to Server function to open the NAS server For example open the Connect to Server window in Finder Connect to Server Choose a server from the list or enter a server address At Mac mn fa AppleTalk I FH Mac Fal Local Network j 1 item Address 192 168 170 172 Add to Favorites Cancel Connect You can either type the IP address of NAS Server in the Address field And click Connect to put it on Desktop Or you can click AppleTalk in the middle left window pane to find the zone and the server Once you find the server click Connect to put it on Desktop 61 8 5 Accessing from FTP Clients You can set an FTP home directory in the NAS server for user access Login authentication is done by checking the ACL of the FTP home directory During an
24. address or address range Host IP Host List 44 6 5 Creating Share and Assigning Share Permissions You can share a specific folder in any volume created in the NAS server with others on the network When you create a share you can assign the permission to the share that other users will be allowed or denied when they access the share over the network To create a new share 1 Go to Security File Folder menu 2 Locate the volume you want to share on the volume lists 3 Click the Create hyperlink to share the corresponding volume Then go to Step 9 4 If you want to share an existing folder under a volume click the volume name hyperlink Click the folder hyperlink until you reach the desire directory Then go to Step 8 5 If you want to share a new folder under a volume click the folder hyperlink until you reach the desire directory path 6 Click the Create Folder button to create a new folder 7 Enter a new folder name and click Apply 8 Click the Create hyperlink to share the corresponding folder 9 Enter a unique share name in the Share Name field The share name is what user will see when they connect to this share The actual name of the folder does not change 10 To add a comment about the share type the text in Comment 11 To limit the number of users who can connect to the share on the User limit click Allow and enter a number of users 12 Select the protocols you want to share 13 Click Apply to
25. amp LAN2 into a single channel appearing to use a single MAC address to provide greater bandwidth It must be used with a network switch having the Link Aggregation or Trunking function Wake On LAN NAS server also supports Wake On LAN available for LAN2 only Wake On LAN allows administrators to remotely power on your NAS server to perform maintenance task on the server with no need to go to the server physically Configuring TCP IP Settings 1 Select a Network Teaming Mode from the pull down menu that suit you need 2 Enable or Disable Wake On LAN Available for LAN2 only 3 Click the Obtain IP settings automatically radio button to obtain IP addresses of your NAS server from DHCP BOOP or RARP server on the network 4 Or click the Use the following IP settings radio button to assign the IP addresses manually 5 Note that LAN3 IP address field will appear only when the optional Gigabit Ethernet adapter is installed in your system 6 Input the WINS server IP address 7 Input the DNS server IP address 8 Input the DNS Suffix 9 Input the NTP Time Server IP Address if available 10 Click Apply to save the setting To disable a LAN port enter 0 0 0 0 in its IP address field If you happen to disable all LAN ports and cannot access the administration page please use the LCD panel to change the IP address to non zero values Server Network Volume Security amp Disc Server Backup Virus Scan Event Status
26. can be configured to use different security policies for different network file protocols either authenticated by local accounts only or by both local and domain accounts For example the NAS server can authenticate Windows users by querying the domain controller while at the same time check the MacOS users with local user accounts The administrator can set the SMB CIFS protocol to the domain mode and configure the AFP protocol to apply Local account authentication 8 2 Accessing from Windows There are some configuration jobs to do before Windows users can access the NAS server Please enter the administration homepage first 1 Please configure the NAS server to operate either in the workgroup mode or the domain mode Go to the Network gt Windows menu and select either Workgroup Mode or Domain Mode Also specify the workgroup domain name 2 Create local accounts if the NAS server is in the workgroup mode Go to the Security gt Account gt Local Account page and use the Add User or Add Group button to create local accounts 3 Get domain accounts from the domain controller if the NAS server is in the domain mode Go to the Security Account Domain Account page Get domain user account for the domain controller 58 Next tick some domain account to be cached in NAS server 4 Share the volume to network users Go to the Security File Folder menu Find the volume01 entry and click Create in the Sharing column or click
27. for target authentication 3 Apply the settings Now an iSCSI LUN is a logical volume mapped to the iSCSI target The target and LUN are shown on the list under the iSCSI tab Note The NAS supports 8 iSCSI devices at maximum 4 The LUNs created can be mapped to and unmapped from the iSCSI target anytime You can deactivate or activate by clicking or icon respectively You can delete a target by clicking icon Server Network Volume Security amp Disc Server Backup Virus Scan Event Status Information Create Delete Expand Migrate Scan iSCSI Recycle Bin Y iSCSI target Management Retresh gt iSCSI target list No iSCSI target 39 6 Security Control This chapter covers how to setting up the security control of the files folders and shares stored in NAS server Managing Access Control List ACL file level security file ownership and user quota are also covered in this chapter You can configure the following types of security control on the NAS server 1 Create edit and delete user accounts in the local user database 2 Create shares 3 Configure Files Folders and shares permission 4 Configure local account domain account and UNIX Linux Hosts permission 5 Maintain the ACL table 6 Configure the local user and domain user quota limit 6 1 Security Information The Security Information screen is the statistic of the current security setting of the
28. is allowed to read both read and write and change permission to the file or folder To assign share permission of a share for UNIX Linux Host 1 Go to Security Share menu 2 Locate the share and click assign share permission to this share 3 Click the UNIX Linux Setting tab 4 Assign the UID GID and Permission of this share It will overwrite the ownership and permission of the mount point once the share is mounted by the NFS client If the NIS support is enabled the UID and GID pull down menus will list all NIS users for you to choose 5 You can allow all hosts to access the share with read write or read only permission Then go to Step 9 6 Or you can specify privileged hosts by highlight the host IP from the left hand windows 7 Select the appropriate permission from the pull down menu at the bottom of the left hand windows 8 Assign which UID GID the root account of the UNIX host should be converted into when accessing the share This is the root squash function 9 Click the gt gt button to join the privileged list 10 You can modify the permission of the hosts in the privileged list by first highlight the privileged host and then select the appropriate permission from the pull down menu at the bottom of the right hand windows 11 Click Apply to save the setting 12 If you want to remove shares check the corresponding checkbox located at the end of the row 46 and click Y You can assign the fol
29. is properly configured This chapter describes how to get the NAS server ready for user access from various network OS Before reading on please make sure that the NAS server is configured with an IP address and a volume is created successfully For the rest of the sections we assume that the server name is NAS SERVER the IP address is 192 168 170 172 and there is a volume named volume01 8 1 Workgroup or Domain Mode The NAS server can work in either the workgroup mode or the domain mode In the workgroup mode the administrator creates accounts for the NAS server and maintains the user database per server User authentication is done by checking the local user accounts In the domain mode the NAS server can retrieve user names from the domain controller and rely on the domain controller to authenticate users It can also authenticate users by local accounts In the domain mode when a Windows user requests to access a shared folder the user will be authenticated with the domain accounts first then the local accounts If the user is assigned with proper access rights in the share permissions and the ACL settings the user will be allowed to access the shared folder For those using MacOS web browsers or FTP to access the NAS server the security control mechanism is similar If set to the workgroup mode the NAS server authenticates all users from various network operating systems with local accounts only If set to the domain mode the NAS server
30. not allowed to erase or change what you have written on this volume This setting CANNOT be reverted in any situation please think it twice before you enable it Server Network Volume Security amp Disc Server Backup Virus Scan Event Status Information Create Delete Expand Migrate Scan iSCSI Recycle Bin g There are no free disks to create volumes 5 3 Deleting a Volume To delete a volume go to the Volume Delete page Select the volume to be deleted and click the Delete button Please be very careful because all data in the volume will be destroyed and the RAID configuration will be erased also All hard disk members in this volume will become free disks after the deletion Server Network Volume Security amp Disc Server Backup Virus Scan Event Status information Create Delete Expand Migrate Scan iSCSI Recycle Bin we E To delete a volume or spare disk check its check box and submit the command gt List of Volumes Volume Name Members RAID Type Free Space Total Space Status F test1 HDD1 3 7 8 RAID10 3722GB 100 3722GB gt Remove Hot spare Disks 35 5 4 Expanding a RAID 5 Volume RAID 5 volume expansion makes it possible to enlarge volume capacity without rebooting the NAS server Volume capacity grows on the fly Moreover you do not have to change any share permissions security controls and quota settings after volume expansion Storage
31. point of Distribute mode in the SmartSync server Please also provide a user account with the privilege to request data from the sync point 76 Step 3 is to complete the task settings On the page you should provide the task name select the target folder to receive data specify the schedule and configure the SmartSync options Step 4 is for confirmation showing the brief information of the task settings The SmartSync Options When setting up a SmartSync task you will see the following SmartSync options Compress the data stream during data transmission when checked it will compress data before transmitting to the SmartSync server Sometimes it will make it faster to complete a task However it takes extra CPU time to compress data and may have performance penalty if compression ratio is low Contain security information when checked it will send ACL information to the SmartSync server Bandwidth control limits the maximum bandwidth for the task Include exclude file pattern for excluding or including certain file types in the synchronization For example to exclude WORD files type doc To exclude all WORD files except those beginning with abc type abc doc Perform quick synchronization quick synchronization will only check file date time and size when matching files instead of checking block by block It will soeed up the synchronization a lot while taking the risk that files might not be made identical
32. provide the sync point name and specify which group is allowed to request data from this sync point Set the mode to Distribute Server Network Volume Security amp Disc Server Backup Virus Scan Event Status Snapshot Tape Backup Tape Library SmartSyne Loader Writer System Profiles Summary Server Tasks Add Sync Point Path jb0a select Path Syne Point Name faistr sync e Syne Point Comment distribute data e Group Allowed Admins e Mode Distribute e Option M Generate transaction logs W Use advanced GFS media rotation scheme keep daily backups for o7 days keep weekly backups for U4_ weeks keep monthly backups for fiz Y months Apply Close On the NAS server which acts as the SmartSync client set up a SmartSync task which defines the schedule settings and the target folder To set up a SmartSync task please go to the Backup gt SmartSync gt Task menu on the Administration Page Click the Add Task button Server Network Volume Security 2 Disc Server Backup Virus Scan Event Status Snapshot Tape Backup Tape Library SmartSyne Loader Writer System Profiles Summary Tasks gt SmartSync Tasks SmartSync Server Syne Point Name Schedule Status Add Task Delete Tash Follow the steps to take to add the SmartSync task Step 1 is to specify the IP address of the SmartSync server Step 2 is to choose a sync
33. recover some data Please copy data to a safe place immediately when a volume is in this state Inaccessible Two or more volume members are missing The volume is not mounted and data cannot be accessed Apply Ready The volume settings on the server and those on the hard disks are Apply Degraded inconsistent It means that the server has to read and apply the volume Apply Critical settings from the hard disks After the volume settings are restored it Apply Faulty RW will return to the last known state which is specified in parentheses Apply Rebuild Apply Expand Mounting Mowningihevoumetordawases Scan xx Scanning hard disks for bad sectors The progress is shown in percentage Hot Spare Disks A hot spare disk will be used to rebuild a RAID automatically whenever a RAID volume is degraded because of a bad or missing hard disk Free disks These hard disks are not used yet They can be used to create volumes or assigned as hot spare disks Volume Details and Renaming a Volume To change the name of a volume click its Volume Name hyperlink in the List of Volumes table It brings to another page for displaying detailed information of the volume You can modify the volume name on that page Device View lt is a list of all the storage devices connected with the NAS server including hard disks CD DVD ROM CD DVD writers and tape drives List of hard disks In Volume shows to which volume the hard disk b
34. settings 4 Click the Modify icon and enter the default UID and GID Default setting 0 5 Choose to map all users to the default UID GID or assign UID GID for each user manually 6 Click Set Default link to set the UID GID of all users to the default UlID GID Note that the value 1 24 represent that the UID GID is equal to the default UID GID configured above 7 Click Apply to save the settings Configuring NIS settings The NIS network information services formerly known as Yellow Pages is a UNIX standard for centralizing the management of UNIX resources The NAS server supports the retrieval of user accounts and their UID GID from a NIS server If the NIS support is enabled the NAS server can auto map NIS users with local domain users It matches user names and assigns the UID GID of the matched NIS users to local domain users The user auto mapping function provides better and tighter integration between NFS clients and other network operating systems The steps of enabling NIS support are as follows 1 Check the Enable NIS Support checkbox 2 The NIS domain name is required Please fill in the correct name in NIS Domain Name field 3 If you do not know the IP address of the NIS server please specify Find by broadcast Otherwise specify the IP address in the fields 4 After enabling the NIS support you can auto mapping NIS users with local domain users In UNIX Linux menu click the Modify icon 5 Select Ma
35. the following conditions is met if the free only if volume space is lower than n in other words the data archiving will be skipped if the free volume space is high if the archived data are over n MB GB that is to say the data archiving will be skipped if the archived data are below the threshold Archiving Schedule Specifies the schedule of the archiving task If the schedule is due the NAS server will check if the conditions specified in the Advanced Settings are met If met then perform the data 56 Delete source files after the archiving is completed if checked the NAS server will delete the source files to free up disk space after data are successfully archived as disc imagesor burned to discs Burn Disc if checked it will archive data to CD or DVD discs Multiple CD DVD writers can be specified here Please note that the CD DVD functions must be set to Loader Writer before putting into use for burning Server Network Volume Security amp Disc Server Backup Virus Scan Event Status Information Disc Images Disc Caching Disc Shares Disc Recording Data Archiving Quick Setup l xe List of Running Tasks Refresh Task Name Disc Label Start Time Status No Running Tasks gt List of Task Schedules Task Name Disc Label Schedule No Task Schedules Add Task 57 8 User Access The NAS server fits into the network environment as soon as it
