Home
Thecus N2200XXX storage server
Contents
1. es 141 OVerVIG W ense snam wn aS MV M cR iw i AR RR RC ER DN DR NR LR Rr Nn NN TUN 141 Login Pages axesabeazEsaspenAFESEIM AMI EMAMEMUM MEAE I PEL IAM EIE MR MIMEEEK GRE 141 Using the Web Disk Does not apply to the 3X series Web Disk 141 Using the Web Disk Support 3X series nn Hel AK TE SIE Photo Server Does not apply to the 3X series photo server 144 Windows XP Publishing Wizard eeeeeeee nnn 144 Managing Albums and Photos cceeeeeeen nmn 149 Creating ATDUPNIS esse u deant E Ease tc eelqu asain MOLD E ISSUE EDAD IRE A 150 Password Protecting ATDUTIS 2o dossaa YE eR E HR ad ERR ERE ER a RR RR 150 Uploading Pictures EO ATDUTLTIS utet rV EUELE RV CHR PA ERE LEE Pe Esa rv ER PR 150 EXIF MIOMA g ferm 151 Side SNOWS aoe recs cia ud diis fahr atatim at A v a inan tana are fuU D MR MEME ts 151 Photo Server Support 3X series eer nnn nnn nnn nnn nnn Hall ARER EI Mapping a Client PC to the Thecus IP Storage 152 WINGOW S Lcid ere re es ere oe CUM LM LEM t AME EE 152 ADPIC OS quM p rM RR 152 Mapping Thecus IP storage as an iSCSI Drive 152 Wirndows2000 XP actae tia on eg vRERP MERIDIA ED EREDESEPERISLRPKCRTIPATEPRPDG MEER 153 MIBIIONWS VISEd sumas sti VEMM d PEL PEL EMDI MIELE PELLI EIE 157 Chapter 6 Tips and THICKS ivixiss uk axa ak EE IRR RO RCRUM
2. od 3 Device Network Configuration Discovery Version 2 0 4 Host Name NSSOD E Login PT System s siia OFixedIP DHCP SIME IP Setting Configuration ess 172 16 64 222 3 Change x 2e oee Password 255 latte tewa 172 16 66 135 3 Complete em 4 Device Change Password Discovery Version 2 0 4 3 Login System 3 Network 7 Configuration New Password Confirm Again 4 Change Password 3 Complete 44 8 Finished Access the Thecus IP storage Web Administrator Interface by pressing the Start Browser button You can also configure another Thecus IP storage at this point by clicking the Setup Other Device button Press Exit to exit the wizard Setup Wizard 3 Device Discovery 3 Login System Setup Other Device 3 Network Configuration Start Browser 3 Change Password Complete The Thecus Setup Wizard is designed for installation on systems running Windows XP 2000 vista 7 or Mac OSX or later Users with other operating systems will need to install the Thecus Setup Wizard on a host machine with one of these operating systems before using the unit LCD Op eration N4100PRO N5200XXX N5500 1U4200XXX 1U4600 N7700 series N8200XXX N8800 series The mentioned models above are equipped with an LCD on the front for easy status display and setup There are four buttons on the front panel to control the LCD functions LCD Controls
3. Bonjour Setting Bonjour is Apple Inc s trade name for its implementation of Zeroconf a service discovery protocol Bonjour locates devices such as printers as well as other computers and the services that those devices offer on a local network using multicast Domain Name System service records This definitive guide walks you through Bonjour zero configuration networking with a complete description of the protocols and technologies used to create Bonjour enabled applications and devices Bonjour Setting Bonjour service Enable C Disable 123 Application Server Thecus IP storage support iTunes server functionality Module Installation and Auto Module Installation The iTunes server function allows you to play music files from your NAS through iTunes on your computer The following section shows you how d Application Server H iTunes Module Installation af Auto Module Installation iT unes Server With the built in iTunes server capability Thecus IP storage enables digital music to be shared and played anywhere on the network From the Application Server menu choose the iTunes item and the iTunes Configuration screen appears You may enable or disable the iTunes Service from here Once enabled enter correct information for each field and press Apply to save your changes iTunes Configuration iTunes Enable iQ Disable Server Name Password Rescan Interval v MP3 Tag Encode
4. Printer Information Item Description O 1 1 O Displays the name of the USB printer manufacturer Displays the model of the USB printer Status Displays the status of the USB printer Remove document Click to remove all documents from printer queue from Queue Restart Printer service Click to restart printer service If a corrupt print job is sent to a printer printing may suddenly fail If your print jobs seem to be locked up pressing the Remove All Documents button to clear the print queue may resolve the issue You can configure Thecus IP storage to act as a printer server letting all PCs connected to the network utilize the same printer Windows XP SP2 To set up the Printer Server in Windows XP SP2 follow the steps below 1 Connect the USB printer to one of the USB ports preferably the rear USB ports front USB ports can be used for external HDD enclosures 2 Goto Start Printers and Faxes 3 Click on File Add Printer 4 The Add Printer Wizard appears on your screen Click Next 5 Select the A network printer or a printer attached to another computer option 6 Select Connect to a printer on the Internet or on a home or office network and enter http Thecus IP storage IP ADDRESS 631 printers usb printer into the URL field 7 Your Windows system will ask you to install drivers for your printer Select correct driver for your printer 135 8 Your Windows
5. gt O Item JJDesciption Logs From the System Information menu choose the Logs item and the System Logs screen appears This screen shows a history of system usage and important events such as disk status network information and system booting See the following table for a detailed description of each item 5 System Log 3AI info Warnings Errors Download All Log Files Truncate All Log Files Number of lines per page 13 Time Details Help 2010 12 22 12 17 49 N4200PRO PM User admin logged in from 172 16 64 153 N4200PRO PM The system N4200PRO PM RAID is healthy now N4200PRO PM Syslog service stop N4200PRO PM N4200PRO PM boot N4200PRO PM mdadm dev md1 has been started with 3 drives N4200PRO PM Disk sdc UUIDf raid5 d8414dbc 5734bdcc 270dc66 fe2b4200 Thu Oct 28 18 16 56 2 2010 12 22 09 44 54 2010 12 22 09 44 52 2010 12 22 09 44 52 2010 12 22 09 44 49 2010 12 22 09 44 49 2010 12 22 09 44 49 4200PRO PM Disk sdb UUID ra d5 d8414dbc 5734bdcc 270dc66 fe2b4200 Thu Oct 28 18 16 56 2 2010 12 22 09 44 49 4200PRO PM Disk sda UUID raid5 d8414dbc 5734bdcc 270dc66 fe2b4200 Thu Oct 28 18 16 56 2 2010 12 22 09 44 49 N 200PRO PM Syslog service stop 2010 12 22 09 44 49 2010 12 22 09 44 19 2010 12 22 09 44 19 4200PRO PM Assemble RAID md1 from dev sda2 dev sdb2 dev sdc2 2010 12 22 09
6. Shared Folders Add z Edit B Remove NFS Samba snapshot ey ACL older name Quota Limit RAID ID File System Public gt EJ nsyne BS RAID xfs no usbhdd RAID xfs no gt Jusbcopy RAID xfs no gt D naswebsite RAID xfs yes CJiTunes music RAID xfs yes t D_Module_Folder_ RAID xfs yes gt _NAS Module Source x RAID xfs yes t andy 3 RAID xis no gt Dandyl m RAID xfs no 163 add folder x RAID ID v Public Yes No Only ZFS supports folder quota Modify Folder Item Description RAID volume where the folder will reside Enter the name of the folder Admit or deny public access to this folder Share Limit Enter the maximum size of the folder The folder will not grow beyond this limit You can enter a 0 to turn off the share folder limit Apply Press Apply to create the folder Modify Folders On the Folder screen press the Edit button and the Modify Folder screen appears This screen allows you to change folder information After entering the information press Apply to save your changes Modify Folder x RAID ID 2 Folder name Public C Yes i No Only ZFS supports folder quota Modify Folder Item J Description Share Limit Enter the maximum size of the folder The folder will not grow beyond this limit You can enter a 0 to turn off the share folder limit Apply Press Apply to activate settings NFS Sh
7. RAID Information Expand Migrate RAID Edit Disk No Capacity MB Model Status Used Spare 1 476 940 WDC WDSO003AB OK 2 476 940 WDC WD5S0034B OK 476 940 WDC WD50034B OK 4 N A N A N A RAID Level T RAID ID RAID i Allow 09 aez Anz v Master RAID Take effect after checked box Encryption Password Allow 1 16 characters Confirm Password Quick Raid Enable this setting to enhance RAID creation time if there is no partition existed inside of hard disk Stripe Size KB Data Percentage File System v mess Remove RAID destroys all data in the current RAID volume The data is WARNING unrecoverable Expanding a RAID To expand a RAID 1 RAID 5 or RAID 6 volume follow the steps below 1 Replace one of the hard drives in the RAID volume and allow it to automatically rebuild 80 2 Once rebuilt you can continue to replace any remaining disks in the RAID array 3 When you are done replacing hard drives log on to Web Management Navigate to Storage gt RAID to open the RAID Configuration screen 4 On the RAID Information screen and click Edit to open the RAID Configuration screen 5 On the RAID Configuration screen click Expand NOTE RAID expansion did not support file system created by ZFS RAID Configuration RAID Information Unused 86 59 GB 60 Expand Capacity 8659 GB Apply Migrating a RAID Once a RAID volume has been created you may want to move