36. to enable the ACL Control 5 Clear the Inherit from parent folder check box 6 Select the users or groups from the left hand windows and click the gt gt button to join the privileged user group list 7 If you want all the subfolders and files inherit the new permission you have just set check the Propagate to all subfolders and files check box 8 Click Apply to save the setting You can assign the following File Folder permission to a user on NAS server No Access NA Account has been denied access to the file or folder Read Only RO Account is allowed to read the file or folder Write Only WO Account is allowed to write to the file or folder Read Write RW Account is allowed to read and write to the file or folder but not to delete it Modify MO Account is allowed to read write and delete the file or folder Full Control FC Account is allowed to read both read and write and change permission to the file or folder Set file folder permission in Windows Network NAS server provides a simple efficient way to set up and maintain file folder security in Windows Network To change permissions you must have been granted permission to do so by the administrator Below is the permission mapping table of NAS server in Windows Network 48 File Folder Permission in NAS system Write Only WO Read Write RW Folder Permission in Windows Network O Full Control O Modify O Read amp Ex
37. 9 rvamom ite Quick Erase Erase Retension scan Inserting and removing tape cartridges The NAS server will initialize the tape library at start up and lock the door To insert or remove tapes from the tape library with no cartridge access ports CAP please unlock the door first Then follow the tape library s instruction manuals to insert or remove tapes Afterwards lock the door again so that the tape library can resume to work It will start the inventory process automatically to read in all media information after the door is locked For some tape libraries which have cartridge access ports CAP use the Import Export function to insert or remove tapes from the tape library To insert a tape first place the tape in the CAP by following the tape library s instruction manual Use the Import function to move the tape to an empty slot The NAS server will read the tape and add it to its inventory To remove a tape use the Export function to move it to the CAP Inventorying tape slots lt checks all the slots of the tape library to see if they are occupied and reads in media information from all the tapes The whole process may take a while depending on the number of tapes and the tape drive speed Erasing a tape The quick erasing function overwrites the tape header only It takes much less time than erasing a tape which wipes out all data in the tape To quick erase or erase a tape please click the radio button
38. E eae ea 66 g USM a Tape LIDT Yoi e aE r E am cde a E EE 68 O 4 Smartsyne NASTENAS DGG Replica tO crore enn eE EET E EA TEET E A NA 73 9 5 Backup and Restore Systemi PrOfile Soora n R E ia 77 OSG BOCKUD USB DEVICE ira ccs E TOE OTE EATEN TN O ETR 78 10 EVENT LOGS AND SYSTEM STATUS coirean E A NNE 80 TOENE a SEINS iaar ecg EE AE ented A AEE E ges ecole ato ana pc male ne waaoues Seca aa 81 TOD CHECKING TIC EVENT LOGS sires rates te tac AEE A oda cat ale rc eae ada CO ata ass tae Ce ida Satoh Stes a a lei 81 10 3 Viewing Systemi StOtUS eases heroes indice E ices wink whale ceed oleh tak NN Red atone Sade hea O enaah tant 84 10 4 Saving System Settings ANd Status AS HTML FIIOS cccccsseccccsseecccnnseccccnscccsenecesaseccsauseessusecssauseessaesessaaaseees 85 10 5 SHALE ACCESS Ne 1 EEAO ce RE EEE 85 11 VIRUS PROTECTION sssrinin E aa 87 LD DITOR OUON eein a N N EN E eae N 87 11 2 Real time Manual anad Schedule SCONNING eiras niana o es EAEE E ERAEN EE EEEE EEEE E EA 87 11 3 Configuring Scan SCUANGS orriren raie TETEA A EE TEE E E TE 89 TAA Upaan VraS POS FIE saa E E T A O 90 12 APPENDIX A PRODUCT SPECIFICATION osica a a te evs eatedeane teas anivanss 91 13 APPENDIX B HARDWARE SETTING ciiin a E 92 Appena C LE DIMOCATOl S ia E E E E EA A N 103 Appendix D UUItY for NAS SVSTEM nrrainn ai iE E E E A a 104 MSONGO aina E E AA EA E A A T EE ee eee 104 DISCOVEHING NAS VSTE a A EA E E A TA 105 BrOWSING amp AGHNMISCCTING Selver Soane Ea EEE E
39. EEE TAO EEE ET T 107 ToolBar FUNCTIONS eera en A N E AAE O aa 109 Mirroring CD DVD Remote rore E E E earmeeeaaeth 110 Archiving Files Asa CD DVD IAC anra r aa a a a e a aa i aeea i A Ti 112 BUNTING DISCHITIOG CS rrn E A AAT E E E ah ence aa ene uies 114 1 Introduction 1 1 Features The NAS server is a premier NAS product featuring tera bytes of massive storage capacity and full range data protection to provide a cost effective highly reliable and high performance storage system for the fast growing network storage demand Deliver storage capacity over tera bytes Expand RAID storage capacity without downtime Feature with hot swappable HDD to maximize storage flexibility Accelerate network throughput with the dual NIC and Gigabit Ethernet support Utilize the power management support with UPS Seamless integration into heterogeneous networking security Backup and archive important data to the local tape drive CD DVD writer or a remote storage server Default Settings IP Address 192 168 1 254 Username admin Password admin This Quick Installation Guide only describes the most basic situations and settings All detailed information is described in the user manual 2 Installing and Starting NAS system This chapter covers the installation procedure of different form factors of NAS server Instruction on how to startup the NAS server by setting up the basic configuration through the Admin Home page or provided software t
40. ID volume is degraded and there is no available hot spare disk for rebuilding the RAID volume will stay in the degraded state In this state you can hot unplug the failed hard disk and plug in a good one in the same HDD tray The RAID volume will rebuild automatically with the new hard disk 1 Identify which hard disk fails The amber LED2 will blink to indicate hard disk failure 2 Unplug the HDD tray and replace the HDD with a good one 3 Plug in the HDD tray Wait until the Green LED is steady on Then you are done 5 9 ISCSI iSCSI Internet Small Computer System Interface an Internet Protocol IP based storage networking standard for linking data storage facilities By carrying SCSI commands over IP networks iSCSI is used to facilitate data transfers over intranets and to manage storage over long distances iSCSI can be used to transmit data over local area networks LANs wide area networks WANs or the Internet and can enable location independent data storage and retrieval Follow the steps below to configure the iSCSI target service on the NAS server 38 1 Click iSCSI tab and Click Add to create a iSCSI target on the NAS 2 Enter the iSCSI target information for configuration Target User Name The name for the target iSCSI Target Lun Select to create an iSCSI target with a mapped LUN and enter the size of LUN The comment for the target iSCSI Authentication None or CHAP Target User Name The name
41. M0000 DataTime B20 6 CPU Fan Speed 10 Configuring the IP addresses using the LCD console 1 After NAS server is boot up the LCD console shows System Ready Press the right button System Ready 2 The IP address of LAN1 is shown Press the middle button to configure LAN1 IP address Note that st using the LCD console the symbol at the right hand upper corner indicates that the IP address can be configured LAN IP 192 168 170 171 3 Move the cursor to Yes by pressing the left button and then press the middle button to confirm Configure LAN 1 Yes fNo Cs Ca C2 4 Move the cursor to the correct position using the left or right button Then press the middle button to change that number LAN1 IP fo2 168 170 171 11 5 After you edit the last digit of the IP address press the right button and configure the Subnet Mask address 6 Repeat Steps 4 to Steps 5 to configure the Subnet Mask and Gateway address 7 After you edit the last digit of the Gateway address press the right button Move the cursor to Save and save the setting or Edit to repeat the above process or Abort to quit the configuration process without saving Exit LAN 1 Menu Save Mdit Abort Cs Ca Ce 8 Repeat the above process to configure the other LAN port 2 4 Configuring the IP addresses using NAStool 9 NAS Network NAStool Desktop File Edit View Miror Server Tool Help Ca
42. NAS server It provides administrator a summary of the security database and the status of the operation mode The Information page is divided into two sections The Security Database section display the number of shares number of ACL nodes and number of user group Number of ACL Nodes Total number of ACL node created ACL tells NAS server which Number of Accounts The total account number of the Local User Group Domain User Group Trust Domain User Group and Unix Linux Host Entry Local User Group Total number of local user group A local user or group is an account that can be granted permissions and rights from NAS server Domain User Group Total number of domain user group Domain users or groups are managed by the network administrator Trust Domain User Group Total number of trust domain user group Host Entry Total number of Unix Linux host entered Folder Quota Total number of Unix Linux host entered The Security Configuration section shows the current security configuration settings of the server Windows Security Mode Display the status of the Windows Network operating mode Status Domain Mode or Workgroup Mode Workgroup Domain Name Display either the workgroup name or domain name Domain Login Account Display the username for retrieving the domain user list in the domain ACL Security Control Display the status of the ACL Security Control Status Enabled or Disabled User Quota Control Display the
43. Refresh Model Name Battery Status Current Power Source Battery Capacity Remaining NIA N A N A N A 18 3 5 Modifying the Administrator s Password Admin is a built in user account for the administrator It is like the root account in UNIX or the administrator account in Windows 2000 or XP Using this account users have access to the administration homepage and all the storage resources By default the password for this user account is empty To prevent security vulnerability it is strongly suggested to specify the password when performing the first time setup of the NAS server To specify or modify the administrator s password please select the Server Password menu on the administration homepage Input the current admin password in the Old Admin Password field and the new password in the New Admin Password and Confirm Admin Password fields Then click Apply The administrator can delegate the administrator s privilege to other users by including them into the Admins built in group Please select the Security gt Account menu Select Admins in the Local User Group window and click Property Specify the users to have the privilege and click Apply Server Network Volume Security amp Disc Server Backup Virus Scan Event Status f information General Password UPS Settings Maintenance Shutdown Upgrade ee By factory default the admin password is empty Itis strongly suggested to assign
44. S connect UPS to the NAS server with an RS 232 or USB cable Then go to the Server UPS Settings menu on the administration page to enable UPS support To use network type UPS connect the UPS to the LAN first Then go to the Server UPS Settings page on the administration page Enable APC Smart UPS series USB UPS Generic serial UPS Type 1 and Type 2 select Network UPS from the UPS Type menu and enter the UPS IP address and correct community Below are the shutdown options on the page Shut down immediately when battery is low Shut down in x minutes when AC fails Turn off UPS when shut down by power failure Specify whether to shut down the server when UPS battery is low Note When utility power fails the NAS server will always shut down Specify how many minutes to wait before shutting down the server when a power event occurs If checked the NAS server will turn off the UPS while it is shutting down by power failure If not the UPS will still be working when the server 1S shut down Server Network Volume Security amp Disc Server Backup Virus Scan Event Status Information General Password UPS Settings Maintenance Shutdown Upgrade ah Enable UPS Support e UPS Type UPS IP Address Community e Shutdown Control Shut down immediately when battery is low Shut down minutes after AC power failure Turn off UPS when shut down by power failure e UPS Information
45. System imaget02 BS Other A a colt seant x 2004 04 22 PM 02 27 14 The main window consists of a file menu a tool bar a tree view pane on the left a list view pane on the right and a status bar on the bottom On the tree view pane are listed all the NAS Servers found by the NAStool on the network Also included is My Computer as the one in Windows Explorer My Container keeps information of the files folders that can be built as a CD image in a NAS Server using the Build Image function If you click on any item on the tree view pane its content will be displayed in the list view pane The status bar indicates NAStool status amp information The left of the status bar shows function hint or item properties To the right it displays the PC date and time You can browse the Domain Name IP Addresses of each NAS Server just by mouse over it Note If a NAS Server is protected by the admin password you have to enter the password to set up or write to the server The following are some icon representations dy NAS Network display all the NAS Servers found on the LAN NAS Server represents a NAS Server Disc Image Folder contains disc images of the NAS Server You can double click to view its content 107 Disc Image represents a mirrored CD DVD image The following are some examples of browsing the servers Example 1 Content of a disc image folder BJ My Computer System ErrTest CPP40 R
46. a non empty admin password to ensure secured management Old Admin Password New Admin Password Confirm Admin Password Apply 19 4 Network Configuration This chapter details concepts and procedures for configuring the NAS server and establishing the system that can communicate among various OS platforms Management protocol and email notification setting are also covered in this chapter 4 1 Network Information The Network Information screen is the summary of the current network settings of the NAS server It provides the administrator a quick look of the basic network setting of the NAS server The Information page is divided into two sections The Network Protocols section displays the current network protocol settings of the server Protocol Type Display network protocol supported by the server Configuration Current status of the network protocol Status Enabled or Disabled Security Policy Display type of the security policy of the network protocol The TCP IP Suite Settings section shows the various TCP IP settings of the server An identifier for a network resource on a TCP IP network A subnet mask used to determine what subnet an IP address belongs to A node on a network that work as a point of entry to another network Speed Mode 10 100 1000 Mbps and full half Duplex Display the current network teaming mode Obtain TCP IP settings from Display the IP settings is either assigned automatically
47. addresses you want to send email notification to when event occurred 6 Click the Send a test email checkbox if you want to send out a test email to validate your email setting 7 Click Apply to save the setting Server Network Volume Security amp Disc Server Backup Virus Scan Event Status Information TCP IP Windows UNIX Linux Macintosh Web FTP SNMP Email SSL q gt Enable SMTP Protocol e SMTP Server Address e User Account e User Password e Administrators Email Address Send atest email Apply 4 10 SSL Settings The NAS server enables secure web access by supporting SSL 3 0 both for the user homepage and the administration homepage To use SSL 3 0 the NAS server will generate a server certificate for authentication and data encryption By default the server certificate is issued to the NAS server designated by its IP address You can also specify to use the server s full name on the server certificate For clients to access server web pages with secure connection they have to install the CA certificate first First fo to the Network gt SSL page Click Download and install CA certificate hyperlink Choose to install the certificate when a dialog box pops up Once the CA certificate is installed the client can access all NAS server s web pages with SSL connection Suppose that the server IP address is 192 168 1 10 To access the NAS system s web pages with SSL connection pl
48. alternative location If the original location is selected it will restore the files to exactly where they are backed up If the original volume is missing it will not restore anything If the original folders are missing it will create the folders automatically If the alternative location is selected it will restore data to a user specified location The full tree hierarchy of backup data will be reconstructed under that location Restore security when checked it will restore the access control lists ACL together with the data Overwrite Options specify whether to overwrite the existing files with the backed up files Checking Task Progress Viewing Logs When a task is running you can view its progress on the Devices page On the upper page is a list of tape libraries and tape drives Any currently running tasks will be shown as hyperlinks in the Status 72 column Click a hyperlink to watch task progress and details It shows Idle with no hyperlinks if there is no running task After a backup or restoring task finishes it will keep summary logs in the system folder On the Summary page you will see the summary logs They keep records of the execution summary information of the backup or restoring tasks Click a hyperlink in the Task Name column to see its details To delete logs please check the check boxes to the right and click the Delete icon 9 4 SmartSync NAS to NAS Data Replication The NAS server is integrated wi
49. as never been so easy Use NAStool to display and modify the setting you have created You can also perform server settings replication from a configured server to other NAS Servers on the network Server parameters of a NAS Server can be imported into other NAS Server to avoid tedious setup process to each Individual unit on the network Features Server Management Discovers all NAS Servers on the network Configures NAS Servers for the first time setup or quick setup Export Import NAS Servers system settings Creating CD Images Remotely Remotely loads CD images from a local CD ROM drive into a NAS Server Collect and duplicates files into NAS Servers as a single CD image Allows users to assign 6 different destination servers when building CD images Fully integrates the CD R function of the NAS Server Supports up to 16 different tasks User Interface Explorer like user interface together with user friendly wizards Task Manager monitors all on going and scheduled tasks Installation System Requirement e IBM PC or compatible with 80486 processor or higher e At least 8 MB of free memory 16 MB is recommended e Minimum 5MB of free hard disk space e VGA or higher resolution monitor e Microsoft Windows 95 98 98SE ME Windows NT 2000 XP Installing TCP IP Protocol for Microsoft Networks NAS NAStool tart communicates with NAS Servers through the TCP IP protocol You must install Client for Microsoft Networks and the TCP IP pro
50. ccount Local Account menu 2 Click the Add Group button 3 Type in the group name 4 If you want to grant the administrator privilege to this group click the Grand administrator privilege check box 5 Select the users from the left hand windows and click the b gt button to join the group 6 Click Apply to save the setting Note If you want to grant administrator privilege to a user simply add the user to the built in group Admins which has administrator privilege User with administrator privilege can access the administration home page To view and change local user property 1 Go to Security Account Local Account menu 2 Select a user 3 Click the Property button 4 If you want to change the password enter a new password and confirm 5 If you want to disable this user account click the Disable user account checkbox 6 Select a group from the left hand window and click the b gt button to add the user as a member of this group in the Member of section 7 Click Apply to save the setting To view and change local group property The NAS server provides a mechanism for administrators to create multiple accounts at one time It imports accounts from a text file and create local accounts accordingly The text file defines some parameters related to the accounts like passwords user quotas groups etc Also it can be used to create user folders in a batch Below is an example of the text file username pass
51. ckup task 4 Choose to make full backups or incremental backups A full backup will copy all source data An incremental backup will only copy those data with archive bits set After backup the archive bits of the source data will be cleared 5 Specify what to backup by selecting the folders to be backed up 6 Specify whether to enable the hardware compression capability of the tape drives 7 Click Apply to start to back up To create a backup task please go to the Backup gt Tape Library Backup menu on the administration page Click the Add Task button and specify the following parameters Devices Media Pool Backup Restore sean y Add Task e Tape Library LIB1 e Task Name WhatTo BackUp select Folders Backup Schedule Add a Schedule No schedule Backup Options Use hardware compression if available Close 1 Specify the task name The created backup set will be named after the task name appended by date time 2 Choose a tape library 71 3 Specify what to backup by selecting source folders 4 Add backup schedules by clicking the Add a Schedule hyperlink a Select the tape drive Usually it is set to Auto allowing the NAS server to choose any available tape drive to do the backups b Select backup media Please define a media pool on the Backup gt Tape Library Media Pool menu if there is no media pool c Choose to make full backups or incremental backup A fu
52. curity control of the NAS server for NFS clients follows the traditional UNIX style trust host mechanism and UID GID checking Follow the steps below to enable NFS support and export the volume for NFS clients to mount 1 Enable the UNIX Linux Network support the NFS protocol Open the administration page and enter the Network gt UNIX Linux menu Check the Enable UNIX Linux Network check box and click Apply 2 Go to the Security Account UNIX Linux Host page and add the hosts that might be trusted to access the NAS server 3 Export the volume to NFS clients Go to the Security File Folder menu Find the volume01 entry and click Create in the Sharing column or Modify if the volume has been shared On the Property page check the UNIX Linux Network NFS check box and click Apply 4 Enter the UNIX Linux Setting tab Add NFS clients to the privileged host list And assign UID GID and permission octets to the exported volume 62 After the volume is exported use one of the NFS clients in the privileged host list to mount the volume Please login as the root and use the following command to mount volume01 under the mnt directory mount 192 168 170 172 volume01 mnt Once mounted the mnt directory will link to volume01 and inherit the same UID GID and permission as you specify in the configuration steps The users on the NFS client with proper access rights will be able to access the mnt directory and hence the NAS server 63
53. d to maintain the correct identity of the user using multiple protocols to access NAS server for example Windows and UNIX Linux clients Windows based clients need to map the Windows user name to UID GID before forwarding a request to retain the correct ownership information for UNIX Linux clients By default the NAS server maps all non NFS users including local users and domain users with the same UID GID as defined on this page If the administrator wants to have different UID GID for different users he should click the Modify button to modify the user mapping to UID GID UID User ID The numerical number assigned to a user in Unix Linux permissions NFS uses UID to determine permissions on files and directories GID Group ID A part of POSIX permissions that determine groups of users NFS files have a GID assigned to them Permission Three numbers are used for setting the file permission Each of the three numbers corresponds to the type of users Owner Members of a group and Everyone Else Number Read R Write W Execute X Example If the permission of a file is set to 777 this file has read write and execute permissions for the owner the group and for other users Configuring UNIX Linux Network Settings 1 Click the Enable UNIX Linux Network NFS Protocol checkbox to enable access for NFS client 2 Enter the default permission for files created via non NFS protocol Default setting 755 3 Click Apply to save the
54. e Task Progress Task 0 Disc 0 Refresh Close 65 When it is writing to disc you can see the progress by clicking the hyperlink in the Status column of the Device List A separate browser window will pop up The progress is indicated by the progress bar the Processed Folders item the Processed Files item and the Size Processed item You can also check the Task Phase to see what the CD DVD writer is doing If it requires more than one disc to burn the source data it will prompt for a new disc after the first disc is burned ok In this case the Task progress bar indicates the total task progress which means the percentage of the source data which have been burned to discs The Disc progress bar indicates the CD DVD writing percentage of the current disc 9 2 Tape Backup and Restore The NAS server builds in backup software for data protection The backup software features full or incremental backup scheduled tasks and multi volume backup The administrator is able to define backup policy by incorporating one or more backup tasks It can also utilize the hardware compression capability It is simple yet powerful enough to fulfill most backup demands The backup software requires the system folder to operate To specify the system folder please open the Administration Page and go to the Server Maintenance page Then specify a volume to contain the system folder If there exists no system folder in the specified volume
55. e owner s name of the corresponding file and folder click the owner s name hyperlink Select a new owner from the user list 3 Check the checkbox beside Apply to all sub folders and files if you want to propagate the ownership to all sub folders and files 4 Click Apply to save the setting Server Network Volume Security amp Disc Server Backup Virus Scan Event Status information File Folder Share ACL Account Quota V Enable ACL control 6 7 Managing Quotas Configuring user quota NAS server supports two types of quotas user quota and folder quota User quota monitors the disk Space usage of each user It is based on file ownership and is independent to which volume that the 49 file and folder located Below are the descriptions of the parameters when setting up user quotas UserName User name in the local user database The user ID set in the user mapping table in Network tine o The group ID set in the user mapping table in Network tice User type Local or Domain finUse Total amount of disk space used by the user Quota Limit The amount of disk space in MB a user is allowed to use 1 Click the Enable user quota control checkbox to enable user quotas 2 Enter quota limit in MB for the user under the Quota Limit column space used by each user 3 You can click the Recalculate to obtain the most updated information of the total amount of disk 4 Click Ap
56. ease open 30 httos 192 168 1 10 for the user homepage or https 192 168 1 10 admin for the administration homepage If the server certificate with the server name is chosen please open hitps server_name instead Server Network Volume Security Disc Server Backup Virus Scan Event Status Information TCP IP Windows UNIX Linux Macintosh Web FTP SNMP Email SSL SSL provides data encryption and server authentication for web access To access SSL encrypted web pages please use URL beginning with https Secure Web Access Allow both HTTP and HTTPS connections Redirect all HTTP connections to HTTPS connections SSL Option Download and install CA certificate e The server certificate for SSL web accessing is issued to 192 168 1 254 192 168 1 4 NASD80052CF 31 5 Storage Management This chapter describes how to create a single disk volume or a RAID volume It also outlines the steps of deleting a volume expanding a RAID 5 volume and assigning hot spare disks After a volume is created please refer to the next chapter for more information about sharing data and assigning permissions 5 1 Volume Usage and Status A volume is a logical storage unit Each volume holds a complete file system A volume can exist on a single disk or a RAID group consisting of two or more disks Volume View List of Volumes lt displays all the volumes in the NAS server Volume Name show
57. eate the system folder Once the system folder is created you are able to save the system settings and event logs as HTML files On the same page choose the files to save and click the Apply button Before saving the files you can preview them by clicking the Preview hyperlinks Previewing will not create any files in the system folder After generating these files you can see them appear in the table Click any hyperlink to view the content of a file To email the save files choose the files to save and check the Send the saved files by email check box Enter the email address to send to And click Apply to send them out by email while saving copies in the system folder 10 5 Share Access Counts On the Status Access Counts menu page it displays how many times the shares have been accessed The count is added by one whenever a connection to the share is established by Windows 85 clients NFS clients MacOS clients There are several share types Normal Share indicates a shared folder in any data volume System Share indicates the MIRROR share which holds all CD DVD volumes Disc Share indicates a share of a single CD DVD volume Group Share indicates a share of grouping of several CD DVD volumes Disc Folder Share indicates a share of disc image folder Server Network Volume Security Disc Server Backup Virus Scan Event Status Environment Open Files Connections Access Count
58. ecute O List Folder Contents O Read O Write O Full Control Modify M Read amp Execute M List Folder Contents F Read O Write Full Control O Modify O Read amp Execute O List Folder Contents O Read M Write OFull Control O Modify M Read amp Execute MH List Folder Contents F Read HM Write File Permission in Windows Network O Full Control O Modify O Read amp Execute O Read O Write O Full Control O Modify Ml Read amp Execute M Read O Write O Full Control O Modify O Read amp Execute O Read Fi Write O Full Control O Modify Ml Read amp Execute MI Read Fi Write Modify MOQ Full Control FC O Full Control H Modify HM Read amp Execute M List Folder Contents M Read M Write M Full Control F Modify M Read amp Execute M List Folder Contents M Read M Write To set view change or remove file folder permission in Windows Network 1 Locate the file or folder you want to set permission 2 Right click the file or folder click Properties Security O Full Control H Modify M Read amp Execute M Read M Write F Full Control M Modify Fi Read amp Execute Ml Read Fi Write 3 Change permission from an existing groups or users click the Allow or Deny checkbox 4 Or remove the groups or users by clicking the Remove button To change owner of a file or folder 1 Go to Security File Folder menu 2 If you want to change th
59. elongs Location indicates the SATA channel position of the hard disk and USB position 33 Model Name shows the model or the manufacturer of the hard disk Capacity shows the unformatted capacity of the hard disk Status indicates the disk status or disk activity being one of the following The hard disk is a member of a mounted volume which is ready for data access The hard disk is not initialized yet A no init disk must be a free disk which can be used to create a volume or be assigned as a hot spare disk Defective The hard disk contains bad sectors The hard disk is not mounted and not accessible Backup Archiving Devices These are either CD DVD ROM drives CD DVD writers or tape drives Type indicates what kind of device it is Mode indicates the data transfer mode of the storage device interface Device type could be CD ROM CD R CD RW DVD ROM DVD R DVD RW DVD ROM CD RW or Tape Data Transfer Modes SATA 1 or SATA 2 5 2 Creating a Volume The first thing for the administrator to do with the storage is to create a volume on the hard disks Then he or she can share the storage for user access and set security control To create a volume first go to the Volume Create page Specify the volume name in the Volume Name field and choose the volume type JBOD RAID 0 RAID 1 RAID 5 RAID 6 or RAID 10 Then choose the hard disks to be included in the volume Last click Apply to submit changes The progress of