8. Raid Name RAID v Fie Systems C3nsync Upload B J usbhdd Recursive 0 Apples ACL to all contained sub folders as well May extend restoration time J usbcopy ad naswebsite JiTunes music SEE ZJ Module Folder r Description T LJ NAS Module Source Raid status must he heakhy degraded x ACL restoration from a ZFS fle system can onl be appled to another ZFS fle system pmi a Recursive AOL restoration does not apply to the USBHDD ushhdd folder a Whie the RAID parton is reetonng backng up ACL ts folders wil not be shown within the UL LJ pm2 e ACL restoration backup cannot ba appled to stacked folders For the ACL restore it could be restored in same system or used in other unit For example restore the ACL backup file to other unit This unit has RAID volume RAIDpm with share folder as listed on right hand screen shot 176 ACL Backup Restore Shared Folders AOL Service Backup m Restore Raid Name RAIDpm File System xfs Add peat QpRemove Upioad C fakepsth folder acl bi Ta Fokler name 3 gt Lnsyne Recursive C Apples ACL to all contained sub folders as well May extend restoration time Jusbhdd Next gt LJusbcopy Description __ om 4 gt L9nasw
9. Thecus N3200XXX NO503 N4i100PRO N4200 series N5200XXX N5500 1U4200XXX 1U4600 N7700 series N2200XXX N8200XXX NS800 series User s Manual ve s Copyright and Trademark Notice Thecus and other names of Thecus products are registered trademarks of Thecus Technology Corp Microsoft Windows and the Windows logo are registered trademarks of Microsoft Corporation Apple iTunes and Apple OS X are registered trademarks of Apple Computers Inc All other trademarks and brand names are the property of their respective owners Specifications are subject to change without notice Copyright 2011 Thecus Technology Corporation All rights reserved About This Manual All information in this manual has been carefully verified to ensure its correctness In case of an error please provide us with your feedback Thecus Technology Corporation reserves the right to modify the contents of this manual without notice Product name Thecus N2200XXX N3200XXX N0503 N4100PRO N4200 series N5200XXX N5500 1U4200XXX 1U4600 N7700 series N8800 series N8200XXX Manual Version 6 5 Release Date October 2011 Limited Warranty Thecus Technology Corporation guarantees all components of Thecus NAS products are thoroughly tested before they leave the factory and should function normally under general usage In case of any system malfunctions Thecus Technology Corporation and its local representatives and dealers are responsible for repair without cost to t
10. Co Front Panel Item _ Description 1 Power Button e Powers the N2200XXX on off USB disks and USB printers Button 4 Card reader e Supports SD SDHC MMC cards via USB interface 5 HDD1 led e Blinking white HDD activity 6 HDD2 led e Blinking white HDD activity e Solid white WAN Cable link e Blinking white Network activity e Solid white LAN Cable link e Blinking Network activity 9 USB Copy led e Blinking white USB copy activity 10 Card reader e Blinking white Card reader copy activity led 11 N3200XXX The Thecus N3200XXX s front panel has the device s controls indicators and hard disk trays MM Front Panel 1 Power LED 2 WAN LAN1 LED e Solid green Network link e Blinking orange Network activity 3 LAN2 LED e Solid green Network link e Blinking orange Network activity 4 HDD 1 LED e Solid red HDD failed e Blinking orange HDD activity 5 HDD 2 LED e Solid red HDD failed e Blinking orange HDD activity 6 HDD 3 LED e Solid red HDD failed e Blinking orange HDD activity 7 USB Port 8 Power Button 9 LCD Display 10 Down Button v 11 Up Button A 12 Enter Button 1 13 Escape Button ESC 12 NO503 The Thecus N0503 s front panel has the device s controls indicators and hard disk trays aaa LUILEIEE ES L uum ss CEN Imit Front Panel Item V Description 1 0 O Power LED e Solid blue System is po
11. v Apply See the following table for detailed descriptions of each field iTunes Configuration Item Descipion 9 iTunes Enable or disable the iTunes Service Server Name Name used to identify Thecus IP storage to iTunes clients Password Rescan Interval ID3 tags will be sent out in UTF 8 format Once the iTunes service is enabled Thecus IP storage will make all music located in the Music folder available for iTunes equipped computers on the network Module Installation From the Application Server menu choose the Module Installation item and the Module Management screen appears From here you can install separate software modules to extend the functionality of your Thecus IP storage 124 Module File E Module Management Enable Type Name Version Description Last Status Action Auto Module Installation Or choose the Auto Module Installation item and the available system Module screen appears The default to get module list is On line so if Thecus IP storage is capable to connect to Internet then it will automatically link to Thecus official website then list available modules Please refer the screen shot below Module Package B Module Source List Installed Name Version Description Location Document Action Not Installed NZBGet 1 0 0 NZBGet download Online Not Installed Mailserver 1 00 10 Mailserver Online amp ling Not Installed IP Cam 2 0 1 Simple surveilla
12. 44 19 K 4 Paget Displaying logs 1 13 of 24 Time 2009 05 23 134451 l Sort Ascending 7 2009 05 25 13 41 20 z Sort Descending 9M unavailable 2000 0325 133624 500 dualll found UPS isl unavailable 2000 05 25 13 31 24 es Columns J Time was ccaddide 2000 05 23 13 26 18 5300 dual l The syste Logs Information unavailable 2009 05 25 13 21 13 5500 dual01 The svstem n5500 dual0T found UPS is unavailable 2009 05 25 13 16 08 5300 dual l1 The system n3300 dualll found UPS is unavailable 2009 05 23 13 12 28 5300 dual01 User admin logged in from 172 16 65 107 2009 03 23 13 11 03 3500 dual 1 The svstem n5500 dual1 found UPS is unavailable See the following table for a detailed description of each item Item Description J messages and error messages System Logs ERROR Shows only error messages Download All Log File Export all logs to an external file Truncate All Log File Clear all log files The number of lines per Specify desired number of lines to display per page page Sort Ascending Shows logs by date in ascending order Sort Descending Shows logs by date in descending order lt lt lt gt gt gt Use the forward gt gt gt and backward lt lt lt buttons to browse the log pages On line Register From the System Information menu choose the On line Register item and the System On line Register screen appears The on line register service can periodically update th
13. 5 SATA HDD trays e Locks are provided for added security 16 N7700 Series The Thecus N7700 series front panel has the device s controls indicators and hard disk trays LJA ME LJ LE I LEA E LR amp LA NE IJ oe a L L 4 b LI L L E b L L LI LI b LI LI L 1 L2 2 JI LJ LEA 22 LA LJ 288 2 LJ j L3 amp se ss 2 see LIA ss see E I 3 LJ M J se LAM LER LA LA a LJ 8 d ss LIS LA LOS LA LA amp LS LIA LJA E LJA LEA Ll 2 ss se ss ss LJA LJ LA M LJ M LIA E Front Panel 1 Power LED e Solid blue System is power on 2 System LED e Solid orange system is being upgraded or system startup data currently inaccessible 3 WAN LAN1 LED e Solid green network link e Blinking green network activity 4 LAN2 LED e Solid green network link e Blinking green network activity 5 USB Copy LED 6 eSATA link LED 7 USB Port 8 Power Button 9 Up Button A 10 Down Button Y 11 Enter Button 12 Escape Button e Push to leave the current LCD menu ESC 13 LCD Display e Displays current system status and warning messages 14 HDD Trays e Seven 3 5 SATA HDD trays e Locks are provided for added security 17 1U4200XXX The Thecus 1U4200XXX front panel has the device s controls indicators and hard disk trays 2345 6 7 8101315 Front Panel 1 LCD Display e Displays the current system status and warning messages e Displays hostname
14. 50 Folders Top 50 Files Please type in the full path of the ISO if not listed Add To mount new ISO file select from listed ISO file and input desired mounting name into Mount as field Click ADD with confirmation to complete mounting ISO file Or without Mount as ISO file export name input system will automatic to give the export name by ISO file name If left Mount as blink then system will create mount point by ISO file name 101 ISO Mount Are vou sure to mount the 2 1sO ISO Mount Adobe Acrobat 7 0 Pr i naswebsite Thecus 01 iso is mounted After you have completed to add ISO then the page will displayed all mounted ISO files 4 jnaswebsite Mounted Path ISO Path ISO Size JBT Seed Andy Weekly Report LJ AMD Thecus 01 J Besttech GT ACS xxx J AMCC Thecus 02 iso J Adobe Acrobat 7 0 Pro ATOM Andy Private naswebsite Thecus 01 naswebsite Thecus 01 1so 102 8MB Ki lt Pagef of 1 gt pj as Displaying iso mount information 1 1 of 1 File Selected Mount as Description Only ISO 9660 file system can be mounted Top 30 Folders Add Top 50 Files Please type in the fu path of the ISO 1f not listed You could click Unmount to eliminate mounted ISO file B Using ISO The mounted ISO file will be located same share folder with name giving Please refer the screen shot below ISO file image has mounted as folder Image you could see The ISO f