60. ely humid environment Do not allow liquids or foreign objects to enter the unit All servicing of this equipment must be performed by qualified service personnel Remove rings watches and other jewelry before servicing the unit Before maintenance repair or shipment the unit must be completely switched off and unplugged and all connections must be removed Safety Notices The computer may provided with CD drives comply with appropriate safety standards including IEC 60825 CLASS 1 LASER PRODUCT KLASSE 1 LASER PRODUKT Caution This unit is provided real time clock circuit There is a danger of explosion if battery is incorrectly replaced Replace only with 3 Volt Lithium cell CR2032 or equivalent type Discard used batteries according to the manufacturer s instructions Caution Before connect or disconnect power cord of the power supply ensure to turn the power supply switch OFF to avoid the risk of equipment damage Table of Contents 1 INTRODUCTION oreren neasayus cnansyunspacesacencaapecneacpacenes spun spucines vacating seaatins ceases seacemmns satan deena 7 th ct SIO UL A E OEE IE IE E A O clea emerges poate A ne tise A E A A E E EET 7 2 INSTALLING AND STARTING NAS SYSTEM cssisssicssisanccapdeawscspdeepasepeqeveasydeaneaeweqancquinesnnsamnyasasmesnanenmieamerens 8 2 1 ESE Guck Installat lO sg sat nirisan iena E AAAA EEE ENEE EEN EES OAAR EEEE 8 2 2 lower FAS LOG AOI aarcaecccsaestciecsiree4acesscsieseace
61. erDLT1l lscst backing up Refresh gt Summary Logs N After a backup or restoring task finishes it will keep summary logs in the system folder On the lower Summary page are the logs They keep records of the statistics and errors of the backup restoring tasks ever executed Click a hyperlink in the Tape Label column to see its details To delete logs please check the check boxes to the right and click the Delete icon 9 3 Using a Tape Library First set up the tape library so that it can be controlled by software Please refer to the tape library s instruction manuals for details Then connect the tape library to the NAS server with a SCSI cable The NAS server supports up to two tape libraries The tape library support is an optional feature on 1U 2U Managing Devices Tapes and Tape Cleaning When the NAS server starts up it will initialize the tape library It might take a while To view the status please open the administration page and enter Backup gt Tape Library Devices When it finishes the initialization you will see a page as below 68 Summary Devices Media Pool Backup N Refresh I Device List device Location Model Name elp LIB1 Host 0 Ch 0 Id 5 Lun 0 EXABYTE Exabyte EZ17 4102 20 Chr0 Td 6 5 a LITAPE1 Host 0 Ch 0 1d 6 Lun O0 EXABYTE xa 2 2100 Inventory 1G gt Tape Media In LIB1 Slot a Tape Label Media Pool siot 0l Unknown esse 02 rome a ease 0
62. ess in Event Configuration Advance menu 80 Server Network Volume Security amp Disc Server Backup Virus Scan Event Status Configuration Web Reminder System Log Device Log Security Log yg gt Event Log e SystemLog Info wl e DeviceLog Info e Security Log Info 7 gt Event Notification e LCD Alert Error e Web Reminder Enabled Email Alert Disabled e SNMP Trap Disabled x e Buzzer Alert Enabled M gt Thermal Settings e F warning if CPU temperature exceeds 70 158 0 v leCPF l Shutdown if CPU temperature exceeds 75 167 0 v CPF e V Warning if system temperature exceeds 45 113 0 PCrF 10 1 Thermal Settings User can also define the thermal scheme of the NAS server so that NAS server can give off warning message or shutting down when the system or CPU temperature is over a predefined threshold temperature Configuring thermal settings 1 Go to Thermal Settings in Event Configuration menu 2 You can set the NAS server to give off warning message or shutdown base on the CPU or System temperature Check the Warning and Shutdown checkboxes and select the proper temperature from the pull down menu 3 Click Advance button to configure the way of notification for various events 4 Click Apply to save the setting The System Fan Control function only on 1U 2U The system and CPU fan would start to wo
63. formation about the system hardware and security event of you NAS server NAS server records three kinds of logs System Log Device Log Security Log All the events are categorized into three levels Info Warning and Error In Event Configuration menu you can configure the level of the logs Use the Advance or Basic button to switch between the display of advance and basic information The Advance view shows all the information in the Basic view plus additional event notification setting that may be of interest to the more advanced user Various notification methods are provided by NAS server to ensure non stop operation and data integrity LCD alert provides warning and error level notification m Warning level notification such as very low disk space is detected on volume hot spare disk is consumed and so on m Error level notification such as CPU fan failed volume is degraded or faulty and so on Web Reminder provides instant notification in the administration homepage Email Alert provides notification via email SNMP Trap sends SNMP trap to the Network Manager System NMS such as HP Open View Buzzer Alert an audio sound will goes off from the build in buzzer in NAS system when event occurred To turn off the buzzing sound either press any button on the LCD front panel or click the Mute Buzzer icon Bon the Administration Page You can configure what kind of events should initiate the notification proc
64. from DHCP or assigned manually WINS Server IP Address Windows Internet Naming Service WINS manages the association of network resources name and its IP addresses without the user or an administrator having to be involved in each configuration change DNS Server IP Address IP address of the domain name system DNS server which located the domain names and translate it into IP addresses 20 NTP Time Server IP Address The IP address of the NTP Network Time Protocol server which is used to synchronize system time automatically over the net The system time will be synchronized with the NTP server every 24 hours SMTP Server Address IP address or server name of the SMTP Simple Mail Transfer Protocol server used in sending and receiving e mail HTTP Proxy Server IP IP address of the HTTP proxy server Next to the IP address is the port Address number Server Network Volume Security amp Disc Server Backup Virus Scan Event Status Information TCP IP Windows UNIX Linux Macintosh Web FTP SNMP Email SSL xe l Network Protocols Protocol Type Configuration Security Policy Windows Network Workgroup Mode UNDYLinux Network Enabled Trust Host Macintosh Network Enabled Local Web Data Access Enabled Local FTP Data Access Enabled Local SNMP Protocol Disabled SMTP Protocol Disabled l gt TCP IP Suite Settings IP Address Subnet Mask Gateway Speed Mode 192 168 1254
65. he SmartSync clients It will backup data from the SmartSync clients to the SmartSync server On the NAS server which acts as the SmartSync server create a sync point of Backup mode which receives data from SmartSync clients and creates data backups in it To create a sync point please go to the Backup gt SmartSync Server menu on the Administration Page Click the Add button to open the page below On the page you should provide the sync point name and specify which group is allowed to replicate data to this sync point Set the mode to Backup up Logo Server Network Volume Security amp Disc Server Backup Virus Scan Event Status Tape Backup SmartSync Loader Writer System Profiles USB Summary Server Tasks gt SmartSync Information e Total SmartSync Points 0 e Active SmartSync Points 0 e Total SmartSync Tasks 0 e Active SmartSync Tasks 0 E Task Summary Logs aK Li a 6o0 0206DwCG 8 ChCShhGSS C lt lt C S S lt S lt S S 3 S SC 3 3 37 3C 3C 3S COS 74 The GFS media rotation mechanism is the policy of managing backup versions The policy is described as below Basically it will check for obsolete versions and delete them when a new backup version is created X Y Z are user defined numbers a It will Keep all the backup versions today b It will Keep one backup version per day in the last X days except today c It will keep one backup version per week i
66. iaraeaeeceudenes NERE EEEE EERE EREE ENEE IREE i 9 2 3 semo Me Adar ESSES inre ee CR ee Pane en een eT ns A eT en eee nee 10 2 4 COnsIGUIING ENE IP addresses USING NASIOO ccesisssccnseecctcesextseceledertexdevareceoncsavvebovesecelelcclenbuxteeceuadestcedusdiecs 13 Zo Accessing the Administration Home PAGEC ccccsseescccccsessccccnnssecesnsensecsscausecessauuseesssaueecsssuensecsssaanseeseas 14 3 SER VER CONFIGURATION sissreiiri niei in an a cutee was duns EN ange cans unaedeune pane euabesaus cenbeehereurnednnn eines 15 3 1 Server Information and Settings nscesesetvencarioesarteusacnscbeesensdensicsnesseosenstenwasavantmeeeeesntuigyoatannenvannacsarasenanrsaaaveahrabrenses 15 2 2 Upgrading the FINIWO E aricece carats cnc sadicense taeVacdsuesienainieeciensssedeanseunet aad pansvedeieis EE ENERE TEE ES 16 SIMU EEE Down he See aa ee cae iro ec Ei iA ROTON TAATOA O OEN TEO 17 A OT OF S SUPO i TE A E E AEA 18 3 5 Modifying the Administrator s Password ssscccccssesseccccsssececcsussecescausecessauasecessauueeesssauasecesaauaeeesssauaseessaaansees 19 4 NETWORK CONFIGURATION sisisirccnsciasis erreian EE N E deisemnsseaes 20 A AVC VOL KINO TO O eiir ninaa one n ENEE ANEI A EAS EEEE ENAA EA EENE E EAEE 20 a2 TCP IP SEUNS Kerraen E E E EEA ENEE E E EN 21 A W GON SE I O E ee E E ETA O AE O EE EATA E OOE NO eee 23 AUN ENO G a A A A cates NAAA 24 FF Macin osh SOCIO S eisene eena arer E EEANN EEA EEEN AEREA EEE EANA ONERE EAEEREN EAE 26 4 6 Web Data Acces
67. ild image Destination 4 Name the CD DVD image to be created Enter the name in the Volume label input box and click the Update button Press Next afterwards Wizard tuild Image Volume Label e Unodate button Za a lf 7 zea ETA OTU Let ti Schedule 113 Burning Disc Images If the NAS server is equipped with CD or DVD writer it can burn any existing disc image in it Select a NAS server from the NAS Servers tree view pane of the NAStool main window Select a disc image in the NAS server and right click on it Select Record CD DVD from the right click menu Specify the parameters in the wizard and click the Add CD R Option button Click Next to continue On the next page specify the launch schedule and click OK Supported CD Formats The Mirror CD function copies CD or DVD discs from a PC CD DVD drive into a NAS Server Below is a list of the supported CD formats that can be mirrored remotely e ISO 9660 level 1 2 3 including Romeo Joliet and Rock Ridge extension e CD HFS e CD DVD UDF e High Sierra e Hybrid ISO HFS e Multi session CD e Mixed Mode CD e UDF V1 5 V2 0 114
68. in front of the slot and click the Quick Erase or Erase button Retensioning a tape To retension a tape is to wind the tape evenly so that it is properly tensioned Use this feature only when there are errors accessing the tape To retension a tape please click the radio button in front of the slot and click the Retension button 69 Scanning a tape for backup indexes If the backup index files are missing the NAS server will not be able to restore the data In this case please insert the tapes and scan them for backup indexes The NAS server will copy the backup indexes from the tapes To scan a tape please click the radio button in front of the slot and click the Scan button Defining a Media Pool A media pool is a group of tapes managed as a unit You must define a media pool before assigning any backup schedules To define a media pool please go to the Backup Tape Library Media Pool menu and click New Pool Please specify the media pool name and the tapes to be added into the media pool Please also specify the tape labels manually Only blank tapes can be added To erase a tape please go to the Devices page Create a New Media Pool e Tape Library LIB4 Media Pool Name sample e Select Tapes Media Type Bar Code VxXA 2 Each media pool is divided into two sets the save set and the scratch set The save set is consisted of the tapes containing important data which cannot be overwritten On the other ha
69. in name Use FQDN if you want to configure NAS server in Domain Mode Ex Microsoft com 3 Click the Workgroup Mode radio button if you want to configure NAS server in Workgroup Mode 4 Or click the Domain Mode radio button if you want to configure NAS server in Domain Mode 5 Inout the domain manager s user name and password Power Users at least 6 Select the option to disconnect idle connection automatically Server will disconnect the connections which have been idle for 5 minutes if this option is enabled 7 Click Apply to save the setting Server Network Volume Security amp Disc Server Backup Virus Scan Event Status Information TCP IP Windows UNIX Linux Macintosh Web FTP SNMP Email SSL wh Enable Windows Network SMBICIFS Protocol Apply 23 4 4 UNIX Linux Settings NAS server can export shares to UNIX Linux client via NFS protocol UNIX Linux client then can mount the shares and gain access to the content of the shares UNIX Linux client uses UNIX user identification typically consisting of User Identifier UID and Group Identifier GID for access control Non NFS clients do not use UIDs and GIDs for identification Since NAS server is intended for working in a heterogeneous network files created by non NFS client could possess incorrect ownership information and generate inaccurate quota information for UNIX Linux clients due to the unmatched UID and GID A mapping is neede
70. isc Recording Data Archiving Quick Setup Disc Share List Share Name Share Type Share Target System Share MIRROR System Share 54 7 4 Burning Disc Images To burn an existing disc image select Disc Recording from the Disc Server menu on the administration page To do disc recording the CD function must be configured as Loader Writer To change the CD function please click the hyperlink in the Function column of the Device List table Next select a disc image by clicking the Select a Disc hyperlink After the selection is made the disc image information will be shown underneath including image size disc format and disc volume label Check the Erase disc before writing option if it is a rewriteable disc which contains data Click Apply to start the disc recording Server Network Volume Security amp Disc Server Backup Virus Scan Event Status Information Disc Images Disc Caching Disc Shares Disc Recording Data Archiving Quick Setup The CD device s function must be changed to Loader VWriter so that it can write to discs Please click the hyperlink text in the Function column to change the function Device List There is no available device 7 5 Archiving Data to CD DVD Discs Data archiving is to move or copy regularly NAS data to CD DVD discs Administrators can set file filters mostly based on file date time to specify what to burn One of the applications is to mo
71. ity ID SID for domain user is issued and maintain by the domain controller on the network Administrator do not need to re configure all the group memberships and access rights to the files and folders if the domain user is deleted from the local user database and the same name is created as the previous one Note If the administrator changes the permission on a file or folder that a user is currently accessing the permission setting do not take immediate effect because of the local handle being used by the user The new rights will only take effect when the user reconnects to the file or folder 47 There are two built in user accounts Admin and Guest And two built in group accounts Admins and Everyone Every user of NAS server including local and Domain user is the member of the Everyone group By default when a volume is created Admins and Admin and Everyone will be granted Full Control permission After you set permissions on a volume all the new files and folders created under the volume inherit these permissions If you do not want them to inherit permissions uncheck the Inherit from parent folder when you set up the permissions for the files and folder Configuring file and folder security 1 By default ACL control is enabled 2 Go to Security gt File Folder menu 3 Locate the file or folder you want to configure the permission 4 Click O inc icon If the icon is disabled go to Security gt ACL menu
72. l Allow anonymous login and map to Allow individual user login Local account authentication Local and domain account authentication e FTP function Only use the public directory D Use the users private directory Account e User Limit Unlimited 28 4 8 SNMP Settings Simple network management protocol SNMP provides the ability to monitor and gives status information of the SNMP agent to the SNMP management console NAS server behaves as an SNMP agent that answers requests from management console and sends trap information to it The following options should be configured to using SNMP protocol Community A name serves as a simple authentication The communication between the SNMP management console and the NAS server cannot be established if the community names are mismatch IP IP address of the SNMP management console Trap A trap is a voluntary message send out from a SNMP agent which is in this case your NAS server when there is an event occurred Management Configure the SNMP management console as Read Only or Full Control Location Provide location information of the SNMP agent Contact Provide name of the contact person who has the management information of the SNMP agent Configuring SNMP Settings 1 Click the Enable SNMP Protocol checkbox to enable SNMP accessing 2 Enter a Community name 3 Enter the IP address of the management console 4 Select Yes from the pull down menu if yo