15. All SSL Certificate Click to set back to default certification details Files Apply Click Apply to confirm the changes NOTE e Disable HTTP support and Enable Secure HTTP support to guarantee secure access e The WebDisk has 2 different versions The version v1 x which is come with FW together may apply the setting here The version v2 x is needed to install through module interface and will not apply setting here e For the models N4200 series N0503 N7700 series and N8800 series could choose either version to use e All other models can only use version v2 x Rsync Target Server By Backup B snc 3 Nsync Target Serwer DOM Backup B Rsync Target Server i gt Rsync ACL Backup Restore When it comes to backing up your data it s very important to have flexibility Rsync Backup provides you with many options including local or remote backup backup scheduling different syncronization settings and password protection Being based on the Linux operating system it is also much more stable and experiences much less frequent data loss during transfer than other remote backup systems For this tutorial you will need to use Rsync Target Server Step 1 and Rsync Step 2 3 under Backup for this client server backup feature It also can be named If function Remote Replication Step 1 Enabling Rsync on your target backup NAS Log in to your target backup NAS through the UI in your web browser Go to
16. Allocation List select SCSI Target then click Add The Create iSCSI Volume screen appears Space Allocation x Create iSCSI Volume RAID ID RAID Unused 5 95 46 38 GB Allocation 46 38 GB iSCSI Target Volume Enable a Disable Target Name Limit 09 gez ign Year 2010 buf ign Month 12 EM LUM TD l Sy Authentication None CHAP Username Limit 0 9 3 z AvE Password Lirnit 19 8 az S Z leangth between 12 185 Password Confirm Description The iSCSI block size can be set under system advance option default is 512 Bytes Please use 4K black size while more than ZTB capacity will be configured in Windows XP Please use 512 Bytes block size for application like vare etc Create iSCSI Volume Item Description O O lt Percentage and amount of unused space on current RAID volume Stackable NAS function to identify this export share Specific Logic unit ID number Enter a password Password Confirm Reenter the chosen password 2 Designate the percentage to be allocated from the Allocation drag bar 3 Enable the iSCSI Target Service by selecting Enable 4 Choose to enable CHAP authentication or choose None 5 Enter a Target Name This will be used by the Stackable NAS function to identify this export share 6 Choose the current year from the Year dropdown 7 Choose the current month from the Month dropdown 86 8 When iSCSI target volume has b
17. CER RO TR 157 USB and eSATA Storage Expansion nere nennen nun h ohh 157 Adding a Spare DISK iis eic ROGO DOG GOOGLE EO GO CRGO ROO OO GC ERR 157 Remote Administration o nnne nununnnnnnhnnhhuauuuu uuu u uua u uu uuu 157 Part T Setup a DynDNS ACCOUN o ous Tu ou DrkeE vro MEER Eq deere n 158 Part II Enable DDNS on the Router eeeeeeen nnn 158 Part III Setting up Virtual Servers HTTPS eere 158 Firewall Software Configuration c eere rennen hh nnno nhau uuu n 158 Replacing Damaged Hard Drives c e eene eene nnno nh nnn nnno 159 Hard prive Damage ssessetopteu t reterekk exexPictuint i prxxi ue eset ee EU EE UE 159 Replacing a Hard DElVecsssuiess biet rU lo MUI edv M DELE 159 RAID Auto Rebulld a cru Eh uua ue ke ka ru ea auk Rad X res SERE FERE ERa Ea ed gas 159 Chapter 7 Troubleshooting ossia e RERO RO RC RR CREARI CR RC 160 Forgot My Network IP Address c n eene enhn hh nnn nnn nnn hau uu uuu 160 Can t Map a Network Drive in Windows XP 160 Restoring Factory Defaults sssss2s22 s 160 Problems with Time and Date Settings eere 161 Dual DOM Supports for Dual Protection 1 eee 161 Chapter 8 Updated for FW v5 02 01 erre 16
18. Disk item and the Web Disk HTTP Support screen appears This screen displays the service support parameters of the system You can change any of these items and press Apply to confirm your settings 122 WebDisk HTTP Support Sharing Enable D Disable Port 80 Secure WebDisk Secure HTTP Support Sharing 9 Enable Disable Port 443 CertificateFile B CertificateKeyFile CACertificateF ile E Apply Restore all SSL certificate File Description 1 Please insert SSL Certificate file while Secure WebDisk enabled or default will be used while file error occurred 2 The SSL Certificate file needs to reload while master RAID has changed A description of each item follows Web Service Item Descipton o HTTP WebDisk Support Enable or disable WebDisk support Enter the port number if this option is enabled The port number is default 80 HTTPs Secure WebDisk Enable or disable secure WebDisk support Enter the port if this Support option is enabled e Disable HTTP support and Enable Secure HTTP support to guarantee secure access UPnP This device supports UPnP Media server which allows users to play media files with UPnP client ex DMA devices Enable or disable Universal Plug and Play protocol UPnP helps to find the IP address of Thecus IP storage UPnP Enable e Disable Description
19. E Master RAID Take effect after checked box Encryption 3 password CAlow1 16 characters Confirm Password Quick Raid rj Enable this setting to enhance RAID creation time f there is no partition existed inside of hard disk Stripe Sire KB e Data Percentage lE g File System EXT Cenate 9 Press Create to build the RAID storage volume 77 tH System Informaten RAID information System Manage ment Pg System Network Idas ID RAJD Status Disks Total m mm acim RAJD Level Status quie Tota Date ss amp RAID 0 Formatting 1 2 3722 2 NJA n Elnata iscsi Burmsed RAID Status Formatting RAID RAID Configuration x 6 Allcurrent active services will be stopped when RAID is being created Are you sure to create RAID now L J RAID Cenfiguration x 1 E AID Setting Successfully A All current active services will be stopped when RAID is beme created Building a RAID volume may take time depending on the size of hard drives and RAID mode In general while the RAID volume building process is up to RAID Building then the data volume is capable to be accessed WARNING Creating RAID destroys all data in the current RAID volume The data is unrecoverable With a RAID 1 RAID 5 or RAID 6 volume you can also add a spare disk after the RAID is created See Chapter 6 Tips and Tricks gt Adding a Spare Disk for details For more information on
20. HDD a Remove the included 2 5 HDD tray b Slide the 2 5 HDD into the 2 5 HDD cage c Slide the 2 5 HDD cage back in until it snap into place 6 Replace the N0503 front cover Pss NN a a LI LATA LAM Dm ANS 23 Rear Panel N2200XXX The N2200XXX rear panel features ports and connectors Back Panel Item Description eSATA Port e eSATA port for high speed external storage expansion 1 e USB 2 0 port for compatible USB devices such as digital cameras USB disks and USB printers e WAN LAN1 port for connecting to an Ethernet network through a Port switch or a router e LAN2 port for connecting to a local Ethernet network through a switch or a router 5 System Fan e System fan that exhausts heat from the unit 6 Power e Connect the included power cords to this connector Connector 7 Reset Button e Resets the N2200XXX e Pressing and holding the Reset button on the back for 5 seconds will reset your network setting and password and turn off Jumbo Frame Support 24 N3200XXX NO503 The N3200XXX N0503 rear panel features ports and connectors Fspansion Siol REE Back Panel Item Description eSATA Port e eSATA port for high speed storage expansion 1 2 USB Port e USB 2 0 port for compatible USB devices such as digital cameras USB disks and USB printers 3 WAN LAN1 e WAN LAN1 port for connecting to an Ethernet network through a Port switch or router 5 4 LAN2
21. License may add an explicit geographical distribution limitation excluding those countries so that distribution is permitted only in or among countries not thus excluded In such case this License incorporates the limitation as if written in the body of this License 189 9 The Free Software Foundation may publish revised and or new versions of the 10 11 12 General Public License from time to time Such new versions will be similar in spirit to the present version but may differ in detail to address new problems or concerns Each version is given a distinguishing version number If the Program specifies a version number of this License which applies to it and any later version you have the option of following the terms and conditions either of that version or of any later version published by the Free Software Foundation If the Program does not specify a version number of this License you may choose any version ever published by the Free Software Foundation If you wish to incorporate parts of the Program into other free programs whose distribution conditions are different write to the author to ask for permission For software which is copyrighted by the Free Software Foundation write to the Free Software Foundation we sometimes make exceptions for this Our decision will be guided by the two goals of preserving the free status of all derivatives of our free software and of promoting the sharing and reuse of software gen
22. N2200XXX N8800PRO N5200XXX N8800 N8800SAS 1U4200XXX N8200XXX Allow 2 5 10 10 15 25 ISCSI volume To do this under the Storage menu click RAID and the RAID List window appears Select the RAID volume you wish to reallocate by clicking on its radio button and click Space Allocation The RAID Information and Volume Allocation List windows will appear The Volume Allocation List displays the space allocated for iSCSI volumes on the current RAID volume 84 Space Allocation RAID Information Master RAL Stab Disks Total Data SCM ID atus Efan RAID Level Used Capacity Capacity Capacity F LAID 3 Healthy 12 5 021 1 0 3 GB 832 7 GB N A Volume Allocation List iSCSI Target aC SI Thin Provision larget Advance Option Qaa iios Bees O Type Name Capacity Volume Allocation List Item Description 1 Modify Click this to modify the allocated space Click this to delete the allocated space Allocating Space for ISCSI Volume Space Allocation RAID Information Master RAID Status Disks Total Data iSCSI RAID Level i Used Capacity Capacity Capacity RAID 5 Healthy 1 2 3 27 7 0 6 GB 852 7 GB 46 4 GB Volume Allocation List iSCSI Target iSCSI Thin Provision Target Advance Option Add 3 Modify lt 3 Expand Delete Type Name Capacity iSCSI iscsi10 46 4 GB 85 To allocate space for an iSCSI volume on the current RAID volume follow the steps below 1 Under the Volume
23. Network IP Address If you forget your network IP address and have no physical access to the system you can find out the IP address by either looking directly onto Thecus IP storage LCD panel or by using the setup wizard to retrieve the IP of your Thecus IP storage 1 Start the Setup Wizard and it will automatically detect all Thecus IP storage products on your network 2 You should be able to find the IP address of Thecus IP storage which you have forgotten in the Device Discovery screen Can t Map a Network Drive in Windows XP You may have problems mapping a network drive under the following conditions 1 The network folder is currently mapped using a different user name and password To connect using a different user name and password first disconnect any existing mappings to this network share 2 The mapped network drive could not be created because the following error has occurred Multiple connections to a server or shared resource by the same user using more than one user name are not allowed Disconnect all previous connections to the server or shared resource and try again To check out existing network connections type net use under the DOS prompt You may refer the URL below for more network mapping information http esupport thecus com support index php _m downloads amp _a viewdownload amp downloaditemid 57 amp nav 0 Restoring Factory Defaults From the System menu choose the Factory Default item and the R
24. OS Support Unix Linux System AIX Allow source port gt 1024 ID Mappine Guest system root account will have full access to this share root root Guest system root account will be mapped to anonymous user nobody nogroup on NAS All User on guest system will be mapped to anonymous user nobody nogroup on NAS NFS Share Item Bescipio O Enter the name or IP address of the host Host has either read only or writeable access to the folder 106 Guest System Support There are two selections available e Unix Linux System e AIX Allow source port gt 1024 Choose the one which best fits your needs IO Mapping There are three selections available Guest system root account will have full access to this share root root Guest system root account will be mapped to anonymous user nobody nogroup on NAS All user on guest system will be mapped to anonymous user nobody nogroup on NAS Choose the one which best fits your needs Apply Click to save your changes Snapshot The Thecus IP storage is capable for 16 snapshot version control To have snapshot to work on the file system creation for RAID volume has to be ZFS Folder D Add Edt Remove LgyNFs Lg sn Folder name gt gt RAID ID File System Pubitc Description _J nsync RAIDJ ext3 no nsync usbhdd RAIDI ext3 no usbhdd usbcopy RAIDI exa no usbcopy 1 naswebsite RAID ext3 yes naswebsite iTunes mus
25. Port e LAN2 port that can be used for connection sharing System Fan e System fan that exhausts heat from the unit 6 Power e Connect the included power cords to these connectors Connector 7 Reset Button e Resets the N3200XXX N0503 e Immediately press and hold the Reset button on the back for 5 seconds This will reset your network setting password and turn off Jumbo Frame Support 25 N4100PRO The rear panel of the N4100PRO houses the USB and Ethernet connections as well as the power connector See the table below for descriptions of each USB Port WAN Port LAN Port Power Connector Item Description e Connect the included power cord to this connector WAN Port e WAN port for connecting to an Ethernet network through a switch or router LAN Port e LAN port for connecting to an Ethernet network through a switch or router USB Ports T e USB 2 0 ports for storage expansion 26 N4200 series The N4200 rear panel features ports and connectors EEEE EEE E E A EE cc cc eo 4 gt en a X e e A e 9e 9 e Back Panel Item Description e For connect the power adaptor WAN LAN1 Port e WAN LAN1 port for connecting to an Ethernet network through a switch or router LAN2 Port e AN 2 port for connecting to an Ethernet network through a switch or router USB Ports T e USB 2 0 ports for storage expansion eSATA Ports e eSATA port f
26. RAID 1 HDDx2 to RAID 6 HDDx4 RAID 1 HDDx2 to RAID 6 HDDx5 RAID 1 HDDx2 to RAID 6 HDDx6 RAID 1 HDDx2 to RAID 6 HDDx7 RAID 1 HDDx2 to RAID 6 HDDx8 HDDx16 RAID 1 HDDx3 to RAID 6 HDDx4 RAID 1 HDDx3 to RAID 6 HDDx5 RAID 1 HDDx3 to RAID 6 HDDx6 RAID 1 HDDx3 to RAID 6 HDDx7 RAID 1 HDDx3 to RAID 6 HDDx8 HDDx16 RAID 1 HDDx4 to RAID 6 HDDx5 RAID 1 HDDx4 to RAID 6 HDDx6 RAID 1 HDDx4 to RAID 6 HDDx7 RAID 1 HDDx4 to RAID 6 HDDx8 HDDx16 RAID 1 HDDx5 to RAID 6 HDDx6 RAID 1 HDDx5 to RAID 6 HDDx7 RAID 1 HDDx5 to RAID 6 HDDx8 HDDx16 RAID 1 HDDx6 to RAID 6 HDDx7 RAID 1 HDDx6 to RAID 6 HDDx8 HDDx16 RAID 1 HDDx7 to RAID 6 HDDx8 HDDx16 RAID X X ONLINE 6 RAID 6 HDDx4 to RAID 6 HDDx5 RAID 6 HDDx4 to RAID 6 HDDx6 RAID 6 HDDx4 to RAID 6 HDDx7 RAID 6 HDDx4 to RAID 6 HDDx8 DNE HDDx16 RAID 6 HDDx5 to RAID 6 HDDx6 RAID 6 HDDx5 to RAID 6 HDDx7 RAID 6 HDDx5 to RAID 6 HDDx8 r HDDx16 RAID 6 HDDx6 to RAID 6 HDDx7 RAID 6 HDDx6 to RAID 6 HDDx8 m HDDx16 RAID 6 HDDx7 to RAID 6 HDDx8 mE HDDx16 Space Allocation ISCSI Target You may specify the space allocated for iSCSI or target USB volumes target USB is available in model N5500 and 1U4600 The iSCSI volume can be created from 2 to 25 volumes per system depend on Thecus IP storage s model Model N4100PRO N0503 N4200 N5500 N7700PRO N3200XXX series 1U4600 N7700 N7700SAS
27. Rsync Target Server under Backup in the menu of the UI 173 Rsync Target Settings Rsync Target Server Enable Disable Username andy 1 Enable Rsync Target Server 2 Add a username and password they can be different than your NAS s username and password 3 Select Apply NOTE e You will need this user name and password while the data is going to remotely backup to this rsync target server Now Rsync is turned on your NAS which means it can be used as a target for Rsync backup in other words only the backup NAS needs to be activated in this way Rsync Step 2 Setting up your backup task and schedule on your source NAS Log in to your other NAS your source NAS through the UI in your web browser Go to Rsync under Backup in the menu of the UI From the Rsync Schedule Backup task list choose Add Rsync Schedule Backup Add ca2Edit Del E Task name Source Folder Schedule Target Server Path Last Time Last Status Action 174 Rsync Schedule Backup x Rsync Schedule Backup Task name Reyne task 1 Task Description Backup Mode Synchronize Compare source and target then delete unexist files Incremental Copy file from source to target Source Folder fandy3 pm Select source folder 192 168 0 105 s 873 Target Server Port Destination path Subfolder pubic i a Usemame andy Password eese Log Folder naswebsite Schedule Enable D
28. System Informatlon sesccesuseuu dac ca CR RCRCCR ER CR RGCRCROR RCICR ACA RR REG CRCR CRACK COR ERR CRCRDR RR CRERGR 56 General Thformaetlobr sss rude dud a ex eub edu Er a eee esu d 56 System Service SESEUS cas oss a ERERE RUNDE DEERYNPRTAGdTYBURETE DEAN SEAGRSATERU RATE Saa 56 Rojo necp E D coun Nn 5 Onsme iRegdistel vus tuiturea iniret a Bur furl Un oa par aac re trc 58 Syslog MatidadgelTieibuseese demus cu a ORE OR Exp E VET CE RM US LEM Dre I eas 59 System Management nic essvisa sues scucsankpasvEepKas EHE EUR PPAR EEECEEEeDEU AES 60 Date and Time System Date and settings eese 60 Notificadon cohbtiguratloriesssssseero6 s od itti piiaa e eel S eue Pro PAR ee o dace 61 xirnpiursiR melecig eem 62 Scrnedule POWEr OM OFF aaucesasaumma iR CER ATAT SQUE RETINET DER ATA Sad 62 Administrator PassWord aceite Reece eka ee aaa 63 CORP To ERI inet Gon Meets bt tans a xent fau tert dere Mot UL EE 64 Factory Cel QUIN nies ME 65 REDOOE GC ShBiEdOoWlusssus ose 2 esr oA RYXERT VERCREE IE RER EUR ERRARE US SS TTE 65 Fie Syste CMe CK acat cis eee 65 Wake Up ODqAN WOC rca ehe ion EUR esc rM af URP Rb io ated 67 SINMP SUDDOPEU zen incus coude dus odo and tette ets Sheen conatu dus udo Sete ees EE 67 Ul bogiri Cobiiaurablofis ssioseveasdphas xatciv RP ERE PER PR EORR RE eS 68 System NetWOFI sissakvuREREREEEVENRERRKRERRFERRRESEPERRRERRCEFENRAKREFEREURERRREPERERRERER EIS 68 WAM CANE HEU 68 LAN 2 eE A IM a ELM ME E 70 DH
29. Thecus target device Up to 20 TB capacity From the main menu the stackable feature is located under Storage Please refer the figure below for reference 94 Stack Target List td D eura d L Tac Trost J Joi ie eras Lapactty sem L olal Statis LA2escriporiod A Add a Stack Target Volume From the figure above click Add to access the stackable target device configuration page Please refer to the figure below With the added stack target you could Enable or Disable now or later per usage needed Add iSCSI Target Add Stack Target X Enable iSCSI Target Stackable TargetiP 172 16 65 157 dgn 19n 2009 05 com thecus XFS 1scs10 vg 1sesi Username Password Export share name Limit 0 9 a z Description Browseable Gi ves Fino Publie C yes ig ind Apply Next input the target IP address of the stackable device and click the Discovery button The system will list available target volumes from the inputted IP address Once IP with volume have been set you may need to input a valid user name and password to validate your access rights If there is no user name and password needed to access target volume then leave it blank 95 Add iSCSI Target Add Stack Target X Enable iSCSI Target 7 Enable Disable Stackable Target IP 172 16 65 157 ign ign 2009 05 com thecus XFS 15scs10 vg 1sesi Export share name Limit 0 9 a z Descript