73. le Bin we There are no free disks to create volumes 5 Migrating Data Volumes Migrating a data volume is to duplicate a volume block by block It helos administrators migrate or duplicate data between volumes of different RAID types or capacity During data migration both the source volume and the target volume will be un mounted not available for client access To migrate data select a source volume and the target volume to migrate to Choose Data migration and click Apply The target volume will inherit all the security and quota settings of the source volume No differences will be observed by clients before and after the migration To duplicate a volume select a source volume and the target volume Choose Data duplication and 37 click Apply The target volume will stay on line after the data duplication 5 8 Hot swapping You may have to change hard disks in some situations such as hard disk failure degraded RAID Critical RAID or general maintenance The NAS server supports HDD hot swapping if used with GNS 4001hot swappable HDD module Below are the instructions of replacing hard disks when using the HDD module When using GNS 4001 hot swappable HDD module 1 Identify which hard disk fails The amber LED of the HDD tray will blink to indicate hard disk failure 2 Unplug the HDD tray and replace the HDD with a good one 3 Plug in the HDD tray Wait until the Green LED is steady on Then you are done When a RA
74. lect a NAS Server from the server list and click Next button 4 Choose the Network Teaming Mode from the pull down menu If you are not clear about this feature continue with the default value Refer to Chapter 4 2 TCP IP Settings 5 If you want the IP settings to be assigned automatically click Obtain IP settings automatically 6 Or you can specify the IP settings manually 7 Click Next button to go to the next page 8 Enter the Server Name Server Comment and Workgroup Domain Name and select either the Workgroup mode or Domain mode Note that this is the server name as it appears on the network which is irrelevant to the network protocol used 9 Click Next button to go to the next page 10 Change the admin password if necessary Click the OK button to save the settings Note that server may need to reboot for certain parameters changes to take effect 105 Importing and Exporting System Settings This section describes how to export the system settings of a NAS Server into a file This file can be read into another NAS Server on the network by using the import feature Import System Settings and Export System Settings form a combined process of replicate system settings from one configured NAS Server to another NAS Server To export system settings of a NAS Server 1 Highlight the server from the server list 2 Right click the server and select Export System Settings 3 Or go to Server gt Export System Settings menu
75. ll backup will copy all selected data An incremental backup will only copy those data with archive bits set d Set schedules e Specify the tape retention period A retention period is the number of days in which you want to keep the backup data from being overwritten For example if the retention period is set to 7 days the tape will remain in the save set as long as it has been used and be moved to the scratch set when it has not been used for 7 days f Set overwrite options If Overwrite the media is selected it will only use blank tape or scratch tape for backups and write data from the beginning of the tapes If Append to the media is selected it will append data to the last used tape 5 Specify whether to enable the hardware compression capability of the tape drives 6 Click Apply to start to back up Restoring Data To restore data go to the Backup Tape Library Restore menu First select the backup task which created the backup sets Then select a backup set and specify whether to restore all files or only partial of them To view the information of the backup set click the hyperlink in the Backup Type column Next choose to restore all files or only certain files or folders For the latter you need to install Sun Java virtual machine v1 4 or higher Please go to hitp java sun com and download the software Use the Java UI to select the files or folders to be restored Next choose the destination the original location or
76. lowing share permission to UNIX Linux Hosts on NAS system Read Only RO The host is allowed to read the share Read Write RW The host is allowed to read and write to the share e k Server Network Volume Security amp Disc Server Backup Virus Scan Event Status y information File Folder Share ACL Account Quota y Modify share property or share permissions E Share name in red color represent that the system folder has been shared If you want to hide or show the snap folder under the share root click the snap folder icon to the left of the share name View effective permission There is no shared folder Create Share 6 6 Configuring File and Folder Security and ACL Access Control Lists ACL are associated with each file and folder as well as the list of users and groups permitted to use that file or folder When a user is granted access to the file or folder an ACL node is created and added to the ACL for the file or folder If you assign permissions to a local user a Security ID SID created by NAS system will be referred by the ACL for the file and folder security If the local user is then deleted and the same name is created as the previous one the new user does not have permissions to the file or folder because the SID will not be the same The administrator will have to re configure all the group memberships and access rights to the files and folders Since the Secur
77. management becomes much easier To expand a RAID 5 volume please go to the Volume gt Expand page Select a RAID 5 volume to be expanded Then choose the free disks as new members Click Apply to submit changes The progress of RAID expansion is shown on the Volume Information page Server Network Volume Security amp Disc Server Backup Virus Scan Event Status Information Create Delete Expand Migrate Scan iSCSI Recycle Bin qA There are no free disks or RAID 5 volume for volume expansion 5 5 Volume Disk Scan Volume Disk scan is especially useful for disk diagnostics and repairs lost or cross linked clusters in Volume Disk All readable data will be placed in new clusters and defective cluster will mark as bad in the file system All the newly added devices will be scanned before usage to ensure the data integrity in the NAS Server Select the volumes or disks you want to scan click Scan Now button to start scanning Or click Schedule to set the time for NAS Server to perform scanning at the scheduled time Disk Auto scanning To make sure that the hard disks contain no bad sectors before putting into use it is suggested to perform disk scanning before taking such actions as creating a volume expanding a volume migrating data or assigning a hot spare disks If disk autoscanning is enabled the NAS server can scan disks automatically when you perform these actions If the hard disks have ever been scanned
78. martSync server please create a SmartSync task on the client Open the Administration Page and enter the Backup gt SmartSync gt Task menu Click the Add Task button Follow the steps to take to add the SmartSync task Step 1 is to specify the IP address of the SmartSync server Step 2 is to choose a sync point of Backup mode in the SmartSync server Specify the action as Restore from server Please also provide a user account with the privilege to replicate data to the sync point Step 3 is to complete the task settings On the page you should provide the task name select which backup version to restore specify the target folder and configure the SmartSync options and the 19 overwrite options The overwrite options specify whether to overwrite the target with the files of the same names Step 4 is for confirmation showing the brief information of the task settings Distributing File Updates to Multiple Sites Two or more NAS server are required one as the SmartSync server others as the SmartSync clients It will replicate data from the SmartSync server to the SmartSync client On the NAS server which acts as the SmartSync server create a sync point of Distribute mode which distributes data to the SmartSync clients as they request To create a sync point please go to the Backup gt SmartSync gt Server menu on the Administration Page Click the Add button to open the page below On the page you should
79. mn On the same page it also shows detailed information of the disc image To delete a disc image To delete a disc image check the check boxes to the right and click the Delete icon Server Network Volume Security amp Disc Server Backup Virus Scan Event Status Information Disc Images Disc Caching Disc Shares Disc Recording Data Archiving Quick Setup we All Disc Images Disc Image Folder ey List of Disc Image Folders There is no available disc image folder New Disc Image Folder j Assign Folders Un assign Folders 53 7 3 Sharing Discs Administrators can choose to share a single disc multiple discs or a disc image folder If a single disc is shared its content will be shown when users open the network share If multiple discs are shared the discs will appear as individual folders under the network share The folder names are the same as the disc names If a disc image folder is shared all the discs in the disc image folder will appear as individual folders under the network share To share a single disc To share a single disc go to the Disc Server Disc Images menu of the administration page Click the Create hyperlink in the Share column Click Apply to share the disc Enter the Share Permissions tab to assign user permissions if you want to restrict user access The Unix Linux Setting tab is for configuring NFS security settings Please refer to section 6
80. n the last Y weeks prior to the X days d It will Keep one backup version per month in the last Z months prior to the Y weeks On the NAS server which acts as the SmartSync client set up a SmartSync task which defines the schedule settings and the source folder To set up a SmartSync task please go to the Backup gt SmartSync gt Task menu on the Administration Page Click the Add Task button Server Network Volume Security Disc Server Backup Virus Scan Event Status Snapshot Tape Backup Tape Library SmartSyne Loader Writer System Profiles ee Summary Server Tasks gt SmartSync Tasks SmartSyne Server Syne Point Name Schedule Status I testdobulequota 192 168 80 48 la Backup Immediately Idle Add Task Delete Task There are four steps to take when adding a SmartSync task Step 1 is to specify the IP address of the SmartSync server Step 2 is to choose a sync point of Backup mode in the SmartSync server Specify the action as Backup to server Please also provide a user account with the privilege to replicate data to the sync point Step 3 is to complete the task settings On the page you should provide the task name select the source folder to replicate specify the schedule and configure the SmartSync options Step 4 is for confirmation showing the brief information of the task settings Restoring Files from the SmartSync Backups To restore data from the S
81. nable FTP Data Access checkbox to enable FTP data accessing 2 Select the Access Control type Click the Allow file download only or Allow file upload and download radio button 3 Select the appropriate Security Policy Check the Allow anonymous login and map to check box and select a local user from the pull down menu User using the anonymous login will then possess the same security privilege as the selected local user 4 Or click Allow individual user login Select Local account authentication to authenticate user using the local user database or click the Local and domain account authentication radio button to use both local account and Microsoft domain security authentication 5 Select the User Limit Click the Unlimited radio button or specify the maximum number of users allowed to access the content in your NAS server via FTP 6 Specify the Home Directory when user connects to the NAS server via FTP Note that you must select a volume to create a FTP home directory 7 Specify the permission of the home directory by clicking the Set icon 8 Click Apply to save the setting Server Network Volume Security amp Disc Server Backup Virus Scan Event Status Information TCP IP Windows UNIX Linux Macintosh Web FTP SNMP Email SSL BP gt V Enable FTP Data Access e Access Control Allow file download only Allow file upload and download e Security Policy FTP with SSL TLS Explicit
82. nation Click the Select Path hyperlink and select a target path 3 Choose whether to overwrite the existing files Overwrite with newer files means it will overwrite the target if the files on the CD DVD disc are newer 4 Click Apply to start copying data 4 cD10 Task Status Microsoft olx Current Task Loader Device Model PIONEER DVD RW DYR 108 Disc Format N a Task Status Procee ding Task Phase Analyzing disc Start Time 2005 04 07 14 53 41 Remain Time 00 10 00 Processed Folders 0 0 Processed Files 0 0 Size Processed 0 0 MB Volume Path rck Task Progress 0 Refresh Close Abort gt 64 When it is copying disc you can see the progress by clicking the hyperlink in the Status column of the Device List A separate browser window will pop up The progress is indicated by the progress bar the Processed Folders item the Processed Files item and the Size Processed item Writing CD DVD Discs The NAS server supports CD or DVD burning It can use ISO 9660 CD format to write data to CD or DVD discs Supported devices are CD RW DVD RW and DVD RW writers and Blu ray Disc Dual layer DVD writing is also supported To write data to CD DVD discs please insert a blank disc into the CD DVD writer first Next open the Administration Page and enter the Backup gt Loader Writer page Then follow the steps below Server Network Volume Security amp Disc Server Backup Virus Scan Event
83. nd the scratch set is consisted of the tapes which are free to be overwritten At the very beginning all tapes are empty and locate in the scratch set When the NAS server backs up data to a tape the tape is moved to the save set After the retention period is passed the tape expires and is moved to the scratch set for recycling The retention period is the number of days for which the tape must be kept in the save set after it is last written You can define the retention period when creating a backup task Backing Up Data To start a backup task immediately please go to the Backup gt Tape Library gt Backup menu on the administration page Click the Backup Now button and specify the following 70 Backup Now e Tape Library LIB1 e Task Name e Tape Drive auto z e Backup Media Media Pool s Select Tapes C sanma roem wene arco feo me feos me forse Backup Type ral xz WhatTo Back Up select Folders e Backup Options M Use hardware compression if available Apply Close 1 Specify the task name The created backup set will be named after the task name appended by date time 2 Choose a tape library and the tape drive Usually the tape drive is set to Auto allowing the NAS server to choose any available tape drive to do the backups 3 Select backup media If you have defined any media pool just select one If not you can choose the tapes to use for this ba
84. ne AAEE I lt 2 Desktop Name Description J My Computer E My Computer 1 CD ROM s F Empty A My Container D Folder s 0 File s G My Container 99 NAS Network NAS Network p Jy HAS Servers Q Remote Servers You can use the provided utility NAStool to perform the initial setup of your newly arrived NAS server The utility designed to perform a quick set up and put your NAS server online in just a few minutes During startup NAStool begins to discover all the NAS server on the network The default server name would be NASxxxxxxxx where xxxxxxxx Is the last eight digits of the Ethernet address of LAN1 Highlight the server you want to configure from the left hand pane 1 2 3 Ol So Click the ey button on the toolbar Or right click the server and select Configure Enter the Server Name Server Comment and Workgroup Domain Name and select either the Workgroup mode or Domain mode Click Next button to go to the next page Choose the Network Teaming Mode from the pull down menu If you are not clear about this feature continue with the default value If you want IP settings to be assigned automatically click Obtain IP settings automatically Or you can specify IP settings manually Click Next button to go to the next page Change the admin password if necessary Click the Finish button to save the settings Note that server may need to reboot for certain parameters changes to take effect 13