30. Use the Up A Down V Enter J and Escape ESC keys to select various configuration settings and menu options for Thecus IP storage configuration The following table illustrates the keys on the front control panel LCD Controls Icon Function Description A Up Button Select the previous configuration settings option v Down Button USB copy confirmation display Enter Enter the selected menu option sub menu or parameter setting ESC Escape Escape and return to the previous menu There are two modes of operation for the LCD Display Mode and Management Mode 45 Display Mode During normal operation the LCD will be in Display Mode Display Mode Item The Thecus IP storage will rotate these messages every one two seconds on the LCD display USB Copy The USB Copy function enables you to copy files stored on USB devices such as USB disks and digital cameras to the Thecus IP storage by press button To use USB copy follow the steps below 1 Plug your USB device into an available USB port on the Front end 2 In Display Mode press the Down Button V 3 The LCD will display USB Copy 4 Press Enter 1 and the Thecus IP storage will start copying USB disks connected to the front USB port 5 All of data will be copied into system folder named USB copy Management Mode During setup and configuration the LCD will be in Management Mode To enter into Management Mode press Enter J and an Ente
31. WAN LAN1 LAN 2 IP addresses RAID status and current time 2 Up Button A e Push to scroll up when using the LCD display 3 Down Button e Push to scroll down when using the LCD display 4 Enter Button 1 e Push to confirm information entered into the LCD display 5 Escape Button e Push to leave the current LCD menu ESC 6 Locator Button e Turns on the LED backlight 7 USB Port e USB 2 0 port for compatible USB devices such as digital cameras USB disks and USB printers 8 PWR LED e Solid Blue System is powered on 9 Busy LED e Blinking orange system startup or system maintenance data currently inaccessible 10 Error LED Solid Red System alert Redundant power or system fan failure 11 LAN LED e Solid green network link e Blinking green network activity 12 Power Button e Power the 1U4200XXX on off 13 Reset Button e Resets the 1U4200XXX 14 Mute Button e Mutes the system fan alarm Can also be managed through the UI 15 HDD Trays e Four 3 5 SATA HDD trays e Locks are provided for added security 18 1U4600 The Thecus 1U4600 front panel has the device s controls indicators and hard disk trays ay aa y ji 4 P id 11 i t m 4 4 1 yy Jom t aE Sa t Ae f i t zz I Po p c In zm zii i il zt zt Sil ELIT LUI Iz iz uz uz uum S S i g l S i T iii L Front Panel Item Description 1 WAN LAN1 LED e Solid green network l
32. Web Administration Interface by navigating to Storage Management gt RAID Configuration For more information on configuring RAID see Chapter 4 System Management gt RAID Configuration Don t know which RAID level to use Find out more about the different RAID levels from Appendix B RAID Basics Step 3 Create Local Users or Setup Authentication Once the RAID is ready you can begin to create local users for Thecus IP storage or choose to setup authentication protocols such as Active Directory AD For more on managing users go to Chapter 4 User and Group Authentication For more information on configuring Active Directory see Chapter 4 User and Group Authentication gt ADS NT Support For information about the benefits of Active Directory see Appendix C Active Directory Basics Step 4 Create Folders and Set Up ACLs Once users are introduced into your network you can begin to create various folders on the Thecus IP storage and control user access to each using Folder Access Control Lists More information on managing folders see Chapter 4 Storage Management Share Folder To find out about configuring Folder Access Control Lists see Chapter 4 Storage Management Share Folder Folder Access Control List ACL Step 5 Start Services Finally you can start to setup the different services of Thecus IP storage for the users on your network You can find out more about each of these services by clicking b
33. When it happened please setup UNIX Extension disable to get issue solved AFP Apple Network Setup From the Network Service menu choose the AFP item and the AFP Support screen appears This screen displays the configuration items for the Apple Filing Protocol You can change any of these items and press Apply to confirm your settings AFP Support AFP Server O Enable 9 Disable MAC CHARSET w ZONE Time Machine Enable Q Disable Apply A description of each item follows Apple Network Configuration tem Description O 1 AFP Server Enable or disable Apple File Service to use Thecus IP storage with MAC OS based systems MAC CHARSET Specifics the code page from drop down list Zone Specifies Zone for Applet Talk service If your AppleTalk network uses extended networks and is assigned with multiple zones assign a zone name to Thecus IP storage If you do not want to assign a network zone enter an asterisk to use the default setting Time Machine Enable checked box while you like to backup you MAC system to have Thecus IP storage as MAC time machine 120 NFS Setup From the Network Service menu choose the NFS item and the NFS Support screen appears The Thecus IP storage can act as an NFS server enabling users to download and upload files with the favorite NFS clients Press Apply to confirm your settings m NFS Support NFS Enable Disable A description of each
34. add Thecus IP storage IP address i e 192 168 1 100 to the Trusted list 158 Replacing Damaged Hard Drives If you are using RAID 1 RAID 5 or RAID 6 you can easily replace a damaged hard drive in the Thecus IP storage while keeping your data secure with the system s automatic data recovery Hard Drive Damage When a hard drive is damaged and data in the RAID volume the system LCD will display warning message also the system beeps Replacing a Hard Drive To replace a hard disk drive in Thecus IP storage 1 2 S Remove the tray with the damaged hard disk N3200XXX NO503 is using HDD rail Unscrew the damaged hard disk and remove it from the tray Slide a new hard disk into the tray and fasten the screws Insert the hard disk tray back into Thecus IP storage until it snaps into place You can also lock it with a key if desired The LED blinks green when the HDD is accessed RAID Auto Rebuild When using RAID 1 5 6 or 10 on Thecus IP storage you can use the auto rebuild function when an error is detected 1 When a hard disk fails the system beeps and or an email notification is sent to specified receivers Check the LCD to see which disk has failed Follow the steps mentioned above to replace the failed hard disk The system automatically recognizes the new hard disk and starts the auto rebuild sequence to resume its status before the hard disk crash 159 Chapter 7 Troubleshooting Forgot My
35. below displays 12 default favorite functions tr My favorite b Shutdown aa Logout il Status tj System Log e E Online Registration mecs oem A Fae General Notifications 4 Syslog Management l UXOR x System Management WO a d Scheduled On Off Disks ig System Network 1 Storage WU n ea User and Group Authentication a Network Service n E Application Server Space Allocation Share Folder User m Backup 4 External Device E US N42 5 5 E E fo F THECUS N4200PRO V5 00 00 15 52 Administrators can add or remove favorite functions to My Favorites by right clicking the mouse on the menu tree v Shutdown Logout go AMI favorite amp Remove My favorite aes 1 Scheduled On Off WAN f LANL c aub la Share Folder User The other way administrators can add favorite functions is by clicking the Add Favorite icon in each function screen Please refer figure below in red circuit icon Sf System Management gt S5 Date and Time b Notifications Ei 4 Firmware Upgrade vel LIS a mmm oma A To return to the favorite screen simply click Home located at the left hand corner of the main screen I d a 1 vw Tye 7 be I y Firmware Upgrade Date and Time Status B i ET x m B agl LATI p j MEF 1 2 2 al ww I Scheduled On ttt WAN f LANL FTP Disks 53 Menu Bar
36. default master and FW upgrading will only execute in DOM1 unlike DOM2 is Read only initially Any circumstance occurred while DOM2 successes recover DOM1 The FW will be version of DOM2 Therefore it may need to upgrade to the version of DOMI it has If DOM1 can not be recovery from DOM2 then system will boot up from DOM2 The original configuration in DOM1 may need to setup again with DOM 2 operation 161 Chapter 8 Updated for FW v5 02 01 Changes of FW v5 02 01 Module login through UI Login Interface UI Login function Modified share folder Edit setup item and add samba setting Add NFS 4 0 support Add NFS sync Async option Add mode option for Samba setting FTP has add option External IP for NAT port forwarding Add web service v1 x SSL certificate input Migrate rsync function to dedicate FW from module install required Add User Quota function Add User and Group backup Add ACL backup Restore Added network UPS supported Add module login through UI Login Interface From the login page other than admin web disk and Piczza Photo server the module has newly added from this FW release So after module has been installed there is new option can be chosen Show in Login Module File Module Management Ena Type Name Version Description Last Status Action Show in Login Yes System Usb eSATA Schedule Bai 2 00 02 USB eSATA ij E x If this optio
37. entire whole and thus to each and every part regardless of who wrote it Thus it is not the intent of this section to claim rights or contest your rights to work written entirely by you rather the intent is to exercise the right to control the distribution of derivative or collective works based on the Program In addition mere aggregation of another work not based on the Program with the Program or with a work based on the Program on a volume of a storage or distribution medium does not bring the other work under the scope of this License You may copy and distribute the Program or a work based on it under Section 2 in object code or executable form under the terms of Sections 1 and 2 above provided that you also do one of the following a Accompany it with the complete corresponding machine readable source code which must be distributed under the terms of Sections 1 and 2 aboveon a medium customarily used for software interchange or b Accompany it with a written offer valid for at least three years to give any third party for a charge no more than your cost of physically performing source distribution a complete machine readable copy of the corresponding source code to be distributed under the terms of Sections 1 and 2 above on a medium customarily used for software interchange or C Accompany it with the information you received as to the offer to distribute corresponding source code This alternative is allowed only
38. have sze limit on 4096 GB If the user quota is large then 4096 that EXT3 4 and Stackable system wil lock on 4096 Please do execute Sync if user quota has been disable then enable again to make sure the accuracy of quota used for each user Or the user used capacity will not count during user quota function is disabled To setup user quota simply click on desired user with associated Quota filed then input numbers Left default value O with no quota limitation for associated users Please be sure the Apply button has confirmed for changes Synchroreze Local Users sip Search Name Quota GB Volume Fie Sys Quota GH Quata GB andy 1000 RAID XFS 0 0 david 300 RAIDpm EXT4 0 0 jack 100 pmi 3044 pmi 0 pm 0 pm pm 0 test Apply 167 Click on user and right hand pane will list associate system RAID volume with setup quota and used size Synchronize Local Users Search Name Quota GB Volume File Sys Quota GB Quota GB andy 1000 RAID XFS 1000 27 20 david 900 RAIDpm EXT4 1000 1 4 jack 100 pmi g prn2 g pm3 0 pm 0 pma 0 test 0 User and Group Backup The user and group backup feature is allowed system users and groups been backup to other location and restore it while needed Please be noticed when restore previous backup users and groups the current users and groups list will be replaced from this restore file s contents User and group settings download upl
39. ne H k Q iu i Oy so oo ee nw amp Co Result RAID 1 2 3 4 5 System Exit Code 0 No z Exit Code 0 No errors The system must be rebooted before Thecus IP storage can function normally after file system check complete Wake Up On LAN WOL The Thecus IP storage has the ability to be awoken from sleep mode via WAN LAN1 port Wake On LAN WOL Service Enable Disable Apply From the menu choose the WOL item and the Wake up On LAN screen appears From here you can Enable or Disable Wake up On LAN Configuration WOL Service Enable or Disable WOL service Apply Click Apply to save changes SNMP Support From the menu choose the SNMP item and the SNMP Support screen appears You could enable the SNMP function and filled in the related information in each fields With the SNMP management software could get system basic information 67 SXMIP Support SNMP Service Enable Disable Read Community Allow 0 9 a z A Z System Contact Svstem Location Trap Target IP Appy From the menu choose the SNMP item and the SNMP Support screen appears From here you can Enable or Disable Ul Login Configuration Adjusts UI Login Configuration settings you can enable disable the Web Disk and Photo Server functions according to your needs For the 3X series users need to install the photo server module or web disk module to access these functions
40. normal access Also the taken snapshot version is read only can not be deleted under CIFS SMB access but only click the Del button showing on the screen shot above Folder and sub folders Access Control List ACL On the Folder screen press the ACL button and the ACL setting screen appears This screen allows you to configure access to the specific folder and sub folders for users and groups Select a user or a group from the left hand column and then choose Deny Read Only or Writable to configure their access level Press the Apply button to confirm your settings ACL setting x 9 This process maybe need sometimes to sync T Are you want sync account No 108 ACL setting x Recurzive Deny Read Only Writable Local Groups w jb Search a 2 Name Nam Name Nam users ACL setting Deny Denies access to users or groups who are displayed in this column Read Only Provides Read Only access to users or groups who are displayed in this column Writable Provides Write access to users or groups who are displayed in this column Enable to inherit the access right for all its sub folders To configure folder access follow the steps below 1 On the ACL screen all network groups and users are listed in the left hand column Select a group or user from this list With the group or user selected press one of the buttons from the three access level columns at the top The group or user then appears i
41. ports will be aggregated and act as one port There are 6 modes can be choose from Load Balance Fail over Balance XOR 802 3ad Balance TLB Balance ALB Set IP Address by You can choose a static IP or Dynamic IP and input your network Link Aggregation Only use Jumbo Frame settings when operating in a Gigabit environment where all other clients have Jumbo Frame Setting enabled e Enabling DHCP automatically turns on UPnP see the Service Support Screen e If you are only using the WAN LAN1 port we suggest that you disable IP Sharing Mode This will result in higher throughput e A correct DNS setting is vital to networks services such as SMTP and NTP e To use the Link Aggregation with 802 3ad selected feature please make sure the networking equipment on the other end of Ethernet cable also supports 802 3ad protocol 69 Most Fast Ethernet 10 100 Switches Routers do not support Jumbo Frame and you will not WARNING be able to connect to your Thecus IP Storage after Jumbo Frame is turned on If this happens turn off the Thecus IP Storage Then insert USB disk with factory reset utility included and power on the Thecus IP Storage Till the system power on complete then it will bring your system settings back to factory default LAN2 LAN2 Configuration The Thecus IP storage supports two Gigabit Ethernet ports for higher service availability To configure th
42. select IP Config gt Miscellaneous DDNS Setting from your Home PC Click on Yes for Enable the DDNS Client Select www dyndns org Go to router setup screen and enter the following information User Name or E mail Address xxx example com Password or DDNS Key xxxx Host Name www N8800 dyndns org Enable wildcard Select Yes Update Manually Click Update i Eh o coco Part Ill Setting up Virtual Servers HTTPS 1 Navigate to NAT Setting gt Virtual Server 2 For Enable Virtual Server select Yes 3 Setup the HTTPS Server a Well Known Applications Select User Defined b Local IP Enter 192 168 1 100 c Port Range 443 the default HTTPS port setting on the Thecus IP storage d Protocol select TCP e Click Aad f Click Apply 4 Test the HTTPS connection from another computer on the Internet a From a remote computer open your browser and enter https www N8800 dyndns org b You should see the login page of Thecus IP storage Firewall Software Configuration If you are using a software firewall i e Norton Internet Security and are having trouble connecting to Thecus IP storage you can try the following steps 1 Double click the NIS icon on system tray and then configure the Personal Firewall 2 On the Programs page find the SetupWizard exe and change its permission to Permit All If it s not in the program list use the Add or Program Scan buttons to find it 3 On the Networking page manually
43. set the RAID storage space as JBOD RAID O RAID 1 RAID 5 RAID 6 or RAID 10 see Appendix B RAID Basics for a detailed description of each 3 Specify a RAID ID 4 If this RAID volume is meant to be the Master RAID volume tick the Master RAID checkbox In a multiple RAID configuration one RAID volume must be designated as the Master RAID volume The Master RAID volume will store all installed modules If the Master RAID is changed to another location i e assigning volume 2 to be the Master RAID volume after volume 1 had been previously assigned then all modules must be reinstalled In addition all system folders that were contained on the Master RAID volume will be invisible Reassigning this volume to be the Master RAID will make these folders visible again 5 Selected whether the RAID volume will be encrypted or not The RAID volume can protect data by using RAID Volume Encryption function to prevent the risk of data exposure To activate this function the Encryption option needs to be enabled while the RAID is created and followed by password input for identification Also an external writable USB disk plugged into any USB port on the system is required to save the password you have entered while the RAID volume is being created See the screenshot below for details 75 RAID Information r Create RAID Disk Na Capacity MB Model Status Used Spare 1 907 729 WC WOD2002 OK E E 5 2 1 007 728 WD