85. olume name of which the system folder is located The System Information section shows the hardware and firmware status of the server The version number of the OS firmware Processor Type The CPU operating frequency Memory Capacity The total size of the main memory No of HDD CD tape Display the number of HDD CD tape installed in the system LAN1 2 3 Ethernet Address The Ethernet MAC addresses of the network controller chips and their types PCI E Slot Display the type of the add on adaptor installed in the system 15 Information General Password UPS Settings Maintenance Shutdown Upgrade gt General Settings Server Name Server Comment Date Time Time Zone Configure from LCD System LCD Banner UPS Support Auto Power Restore System folder resides in System Information Firmware Version Processor Type Memory Capacity Amount of HDDs DVDs orTape devices LAN 1 Ethernet Address LAN 2 Ethernet Address PCI E Slot 3 2 Upgrading the Firmware Updating OS firmware will accommodate new functions or bug fixes Once you get new releases of an OS firmware image you can upgrade the OS firmware by using the web browser The process is NASD80052CF NAStorage 2012 01 17 16 04 26 GMT 08 00 Taipei Enabled None Disabled Enabled ftest 1 1 10 Intel R Celeron R CPU 550 2 00GHz 1014 MB 4 0 0 00 E0 D8 00 52 CF 10 100 1000 Mbps 00 E0 D8 00 52 D0 10 100 1000 Mbps
86. ool NAStool is also outlined in this chapter The GNS 4001 4 Bay Gigabit Network Storage no HDD installed are pre installed before shipping 2 1 First amp Quick Installation Installation Hard Disk Fig 1 Fig 3 Fig 4 Fig 5 2 2 lower installation on O eS Pull out a HDD tray from the GNS 4001 mobile rack Secure and mount a hard disk onto the HDD tray using four screws under the tray Insert the HDD tray back in the mobile rack Make sure the lever of the mobile rack is properly in place Repeat Step 1 to Step 3 if necessary for the other HDD trays Connect your NAS server to the network by attach a LAN cable from the LAN port located at the back of your NAS server At least one network connection is required Plug the power cord into the power connector on you NAS server Make sure the power switch on the power supply is in ON position Press the power button on the upper right hand corner of your NAS server Wait for the server to boot up The boot up process takes approximately 2 minutes 2 3 Setting the IP Addresses LCD console flow chart LCD menu console flow chart LAN 3 galeway 132 168 3 1 Hg LAN 1 IP Enter conigureLani Configure LAN 1 13216811 Yes Ho F Galeway Maak Na LAN 2 IP fae Configure LAN27 88 Configure LAN 2 192 168 2 1 Yea Ho F Gateway Maak No Ente FconmgueLansy 8 Configure LAN 3 Yea No IP Gateway Maak Serer Name NAS 0e
87. ory default the username is admin and password is admin Note It is recommended that user change the admin password immediately to keep your NAS server secure and to protect resources from inappropriate access by other users on the network 14 3 Server Configuration This chapter describes how to name the server specify the server date and time upgrade the OS firmware shut down the system and use UPS with the NAS server 3 1 Server Information and Settings Click Server from the administration homepage You will see the Information page describing the summary information of the NAS server The Information page is divided into two sections The General Settings section shows the parameters which can be modified on the Server General page Server Name Name of the NAS server A NAS server has one unique name applicable to all network protocols Server Comment The text which is shown in the comment field when browsing network computers in Windows Network Neighborhood Date Time Server date and time in 24 hour format Time Zone The time zone setting of the server relative to the Greenwich standard time System LCD Banner Indicates the banner text which is displayed on the LCD console when it receives no user input or event messages for a period of time Auto Power Restoration If enabled the server will power on automatically when the power restores after abnormal shutdown System folder resides in Display the v
88. ou have to do it manually The Update user database function on the Domain Account tab of the Security Account menu helps you find the user accounts which have already been deleted from the domain controller yet still remain in the NAS user database You can choose to delete them from the database ACL and share permission will be also updated by removing the entries related to those users 6 4 Creating UNIX Linux Host For NAS server NFS client s mount privileges are granted specifically to UNIX Linux host created by the administrator If a UNIX Linux host is granted access right to a share in the NAS server user of the UNIX Linux host can have access to the share Administrator should create a UNIX Linux host list prior to grant access right to them To create a list of the UNIX Linux host 1 Go to Security Account menu 2 Click the UNIX Linux Host tab 3 Enters a single host IP address in the first text box 4 Or enter the start IP address in the first text box and the last 3 digits of the end IP address in the second text box to input a range of the host IP addresses of the Host IP field 5 Click the Add button to add the host IPs to the host list 6 Click Apply to save the setting Server Network Volume Security amp Disc Server Backup Virus Scan Event Status Information File Folder Share ACL Account Quota Y Local Account Domain Account UNIX Linux Host gt Input a host IP
89. p a wizard for access to major functions Mirror CD Build Image and Server Quick Setup Task Manager opens a task manager window which displays and controls all ongoing and scheduled tasks k i Help opens the Help window for display help information 109 Mirroring CD DVD Remotely This chapter describes how to copy a CD from a PC CD ROM drive to a NAS Server Please follow the steps below 1 To mirror a CD or a DVD remotely into a NAS Server first click the Mirror CD icon on the tool bar It invokes the Mirror CD wizard as shown below Select a PC CDROM drive as the source Press Next to continue Wizard Mirror CD DVD 2 Choose one or more servers as the destination Select a server in the Target amp File Path list box select Smart mode for redundancy check of the CD image or select Force mode to allow a second copy of the same CD image Then click the gt gt button You can see the task being added to the right hand pane Click the Next button to go to next page Destination You can mirror to six targets at most Source image Taget t File Path Server Name File Path 3 Change the volume label of the CD DVD image if necessary If you want to change the volume label click the 2 User Define radio button and enter the volume label in the input box Then click the Update button Click the Next button afterwards Wizard Mirror CD DVD C 2 User Define Vol
90. p users to UID GID as defined below to Apply 6 Click the Auto map with NIS users link to map with the users in the configured NIS server Server Network Volume Security amp Disc Server Backup Virus Scan Event Status Information TCP IP Windows UNIX Linux Macintosh Web FTP SNMP Email SSL YA V Enable UNIX Linux Network NFS Protocol Default permission for files created by non NFS protocols 755 e User mapping to UVID GID hodit Enable NIS support e NIS Domain Name e NIS Server Find by broadcast IP Address Apply 25 4 5 Macintosh Settings NAS server supports two kinds of protocols used for Mac OS clients TCP IP Open Transport and Both AppleTalk and TCP IP Also NAS server provides two kinds of security polices for Macintosh Network AFP client Local account authentication Authenticate user using NAS server s internal user database Local and domain authentication If Windows Network is enabled you can enable both local and domain authentication for AFP client Current Zone A division between groups of machines when viewed using AppleTalk Apple Talk Zones can be seen in the Chooser the AppleTalk Control Panel and the Network Browser AppleTalk Address It is a unique number that identify the server on the network The number to the left of the dot is the network number The number to the right of the dot is the node number Configuring Macintosh Network Set
91. ply to save the setting To set all quotas to the same value please specify the quota value in the Set all quotas to xx MB input field Click the Set hyperlink to save settings Configuring folder quota Folder quota monitors the amount of data that can be stored on the folder on which folder quota is applied regardless of who saves there It can limit the total amount of data stored in the NAS server to effectively control the proper consumption of the storage resources Note that is it prohibited to set folder quota to the Volume root or System folder and its sub folders Folder Name The path and folder name that the folder quota has been applied Total amount of disk space used Quota Limit The amount of data that can be stored in the respective folders Delete quota entries by selecting the check box at the end of each quota entries and click this icon 1 Click the Enable folder quota control checkbox to enable folder quotas 2 Click the D rac to add folder quota to a folder 3 Click the Select Path to browse for target folder 4 Enter the quota limit in MB 5 Click Apply to save the settings 50 6 You can click GB ire Recalculate to obtain the most updated information of the total amount of disk space in use on each folder To set all quotas to the same value please specify the quota value in the Set all quotas to xx MB input field Click the Set hyperlink to save settings Server Network
92. r only certain files or folders For the latter it requires Java virtual machine for the UI Please go to http java sun com for the latest Java virtual machine 4 Click the Next button 5 To restore selected files or folders please make selections on the Java Ul in the What to Restore item 6 Choose the target location It can restore data to either the original location or an alternative location If the original location is selected it will restore data to the location where they are originally backed up Please note that if the original volume is missing it will not restore anything The alternative 67 location means any user defined path Please use the Select Path hyperlink to specify the path It will restore files and the full directory hierarchy under the specified path 7 Specify whether to restore the ACL settings together with the files 8 Specify whether to overwrite the existing files with the backup files 9 Click the Apply button to start to restore Checking Task Progress Viewing Logs When a tape task is running you can view its progress on the Summary page On the upper Summary page is a list of tape drives Any task currently running will be shown as a hyperlink in the Status column Click a hyperlink to watch task progress and details It shows Ready without hyperlinks if there is no running task gt Device List Tow nee wan Sse one rape TAPE Bus 0 Ch 0 Id 0 Lun 0 TANDBERG Sup
93. rage consumption per user during the next startup information It may take much time if there are a huge amount of files in disk Reset configuration to Reset all configurations to default factory default Scheduled shutdown and power on To set the automatic power on and shutdown schedules select the Server Shutdown menu Click the Schedule tab to modify the schedules On the schedule settings page you can set daily or day of month schedules Check the Enable check boxes and specify the time of powering on or shutting down Remember to click the Apply button to submit the changes Server Network Volume Security Disc Server Backup Virus Scan Event Status Information General Password UPS Settings Maintenance Shutdown Upgrade w Manual Schedule You can shutdown or reboot the server when there are no tasks in progress You can also select the startup options to perform during the next startup gt Tasks In Progress Tasks No critical task Options for the next start up F Recalculate quota information l Reset configuration to factory default 17 3 4 Enabling UPS Support The NAS server supports UPS and basic power management functions It sends alerts when there are power events like utility power failure or low battery capacity When power events occur the NAS server can shut down itself automatically to prevent potential data loss To use smart signaling UP
94. re virus infected files are located and quarantine The real time scan history display the date time that the virus is found virus name action taken and the full path name of the infected file And the scan task summary display the start time of each manual or scheduled scan task 11 2 Real time Manual and Schedule Scanning The embedded antivirus utility provides several options for virus protection including real time manual and scheduled scanning to offer comprehensive antivirus and content security solutions for enterprise customers 87 Note Antivirus requires the system folder to operate Please go to the Server Maintenance page and specify the volume where the system folder resides Server Network Volume Security amp Disc Server Backup Virus Scan Event Status information General Password UPS Settings Maintenance Shutdown Upgrade q On this page you can specify the location of the system folder which is required for saving system files or performing certain functions ew The volume which contains the system folder test 1 7 No system file exists e Save the following files in the system folder System Information and event Logs Preview all html all en html sysinfo html system html device html security html Send the saved files by email Mail to Apply Note For the first time operation please go to the Virus Scan Upda
95. rk over 25 C 10 2 Checking the Event Logs You can view a summary of all the events occurred on your NAS server Web Reminder System Log Device Log amp Security Log The severity of each event will be determined by NAS server and displayed in different colors Information Green 81 Warning Yellow Error Red Viewing Web Reminder Web Reminder is the warning message that appear at the first screen of the administrator home page to alert administrator that one or multiple critical events of your NAS server has been found Administrator can therefore be aware of the status of the NAS server immediately when entering the administrator home page Click the hyper link of the Web Reminder message and it will directly lead you to the Web Reminder summary menu Go to Event gt Web Reminder menu to see a summary of all the critical events occurred on your NAS server Viewing System Log In the Event System Log menu you can 1 Select the number of most recent events show on a screen 2 Select the severity level for the events you want to see 3 Click netresh 2 or button to refresh the screen 4 Click Clear 1 button to clear the log Viewing Device Log In the Event Device Log menu you can 1 Select the number of most recent events show on a screen 2 Select the severity level for the events you want to see 3 Click Refresh J button to refresh the screen 4 Click Clear or Bron to clear the log Viewing Security
96. rmal status and system voltage You can use this information to quickly find out the problem of your NAS server and take appropriate action In Status Environment page you can monitor the CPU fan status CPU and System temperature plus the System Voltages Click Refresh to obtain the latest figure Viewing the Open Files In Status Open Files menu it provides the following information about all the open files on NAS server R W read write privileges of the opened file User the name of the user who has opened the file Protocol the protocol used for the network connection SMB NFS AFP or FTP File Name lists the name and path of the opened file Viewing the Active Connections In the Status Connections Current Connections configure and show the protocol used by the client that is currently connecting to the NAS server by click the check box beside the protocol you want to show on the list User the name of the user who has connected to NAS server Computer the computer name of the client connecting to the NAS server Address the IP address of the client connecting to the NAS server Protocol the protocol used for the network connection SMB NFS SYNC AFP or FTP Connected Time the date time that the connection is established Open Files total number of the open files Disconnect disconnect a particular connection by check the disconnect check box and click the icon Viewing the System