44. storage in direct sunlight or expose it to other heat sources DO NOT use chemicals or aerosols to clean Thecus IP storage Unplug the power cord and all connected cables before cleaning DO NOT place any objects on the Thecus IP storage or obstruct its ventilation slots to avoid overheating the unit Keep packaging out of the reach of children If disposing of the device please follow your local regulations for the safe disposal of electronic products to protect the environment Table of Contents Copyright and Trademark Notice cccesssccnnessecneesecnnseeneussenuesonas 2 About Inis Manualaassmnsisiie us aa COR ROGER RU CIC ACQUA GR AR CC RC RR CR 2 Limited WarFallby isicersk ecl xix MODO SX RC ON RR M An RE A ROCCO CR RD RC CR ER RR RD 2 Safety WarhIldS caras esvseonazS waa REFYFVEAERVREERERENEREPKEREEFIENARERFERRARREREEFKE 3 Tabl e of COnDEenLtS ice acce OR WAR CRDI ROE raaa ROCCO RR RO ERR 4 Chapter 1 Introduction oai ERR RSRCL ERREUR RE EEEERREERWRCKERERAS xS 8 Over vie W Soie vidas DEauECEs basins eed Eva NN MEM MEUM EE PU QUEE CNN DUNS EE MENU EE 8 Product Highlights iux enixa nx Rr aaa 8 Package Contents ver oan a ane CO CQ ROGER ln 10 Front Panels eu kR a NERRRAWANERRNAER KLEINERE RR M YRYSI RE KEEPER VR E KE i 11 Hard DISK TRAYS Gitisibesa eda asaEuSAQuSq SERE a DUM MH MEE 21 Rear Paleliss innoxia Race ROC GO RUE RC CR a Rn Cc RR RR PCR RR RR 24 Chapter 2 Hardware Installation eee erre ee
45. such as the photo server User Quota Quota Support User Quota T Enzbls ie Disable Quota setting Local Doers e Local Uzers Name Quota Site MB RAID 4 m al A Description Flesse click the fald of Crutoa Size to chanaga the U ger Quota The marimen racord af user list i 100 You can search seme tor abhor wears in the Het 118 Network Service Setup and manage protocols such as Samba CIFS FTP and HTTP Web Disk and other network services E Netwotk Service c Sat ba CIES Sh AFP Waxrs X rir a r TD aa 1 k ZH HTIP Web Disk EP Pnp Samba CIFS There are 5 options is currently allow Admin to Enable Disable to operate Thecus IP storage associated with Samba CIFS protocol With the option changed it will need to reboot system to activate r Samba CIFS Samba Service 9 Enable Disable File Access Cache 9 Enable Disable Samba Recycle Bin Enable Disable Samba Anonymous Login Authentication 2 Enable Q Disable Samba is Native Mode 9 Yes Native Mode No Compatible Mod Optimize Block Size 9 Enable Disable Server Signing 7 Auto Mandatory Disable r SMB CIFS option for MAC Allocated Buffering Size 9 Enable Disable UNIX Extensions 9 Enable Disable Hide Temporary Files Enable Disable Apply Samba Service Used for letting the operating system of UNIX series and SMB CIFS of Microsoft Windows op
46. system will ask you if you want to set this printer as Default Printer Select Yes and all your print jobs will be submitted to this printer by default Click Next 9 Click Finish e Not all USB printers are supported Please check Thecus website for a list of supported printers e Note that if a multi function all in one printer is attached to the Thecus IP Storage usually only the printing and fax functions will work Other features such as scanning will probably not function 136 Windows Vista To set up the Printer Server in Windows Vista follow the steps below 1 Open Printer Folder from the Control Panel gO E gt Control Panel gt X Control Panel Home User Accounts and Family Safety e Set up parental controls for any user Add or remove user accounts System and Maintenance Get started with Windows Back up your computer Classic View Security Check for updates Check this computer s security status e Allow a program through Windows Firewall Appearance and Personalization Change desktop background Change the color scheme Adjust screen resolution e Network and Internet View network status and tasks Set up file sharing i Hardware and Sound 7 Play CDs or other media automatically Mouse Additional Options Pr Recent Tasks ki dendi R Uninstall a program Printer Change startup programs Clock Language and Region Change keyboar
47. take away your freedom to share and change it By contrast the GNU General Public License is intended to guarantee your freedom to share and change free software to make sure the software is free for all its users This General Public License applies to most of the Free Software Foundation s software and to any other program whose authors commit to using it Some other Free Software Foundation software is covered by the GNU Library General Public License instead You can apply it to your programs too When we speak of free software we are referring to freedom not price Our General Public Licenses are designed to make sure that you have the freedom to distribute copies of free software and charge for this service if you wish that you receive source code or can get it if you want it that you can change the software or use pieces of it in new free programs and that you know you can do these things To protect your rights we need to make restrictions that forbid anyone to deny you these rights or to ask you to surrender the rights These restrictions translate to certain responsibilities for you if you distribute copies of the software or if you modify it For example if you distribute copies of such a program whether gratis or for a fee you must give the recipients all the rights that you have You must make sure that they too receive or can get the source code And you must show them these terms so they know their rights We prot
48. the device s controls indicators and hard disk trays IET Am rm w ui P Qo N OU bg HAR IER HTE Front Panel Description 1 Power Button e Power on off N4200series 2 OLED e Displays current system status and messages e OLED screen saver will be enabled after screen is left idle for more than 3 mins e OLED screen will be diabled after it is left idle for more than 6 mins OLED 3 HDD 1 LED 4 HDD 2 LED 5 HDD 3 LED 6 HDD 4 LED 7 WAN LAN1 LED 8 LAN2 LED 9 USB Copy 10 HDD Tray e Four HDD trays support 4x 3 5 or 4 x 2 5 HDDs 11 USB Copy e Copies USB storage contents to the N4200 series Button 12 USB Port e USB 2 0 port for compatible USB devices such as USB disks 15 N5200XXX N5500 The Thecus N5500 front panel has the device s controls indicators and hard disk trays d i Front Panel Item BDescipion 2 1 System LED e Blinking orange System is being upgraded or is starting up data currently inaccessible e Solid green Network link e Blinking green Network activity e Solid green Network link e Blinking green Network activity LED e Solid blue System is power on 11 Enter Button l e Push to enter LCD administrator password to access basic system setting 12 Escape Button ESC e Push to leave the current LCD menu 13 LCD Display e Displays current system status and warning messages 14 HDD Trays e Five 3
49. the folder L Browseable Enable or disable users from browsing the folder contents If Yes is selected then the share folder will be browseable Apply Press Apply to activate settings User Quota The User Quota provides a way of limiting users available storage capacity Setting a user quota gives a given user a given amount of space on EACH RAID partition For example if there are 3 RAID partitions and a user has a user quota of 300MB the user can store 300MB of data on EACH RAID partition or a total of 900MB of data 166 The framework keeps track of the total amount of data a user has used across different folders and functions such as the photo server Please do enable the user quota function first Then you could choose Sync to calculate for all of users to each associated RAID volume with used space Home gt User and Group Authentication gt User Quota G Heb C My favorte D Shutdown A Logout User Quota a Enable C Disable Synchronize Local Users E volume Fle System synchronized Time Estimation min p RAD XFS Fnished Depend an number af f tl RA IDa Ex T4 Naver Sync Dapend on number off a To enable usar quota function we are strongly recommended to use ether ext4 or XFS fila system If ext3 file aatem amp invaleed the user quote initialzation wil take quite a long time depend on its volume sire e Please cick the field of Quota Ste to chanage the User Quota EXT3 4 and Stackable
50. to the factory default values WARNING Reboot amp Shutdown From the menu choose Reboot amp Shutdown item and the Shutdown Reboot System screen appears Press Reboot to restart the system or Shutdown to turn the system off Shutdown Reboot System shutdown I Heboot File System check The File System Check allows you to perform a check on the integrity of your disks file system Under the menu click File system Check and the File System Check prompt appears File System Check The file svstem has been checked successfully Reboot the svstem make the changes effective ZFS file systems don t need file system checks Encrypted RAID does not support file system checks Press Apply to reboot the svstem now Apply To perform a file system check click Apply Once clicked the following prompt will appear File System Check X e The setting has been changed carry on with press Yes for confirmation Click Yes to reboot the system 65 ee LL ar t se 2m o m am a File System Check File System Check Reboot Reboot 5 Done e Once the system has rebooted you will be returned to the File System Check prompt There you will see the available RAID volumes to run the file system check on except ZFS volume ZFS has no need to perform file system check Check the desired RAID volumes and cli