97. s Load gt Share Access Counts Share Name Share Type Access Counts System Share Refresh 86 11 Virus Protection Most storage systems are vulnerable to virus attacks An infected file in you NAS server can be exchanged among the clients system in the network and resulting in corrupted data or causing productivity loss The integrated Trend Micro antivirus software in NAS server is the best of breed security product that delivers the reliable antivirus protection to prevent virus from spreading before they get to you 11 1 Information The Information screen is the summary of the current antivirus settings It gives you a comprehensive overview of the current status of antivirus general settings real time scans history and scan task summary of your NAS server General settings display the present condition of the following items Real time Scan Display real time scanning is either disabled or enabled Virus Scan Schedule Display schedule virus scanning is either disabled or enabled Virus Scan Status Display virus scanning is either idle or scanning Pattern Update Schedule Display the status schedule for the next virus pattern file update Last successful update Display the date time of the last successful virus pattern file update Scan engine version Display the current scan engine version Virus pattern version Display the current virus pattern file version Quarantine Folder Display the folder name and path whe
98. s SetlingS ivccenctiscncrcsetcecseraevacssnasunanniesceraeseteansisinetaad vans EAEE EE ENERE EEEa 27 71 OO FI B 8 gy A ef SENO S Eni O E OEA EEO OEA T EAO OTTO 28 Le SNMP S T E E a E E E E OE AE E E E E EAE E 29 Ah AV E OS AA A A A P A E AT P A AA A A AA 30 A OULD S E A S E E E AS E E EE 30 5 STORAGE MANAGEMENT nusssniconi a T E venue onttoutsestsnevine 32 3 4 Volume Usage and SALUS wrccccnsicnncsnesteccenarvenesteevesesnensustetosteagansicnevsaesVeceuporsnctanaalkpodsavsuncaenendoansnavceotedeeteaaaier succes 32 ABa e E A TN A E E O E E EA E E E E E ne eee 34 TAD IN VO INC LOE E S I E EA NEE A E AN ENA E A E E eee AE 35 5 4 Expanding a RAID 5 Volumi oc acrsenccavesetvcaareoesovteusachscbeesensaensesnesstosenstenwasavantneeavpensennwatensenvanvansarasenarssasodsanrabredses 36 BB Vome k SCO es iE aea 36 56 Assigning HotSpare DISKE Rene ee rn Conn ee aN eee OROT ONE ONRET EON OAA 37 rN T ONT VOTES a E A E EEE E E AE E 37 By ted OLS WAPDIN I Car cre EE tia cla einstein ci E area aL E Ue Ra mduuaia E EN AO 38 BB FSS ected cs A EE EE T ovate AG cc ce wate E A Sala and wa cep ne cascade ont Seales aaa EE E a A 38 6 SECURITY CONTRO Livices cece ssccaneseccccuasacscenntapenawesaciiacnsetassvesecScaeuhaeuceeeSevueanesacscanedeewaasusreocacetesacceusecesinens 40 Bi SOC CUTIOY IONA ON aE EE EN aie anata adevtaesath basse da dag vase see bases O capo ehase E 40 6 2 Creating the Local User and Local Group ACCOUNECS 1scccseecccsnesecsauseccsausecssunsccsau
99. s the name of the data archiving task for management purposes Source Folders Specify the data to be archived The folders not preserving the full paths will be archived to CD DVD discs Disc Label Specifies the labels of the CD DVD discs Date Extension If the date extension is enabled it will append the date of archiving to the disc labels For example ARCH20041010_01 is the first disc created by the data archiving task on October 25 2004 with the date extension The second disc will be ARCH20041010_ 02 if more than one disc is created Disc Type Specifies the media for burning It can be a CD 650M 700M a DVD a blu ray DVD or a dual layer DVD The NAS server will create disc images that match the size of the disc type and then burn the disc images Advanced Settings File At first the settings are hidden Please click the Show hyperlink Filtering to display the advanced settings The file filters specify which files in the source folders to include for data archiving You can choose to include only the files which are in the specified date range Or you can choose to include the files which are N days old Or you can choose to include only the files of which the archive bits are set The NAS server will clear the archive bits of the source files which are archived if not deleted Advanced Settings Skip You can set constraints so that the archiving task is activated Archiving Do archiving only when one of
100. s the volume name which is defined when creating a volume Each volume name is also a hyperlink It opens a page for showing the detailed information of that volume Members indicate the hard disks which compose the volume RAID Type indicates whether this volume is JBOD a single hard disk RAID 0 RAID 1 RAID 5 RAID 6 or RAID 10 Please refer to the next section for more information about RAID Free Space indicates the volume usage by showing the free storage space in the volume and the percentage Total Space indicates the volume size Status indicates the disk activity on the volume The disk activity may be one of the following Ready The volume is mounted and ready for data access Not Ready The volume is not mounted successfully It is not accessible Degraded One of the volume members is defective Data are still intact and accessible but the volume is no longer protected by RAID Data backup and RAID rebuilding are strongly suggested when a volume is in this state Critical Two of the volume member is defective Data are still intact and accessible but the volume is no longer protected by RAID Data backup and RAID rebuilding are strongly suggested when a volume is in this state Faulty Two or more hard disks in the volume are not functional It is not possible to perform any data access or recover any data Faulty RW Two or more volume members are defective 32 There might be data loss but it is possible to
101. save the setting SACRE ETSETS EMESIS Security iy Hine Sarver ESES RUE Beat Renee Sears Information File Folder Share ACL Account Quota g Here you can perform the following actions To change the owner of the file or folder use the Owner column To create a share or modify share property use the Sharing column To add or modify ACL use the Secunty column To assign share permission of a share for local account and domain account 1 Go to Security Share menu 2 Locate the share and click assign or modify share permission to this share 3 Highlight the users or groups from user pool and click users checkbox 45 4 Select the appropriate permission from the pull down menu at the bottom 6 You can modify the permission of the users or groups in the privileged list by first highlight the users or groups and then select the appropriate permission from the pull down menu at the bottom of the share permission item 7 Click Apply to save the setting Note You can also modify share permission in Security File Folder menu by click the Modify hyperlink of the corresponding shared folder You can assign the following share permission to a user on NAS server No Access NA Account has been denied access to the share Read Only RO Account is allowed to read the share Change CH Account is allowed to read and write to the share Full Control FC Account
102. secssaueeessunecesassessassssaanseees 41 6 3 Caching Windows Domal USER ACCOUNTS esiseina aa E A Capes O 43 GA CreGunG UNIX LINUX OSE roind e cals seals a es sod E A E TA 44 6 5 Creating Share and Assigning Share Permissions ccssscccccseecccssscccsseccssuseccauecessasecssaseessusecesaussessausessaaseees 45 6 6 Configuring File and Folder Security and ACL ccccccssesseccccansssecccaeesecccnscuseecessuseecssaueneessssuunsessssauneeesssaanseeeeas 47 67 M nagng QUOTE iaie E E E E etree oueneneaneh taal 49 7 DISC SHARING AND DATA ARCHIVING cresas nnee EEE E 52 Fed CREOUNG DISC HINOGES rir EE T E EEE EA EE E AO TA 52 k Manding DISES aae a E T E A N N day entoniawenns 53 TD SIVAN DISCS Er RE TAA EEO ET ATA E E O R O OTE 54 PA BUMI D C INAJ ES i E EEE A EE A E EE E E OME Rae EAs 55 Za Archiving Data to CD DVD DISCS aare EAEE A AEE A E N 55 8 USER ACCESS ciin aa a a a aa aA 58 Bit WOFKGKOUP OF Domain MOUE innn En E E E T OE TNA 58 8 2 ACCESSING FLOM WINGOWS css averse a i ee A a ee 58 8 3 Accessing Froni Web BIOW SONS air of cucnicrays raiona ienn T n EEKAN ATENEA EA A EAEE EEEE EE E 59 8 4 Accessing Trom MacOS iieiaei nia i i i i a a A a E e 61 ga Accessin FONT TFIP C NENS aeneae E ETE EA ae N E E E 62 850 ACCESSING FLOM NFS CHONUS oiae a a a a e a N T aoe 62 9 BACKUP AND RECOVERY irii a a a lances aa aa na 64 9 1 LOGGING and Witing CD DVD DBCS eea Eaa ANE A A AON TAAA INON eee 64 9 2 Tape Backup GNO RESTOTE orriei EE ENEE EAR A E E E E EE
103. server will not recognize them 52 immediately Administrators must command the NAS server to discover disc images manually or set up the NAS server to discover disc image regularly To discover disc images manually please open the Disc Server Disc Images administration page and click the Rescan images hyperlink to the right of the page To set up the NAS server to discover disc images regularly please open the Disc Server Information page Configure the Disc Server Settings to enable the NAS server to scan for disc images every one hour Using the remote mirroring software to create disc images Please refer to Appendix B Utility for NAS server for how to use the remote mirroring software 7 2 Managing Discs Once the disc image is created in the NAS server it can be seen on the Disc Server All Disc Images menu of the administration page If the disc images are not created or duplicated by the NAS server or by the remote mirroring software administrators will have to re scan the disc image folders for disc images manually For example if disc images are copied from another NAS server to a disc image folder over network using the Windows or other OS platforms the NAS server will not be able to list them on the Disc Images page In such cases administrators have to click the Re scan images hyperlink text to the right of the page To change the disc name To change the disc name click on the hyperlink text in the Disc Name colu
104. ssing 2 Choose Allow file download only or Allow file upload and download 3 Click the Local account authentication radio button to authenticate user using the server s local user database 4 Or click the Local and domain account authentication radio button to use both local account and Microsoft domain security authentication 5 Select the default type of the folder display on the user page You can choose from Detail View Large Icons or Small Icons 6 Click the checkbox beside the Allow users to modify ACL to give users the privilege to modify the ACL table entries 7 Click Apply to save the setting Server Network Volume Security amp Disc Server Backup Virus Scan Event Status Information TCP IP Windows UNIX Linux Macintosh Web FTP SNMP Email SSL gE V Enable Web Data Access HTTP Protocol e Access Control Allow file download only Allow file upload and download e Security Policy Local account authentication Local and domain account authentication e Default user page Default view type Detail view 7 F Allow users to modify ACL Apply 2 4 7 FTP Data Access Settings NAS system supports File Transfer Protocol FTP that allows users to transfer files via the Internet By properly configuring the FTP settings you can effectively control how users access the content in your NAS server via FTP Configuring FTP Data Access 1 Click the E
105. status of the User Quota Control Status Enabled or Disabled Folder Quota Control Display the status of the Folder Quota Control Status Enabled or Disabled Server Network Volume Security amp Disc Server Backup Virus Scan Event Status Information File Folder Share ACL Account Quota go gt Security Database e Number of Shares e Number of ACL Nodes e Number of Accounts Local User Group Domain User Group Trust Domain User Group Host Entry e Folder Quota Entry 10 o oOo oO ff amp Oo OO gt Security Configuration e Windows SecurityMode Workgroup Mode e Workgroup Domain Name None e Domain Login Account None e ACL Security Control Enabled e User Quota Control Enabled e Folder Quota Control Disabled 6 2 Creating the Local User and Local Group Accounts A local user or group is an account that can be granted permissions and rights from your NAS server You can add local user to a local group Groups are indicated by a sign at the suffix of the name You can also grant administrator privilege to a local group Groups with administrator privilege are indicated by a sign at the suffix of the name To create a local user 1 Go to Security Account Local Account menu 2 Click the Add User button 3 Type in the user name and enter the password 4 Re type the password to confirm 5 Click Apply to save the setting 41 To create a local group 1 Go to Security A
106. t will append the backup to the tape not overwriting any existing data on tape 7 Specify whether to enable hardware compression capability when the tape drive has the feature 8 Click the Apply button Restoring Files from Tape To restore data from tape please open the administration page and go to Backup gt Tape Backup page Click the Restore tab and follow the steps below Summary Backup Restore gt Restore files from tape Step 2 Select files or folders to restore e Tape Drive TAPE1 e What To Restore Backup Indexes Tape Label Backup Type Backup Time e WhatTo Restore Ga EFT system antivirus archive backup config up PP lAnooooooe p p imp acnt c info logs wen Gla e Restore Files To Original location Alternative location Select Path e Restore Options Il Restore security Overwrite Options Never overwrite the existing files C Always overwrite the existing files C Overwrite older files with newer files Previous Finish Cancel 1 Specify the Tape Drive for restoring 2 Specify a backup set to restore by selecting a backup index The backup indexes are required to restore data from tape When the backup indexes are missing you have to import them from tapes for further restoring operation To import backup indexes please select a tape drive and click the Import hyperlink 3 Choose whether to restore all the files in the backup set o
107. te page to obtain the most updated virus pattern file Otherwise the antivirus function cannot work Enabling Real time Scanning The real time scanning function provides antivirus protection while users are reading or writing files to the NAS server 1 Click the Enable Real time scan checkbox to enable real time scanning 2 Select scan direction Incoming files are those that are being stored in NAS server whereas outgoing files are copied or moved from NAS server to other location 3 Click Apply to save the settings Configuring Manual Scanning The manual and scheduled scanning function can scan any folders for infected files The scan results will be listed as a scan task summary on the Information page 1 Go to Virus Scan Setting page to configure the scan settings required See Configuring Scan Settings on Section 11 3 88 2 Click the Manual tab to go to the manual scanning page 3 Click the Select Folders hyperlink to specify the folders you want to perform the manual scan 4 Click Apply to save the settings Configuring Schedule Scanning 1 Click the Enable Scheduled Scan For Infected Files checkbox to enable scheduled scanning 2 Click the Select Folders hyperlink to specify the folders you want to perform the scheduled scan 3 Configure the start time and recurrence pattern for the scheduled scanning 4 Click Apply to save the settings 11 3 Configuring Scan Settings All virus scan has two op
108. th the SmartSync function for NAS to NAS data replication Two or more NAS server are required one as the SmartSync server others as the SmartSync clients The SmartSync server is like an ftp server The SmartSync clients can either replicate their data to the SmartSync server or copying data from the SmartSync server depending on the task settings There are three operating modes of SmartSync mirror for one to one data replication backup for disk based backup distribute for one to many data distribution The following sections describe the usage and applications of these operating modes Building a Mirror Site Two NAS server are required one as the SmartSync server another as the SmartSync client It will replicate data from the SmartSync client to the SmartSync server On the NAS server which acts as the SmartSync server create a sync point in it Async point is a folder in the SmartSync server which is exposed to SmartSync clients for data replication A sync point of mirror mode receives data from a SmartSync client and builds an identical data copy in it To create a sync point please go to the Backup gt SmartSync gt Server menu on the Administration Page Click the Add button to open the page below On the page you should provide the sync point name and specify which group is allowed to replicate data to this sync point Set the mode to Mirror Server Network Volume Security amp Disc Server Backup Virus
109. the Windows Network is set to using Domain Mode in your NAS server you need to cache domain account in the NAS server s local user database By caching domain accounts it soeeds up the process of setting permissions and quotas To retrieve Windows domain user group 1 Go to Security Account menu 2 Click the Domain Account tab 7 Select the domain users or groups from domain user pool and click domain user checkbox 8 Click Apply to save the setting Filter Rules 1 User Group You can filter windows domain pool displays domain users or domain groups or all 2 Domain You can filter which one domain displays in pool or all 3 Authorized Unauthorized You can filter authorized or unauthorized domain accounts or all 4 Keyword You can filter domain accounts which you key in some keyword in field 43 Synchronize user database This function synchronizes the domain accounts cached in the NAS user database with the native domain controller New domain accounts in the domain controller will be added to the NAS user database while the non existent domain accounts will be removed from the NAS user database Due to the limitation of system resource the user database synchronization will be skipped if there are more than 10 240 domain accounts in the domain controller To synchronize with the domain controller Update user database Changes of user accounts on the domain controller will not affect the NAS server automatically Y
110. tings 1 Click the Enable Macintosh Network AFP Protocol checkbox to enable access for AFP client 2 Select a protocol and click the radio button beside it 3 Click the Local account authentication radio button to authenticate user using the server s local user database 4 Or click the Local and domain account authentication radio button to use both local account and Microsoft domain security authentication 5 Select the Current Zone from the pull down menu or Default Zone is assigned by default 6 Click Apply to save the setting Server Network Volume Security amp Disc Server Backup Virus Scan Event Status Information TCP IP Windows UNIX Linux Macintosh Web FTP SNMP Email SSL we V Enable Macintosh Network AFP Protocol e Protocol TCP IP Open Transport Both AppleTalk and TCP IP e Security Policy Local account authentication Local and domain account authentication Current Zone Default Zone 7 e AppleTalk Address 65280 158 net node Apply 26 4 6 Web Data Access Settings This section shows the parameters that you can set up for user to access NAS system user s home page You can configure the user access constraint authentication policy and default setting by defining the Access Control Security Policy and Default User Page settings Configuring Web Data Access 1 Click the Enable Web Data Access HTTP Protocol checkbox to enable Web data acce
111. tions that need to be configure File Type to Scan you can limit scanning to specific file types Action When Virus Found three actions quarantine clean delete can be chose from when virus is found File Types to Scan Server Network Volume Security amp Disc Server Backup Virus Scan Event Status information Scan Settings Update re gt File Types to Scan all file types Files with specified file extensions ONLY Scan Trend Micro recommended extensions Qr R Scan selected extensions Type a file extension List of selected file extensions 1 Click the desire scan file type 2 If All file types is selected all files regardless to its file extension will be scanned 3 If Files with specified file extensions Only is selected specify using the recommended extensions recommended by Trend Micro or specify the file extension manually 4 Note that the maximum scanning layer of a compressed file is set to 2 layers for all real time manual and scheduled scan Actions When Virus Found Action When Virus Found Quarantine move infected files to the quarantine folder Clean remove virus code from infected files quarantine if clean fails Delete remove infected files Apply 1 Click the desire action when virus was found 2 Click Apply to save the settings 89 11 4 Updating Virus Pattern File Virus pattern update can be performed either manually or according
112. to the schedule It is required to perform a manual update immediately when the antivirus function is activated for the first time Configuring a manual update 1 To download virus patterns from Internet select Trend Micro update server on internet Please note that you have to specify the DNS server IP address on the Network gt TCP IP menu of the Administration Page 2 Or you can download the virus pattern file in ZIP format from Trend Micro s website http www trendmicro com manually Select A virus pattern file in ZIP format here and specify the location of the virus pattern file 3 Click Apply to save the settings Configuring a scheduled update 1 Click the Enable Scheduled Update of Virus Pattern Files checkbox to enable scheduled update 2 Configure the download schedule Select the start time and recurrence pattern for the scheduled update 3 Click Apply to save the settings 90 12 Appendix A Product Specification GNS 4001 Specification Dimension 5mmxtGormacomm O FFormFactor tw 1x CF slot Ultra DMA 100 1x RS 232 Peripheral Support 2x USB 2 0 1x E SATA 1x SATA II For Optical Device Busser monen OOOO 91 Appendix D Utility for NAS system NAStool is a powerful software that discover and administer NAS Servers on the network and remotely loads disc images into the NAS Server You can either duplicate a whole CD or build an image from a group of files Sharing and publishing data w
113. tocol in Windows to use NAStool Installing NAStool You are ready to install this utility if the TCP IP protocol is installed in your computer To install NAStool insert the Utility CD into the CD ROM drive On the auto run interface click Install NAStool lf the auto run interface does not appear go to X NAStool and run NAStool exe where X is the drive letter of the CD ROM drive 104 Follow the instructions in the setup wizard to install NAStool It will create shortcuts on Desktop and in the Programs folder of the Start menu Discovering NAS system When startups NAStool automatically discover all the NAS systems on the network and display a list of server under the node Local Server NAStool will automatically refresh the server list at a specified interval The default interval is 10 minutes NAStool can also locate NAS servers by IP addresses It is useful when NAS servers are on the Internet or located in different network segments from the NAStool To locate NAS servers by IP addresses select Remote NAS List from the File menu Click the Add button and enter the IP address of the NAS server To set the automatic refresh interval 1 Go to Tool NAStool Options menu 2 Enter a number between 1 to 60 minutes 3 Click OK Server Quick Setup Using NAStool You can perform initial setup for your NAS system using NAStool 1 Click the i button on the toolbar 2 Or go to Server gt Server Quick Setup 3 Se
114. try and click Create in the Sharing column or click Modify if the volume has been shared On the Property page check the Web Access HTTP check box and click Apply 4 Set the share permissions After sharing the volume click the Share Permissions tab to specify the access rights of local users groups and domain Now users can run the web browser and open the IP address of 192 168 170 172 to browse the NAS server When the user homepage is opened it prompts for user name and password Then it will display all shared folder after user login The user homepage will be like 59 i S V O nN GNS 4001 4 Bay Gigabit Network Storage Logout NASD80052CF Admin Server Name NASD80052CF GS CDROM 2012 01 13 15 08 11 G MIRROR 2012 01 13 15 08 11 A E In the top right corner of the user page are the tool bar icons which provide access to various functions like creating folder or uploading files Below the tool bar are the server name and the login user Lower on the page is a file browsing area Tool bar icons Change View Mode changes the views of the file browsing area between Detail Large Icons and Small Icons Change Password modifies the password of the login user It allows a local user to change the password Create Folder creates a new folder in the current path if the login user has the access right Upload File uploads files to the current path if the login user has the access right
115. u want the corresponding management console to receive trap message 5 Select Read Only from the pull down menu if you want the corresponding management console has read only privilege 6 Repeat Step 2 to Step 5 if more than one management console is available NAS server supports up to 4 management consoles 7 Enter the location information of your NAS server 8 Enter the name of the contact person who has the management information of the NAS server 9 You can check the checkbox beside Send a test trap to send sample trap information to validate your setting of the SNMP settings 10 Click Apply to save the setting Server Network Volume Security amp Disc Server Backup Virus Scan Event Status Information TCP IP Windows UNIX Linux Macintosh Web FTP SNMP Email SSL we Enable SNMP Protocol Community IP Trap Management 29 4 9 Email Settings You can configure email notification to notify you when there is an event occurred to the NAS server Enter the information of the SMTP server on your network in this menu you can configure what kind of event should trigger the email notification process in the Event Configuration Advance menu Configuring Email Settings 1 Click the Enable SMTP Protocol checkbox to enable SMTP protocol 2 Enter the SMTP Server Address 3 Enter an existing user account name of the SMTP server 4 Enter the password of the account 5 Enter up to two email
116. ume Label Detauk the same as CD Label MESURO 4 Specify the date time to run the task Then press Next Wizard Mirror CD DVD Schedule Wizard Mirror CD DVD tT ed et ee Mirror Option 6 Click OK to start the task The Task Manager will show the progress C Task Manager 1 task s La Lx 1 Mirror CO DVO 111 Archiving Files As a CD DVD Image This chapter describes how to build CD image from My Container into a NAS Server Please follow the steps below 1 The first thing to build a CD DVD image is to collect files Open Windows Explorer and drag amp drop files into My Container sete scs san ot 2 Click the Build Image icon on the tool bar to bring up the Build Image wizard You can click the Validate button to check if the file folder information in My Container is correct If not you can choose to update My Container Wizard Build Image Validate Container Information J You can validate the information in My Container chad Next gt x Conceal 3 Choose one or more servers as the destination Select a server in the Target amp File Path list box select Smart mode for redundancy check of the CD image or select Force mode to allow a second copy of the same CD image Then click the gt gt button You can see the task being added to the right hand pane Click the Next button to go to next page 112 Wizard Bu
117. up USB Device NAS server supports USB pen drive and external hard disk Support FAT FAT32 only backup in optional models with USB ports The front penal will display to ask if you want to process USB backup or not when plugging in a device System will jump out the display without any inputs in 60 seconds You can also activate this function via web interface 78 Enable USB Backup Plug in the device and check the Enable USB Backup You will see the menu for selecting the source folder and the target folder Click Select Path by Source Folder to select the entire drive or individual folder in device you want to backup Limitation This function doesn t support the CARD Reader One drive support 3 partitions Please unmount the USB device before removing or the data may be damaged g Server Network Volume Security Disc Server Backup Virus Scan Event Status Tape Backup SmartSync Loader Writer System Profiles USB 7 Tasks In Progress Tasks No critical task Recover system configurations e Select a System Profile The backup at An external file e Restore Option l Server and network settings User accounts and quota settings Security Information including network shares and ACLs Backup settings 19 10 Event Logs and System Status This chapter covers the Event Notification and System Status pages You can collect in
118. ve obsolete data out of the NAS server so that disk space can be freed for future uses lf used with the Disc Server function the Data Archiving function becomes more versatile You can choose to turn some less frequently used files to read only disc images first which can be mounted by the Disc Server function to share to network users in read only forms When the archived data are not in use for a long time you can then choose to burn them to discs freeing the hard disk space The Archive Folder During data archiving the NAS server will first create disc images in the archive folder which is a disc image folder specifically for storing archived data in the form of disc images Firstly specify the location of the archive folder on the Disc Server Data Archiving gt Summary page before you use the data archiving function Summary Logs On the Disc Server Data Archiving gt Summary page are also shows the summary logs which keep track of the execution summary of the data archiving tasks In addition they keep records like which disc images are created which are burned and which are 55 not Click the View hyperlink under the Discs column of the Summary Logs table to view the list of disc images For those disc images not burnt yet you can choose to burn them Setting Up Data Archiving Tasks On the Disc Server Data Archiving Tasks page you can create tasks to archive data manually or scheduled Task Name Specifie
119. volume creation is shown on the Volume Information page Below are the volume types JBOD Just a Bunch Of Disks A JBOD type volume contains only one hard disk as its member RAID level 0 is disk striping only which distribute data evenly over multiple disks for better performance It does not provide safeguards against failure RAID level 0 uses two or more hard disks RAID level 1 uses disk mirroring which provides 100 duplication of data It offers high reliability but doubles storage cost RAID level 1 uses two hard disks RAID level 5 distributes data and parity bits over multiple disks 34 for both performance and fault tolerance A RAID volume can still work when a hard disk fails RAID level 5 uses three or more hard disks Building a RAID 5 volume may take hours depending on capacity RAID 6 RAID 6 striped disks with dual parity combines four or more disks in a way that protects data against loss of any two disks RAID 10 RAID 1 0 or 10 is a mirrored data set RAID 1 which is then striped RAID 0 hence the 1 0 name A RAID 1 0 array requires a minimum of four drives two mirrored drives to hold half of the striped data plus another two mirrored for the other half of the data In Linux MD RAID 10 is anon nested RAID type like RAID 1 that only requires a minimum of two drives and may give read performance on the level of RAID 0 Write Once Volume When setting a Write Once volume you are
120. word group user quota user folder folder quota create default ACL user001 aataa1 groupA 1GB vol 1 users user001 1GB yes user002 bb2bb2 groupA 1GB vol 1 users user002 1GB yes user101 101101 groupB 10GB vol 1 users user101 10GB no lt is suggested that administrators use Microsoft Excel to maintain the account file then save it as CSV files in which fields are delimited by commas Thus the advance features of Microsoft Excel like filling in a series of numbers or items easy copy and paste can be used To mass import local accounts 42 1 Go to Security Account Local Account menu 2 Click the Mass Import button 3 Select a file to import 4 Click the Apply button 5 If there are any errors it will be displayed in the pop up window after clicking the Last Import hyperlink Server Network Volume Security amp Disc Server Backup Virus Scan Event Status Information File Folder Share ACL Account Quota q Local Account Domain Account gt Add delete or modify local users and groups UNIX Linux Host Local Account Admin Add User Aodmins A j Everyone Add Group Mass Import Last Import indicates group 6 3 Caching Windows Domain User Accounts Domain users and groups are managed by your network administrator Windows network use a domain controller to store the information of all the domain users and groups When
121. ystem settings to restore Then click the Apply button A system profile can also be created by the NAStool software To recover from a system profile saved by NAStool click the An external file item and find the system profile Specify restore options and click the Restore button Restore options are Server network and backup settings includes all settings in the Server Network Backup and Event Configuration menus Please note that the admin password will not be restored during the recovery User accounts and quota settings includes local accounts current domain accounts and trust domain accounts together with their quota settings User accounts will be appended to the existing user database local accounts with the same names will be overwritten domain accounts with the same SID will be overwritten others will be added to the existing user database Security Information including network shares and ACLs includes all network shares share permissions and access control lists Server Network Volume Security amp Disc Server Backup Virus Scan Event Status Tape Backup SmartSync Loader Writer System Profiles USB q Backup Restore Enable Backup of System Profiles e Backup Schedule Immediately According to the schedule Time Weekly Sun Mon Tue Wed Thu Fri Sat Day of Month e Current backups of system profiles No system configuration backup file 9 6 Back

LevelOne GNS-4001

Contents

Download Pdf Manuals

Related Search

Related Contents