51. virtual size The maximum virtual size is 16000GB 3 In this case if you make the iSCSI target volume 1700GB then the virtual size is available for the next iSCSI target volume under thin provisioning is 14300GB 16000 1700 4 The limit is 5 iSCSI target volumes under thin provisioning or a virtual size of 16000GB RAID ID RAI Unused 18 333 85 GB Virtual Sze 333 8 GB iSCSI Thin provision physical size starts with 333 8GB Unused 15 3353 59 GB Virtual Size 16000 GB SCSI Target Volome V Enable Q Disable The virtual capacity is limited to 16000GB 91 The screen shot for iSCSI target volume creation under thin provisioning the physical capacity 333 8GB Space Allocation x Create IS S Thin Pririzion FAID ID Unused Virtual Sime CEI Target olome Target Name Limit 0 3 a z ipn Yaar 2000 lw ign_ Month 08 iw Authentecation E Nons CHAP Username Limiti0 3 a z A Z Pauxrzarnc ListXc 3 a2 z A mdlanzth betean 12 18 Pasgosd Conium Description The 13C51 block stze can be set onder ryste advance option defili is 312 Bytes Plaasa ming 4K block size while more than 2TB capacity will ba configueed in Windows XD Please ming 512 Byte block size for application ka VhIware atc The screen shot to setup an iSCSI target volume under thin provisioning of 1700GB iSCSI Thin Privizion Volume T dExpand GP Dale ives ama Capacity ACA Thine Brecon Volcene ACSI Then Savion V
52. with a single power connector Power Connector Power Switch USB Ports A Type LAN2 Port JE S258 Lj i S E eee MENEE eee System Fan eSATA Port Serial Port USB Ports B Type WAN LAN1 Port 32 N8200XXX The N8200XXX rear panel features ports and connectors EI G33 38NM Back Panel Description 1 Power Connector e Connect the included power cords to these connectors 2 Power Switch e Powers the N8200XXX on off 3 eSATA Port e eSATA port for high speed storage expansion 4 USB Port e USB 2 0 port for compatible USB devices such as USB disks and USB printers 5 Serial Port e This port is for an external UPS device switch or router through a switch or router 8 Locator LED e Identifies each NAS within a rack mount configuration 33 N8800 series The N8800 rear panel features ports and connectors N8800PRO SP is Single power d J B gs t ate E p f i See m am I NHH Back Panel Item Description 4 USB Port e USB 2 0 port for compatible USB devices such as USB disks and USB printers 5 Serial Port e This port is for external UPS device switch or router switch or router 34 Chapter 2 Hardware Installation Overview Your Thecus IP storage is designed for easy installation To help you get started the following chapter will help you quickly get your Thecus IP storage up and running Please
53. 0 users from the chosen category To narrow your search enter a search term in the blank provided User and Group Authentication The Thecus IP storage has built in user database that allows administrators to manage user access using different group policies From the User and Group Authentication menu you can create modify and delete users and assign them to groups that you designate 110 ea User and Group Authentication IADS ey User A Group C Batch Input F Quota ADS NT Support If you have a Windows Active Directory Server ADS or Windows NT server to handle the domain security in your network you can simply enable the ADS NT support feature the Thecus IP storage will connect with the ADS NT server and get all the information of the domain users and groups automatically From the Accounts menu choose Authentication item and the ADS NT Support screen appears You can to change any of these items and press Apply to confirm your settings ADS NT Support Work Group Domain Name MYGROUP ADS NT Support C Enable Q Disable Authentication Method Q9 ADS A NT ADS NT Server Name ADS NT Realm Administrator ID Administrator Password A description of each item follows ADS NT Support Item Description O Work Group Domain Specifies the SMB CIFS Work Group ADS Domain Name e g Name MYGROUP Directory Server or Windows NT Windows NT ADS NT Server Name Specifies
54. 2 Add module login through UI Login Interface eere 162 Ul Login Config iraLtloliss ovcixaa a EE EE ERE tunan PR Ee IPEA ER Ed ERE RR ER EIE 163 Siiate FOC sis cc T 163 Br aSS cc TETTE 166 User and Group BACKUD used nion na anne xad edi dodo nd on Oros dn cata 168 Samba bb Seateacastinawaraer e ecutucancstanwmeeeteunleh stares LEO TRUE RIEN DNETD LE 168 gren E 171 WebService HTTP Web Disk eee nnn nnn 172 RSYNC Target ServVelzstodxnes ee dex inta ate aei Ebeu ru e inue eie PEE 173 ic iperrPMM n eaan Herm 174 ACL Backup and Restore cuis ist ecipes Er tee Lec ebore sea o ns PE DK EXC PLE DEI ER 176 Uninterrupted Power Source UPS Setting een 177 Link Aggregation mode CeSCTIPtiONn c cece eee eeeeeeeeeeeeeeeeeeaaeaaaas 178 Appendix A Customer Support eere nnne nne 180 Appendix B RAID Basics eee onn hn nnn hh nnn nnn 181 OVerVIQ W iucseisux uu uuu wn S uia ww RR RC A Ru i c D AR Er RR ACTU NR 181 Benefits ouo rer here EPEC CCRC EE a een s CORE CEEE CCRC nd VV pw Cae rw Ed 181 Improved Pertortmidlieeusitsiensseteidtudehdt a cdusia duca ipd eh ar Pac obo 181 Data S OCUFIDV oes sica uui hawinkesb Enid enim SUN tatwI D esEauid Mundus d Moe 181 RAID Levels inris ia GORGE RC E ODER aa 181 Appendix C Active Directory Basics e eere 184 OVerVIe W vsssssvue
55. Asia Taipe v NTP Service Enable Q Disable Sync with an Yes clock isc org v External NTP Servet 7 No Apply See the following table for a detailed description of each item Time Description NTP Server Sync with external NTP Server Sets the system date Sets the system time Sets the system time zone Select Enable to synchronize with the NTP server Select Disable to close the NTP server synchronization Select YES to allow Thecus IP storage to synchronize with an NTP server of your choice Press Apply to change WARNING If an NTP server is selected please make sure your Thecus IP storage has been setup to access the NTP server Notification configuration From the menu choose the Notification item and the Notification Configuration screen appears This screen lets you have Thecus IP storage notify you in case of any system malfunction Press Apply to confirm all settings See following table for a detailed description of each item r Notification Configuration Beep Notification Enable 3 Disable Email Notification Enable Q Disable SMTP Server DN Authorization Type v SMTP Account ID Account Password Log Level v Sender s E mail Address Recipient 1 s E mail Address 1 Recipient 1 s E mail Address 2 Recipient 1 s E mail Address 3 Recipient 1 s E mail Address Notification Configuration Item J Description Beep Notifi
56. C V D2002 OK 3 207 720 DC ViD2002 Warning C a 4 gar 29 DC YD2002 Ok C 3 1 907 728 WEC VD2002 OR C C n 1 907 725 WDC VyD2002 OK E r1 hu RAID Level JER XLI RAID f RAGED T RAILS RAID 5 RAIL 1C RAID ID Allow 1 16 characters Confirm Password Quick Raid Stripe Sge KB iud Data Percentage AL Fie Systeme 2 eases Once the Create button has been pressed with the Encryption checkbox enabled the following message pop up will appear for confirmation RAID Configuration x To encrypt RAID volume well cause performance down and vou need to beve writable USB desk insert to USB port te store encrypted password Strongty recommend to backup your encrypted password to somewhere alse safely or the password lose will cause date uisreachable After the RAID volume has been created you may remove this USB disk until the next time the system boots The RAID volume can not be mounted if the USB disk with key can not be found in any system USB port when the volume is accessed To activate the encrypted volume plug the USB disk containing the encryption key and into any system USB port We are strongly recommended copying the RAID volume encryption key to a safe place You can find the encryption key file from the USB disk in the following format RAID volume created date xxxxxx key WARNING Please keep USB disk in a safe place and also backup the encrypted key There is no way to rescue data back if th
57. CP Server Configuratiol sesessssseos soe sTRENL CERO RRNIRESEPEPSTERTPEPEEYRPER PRDUN 71 Storage ManagementL ioiisesasccucse sesSERREERESSRRSHRR REA RREEASRPSARR S EERRSOPRRC ME 71 DISES TRIOPETISUIOEI ccone Sa LR aste OR TET toU OES seanndia Ga p edam S Las riu IL 71 EAID IntOHnatlob osos tru i Saad Ver Ea Saw Teste tuvo I Eas dne ae ve i arias 74 Space AIOCdtlobuss dde E PEPLHdPIPEERYXPATVTADETU PERSE Dada PETS PET maser nee aies 84 ISCSI ThilisPEFOVISIOPIEIG aches tbe RR ES UA NECI NEA EE EI CIV MEN dE EU 89 KOVINCE ODIOM irreais ume So tu ese Sa UM DEUM HEP E C LUE 93 Stackable NAS us wassi EM PO Ex il eek vrl on ees Meu eu E IUIS SE catia ein Cd ETE 94 OSMON 222601523235 PEPERPITATREAPITEN SE SIM PESSRUADPIDINDEPENORUNPRIEC RIED E TPR MEDI 100 Shabe FOIE aceitusistess vede DNE coepi atia aida to e dU DD aaa 103 Folder and sub folders Access Control List ACL eeeernnnnnn n n 108 User and Group Authentication ee eeeeeee ene h hh nnn hah h hun u hana uu uuu 110 ADSINT SIDDOLL25 3 22 0 8 5 15 99 ITI Sap d TRUEIE ri 111 Local User onflgiatlof s osox s ceca ede nd isa cep a oco a DER 113 Local GEoup Gonrgu letiolisssess uds situe A pu rc cen ados 115 Batch Create Users and GFOUDS 253 Sie vx ate RR EIER ERR EE ER UR 117 JUOELO aeri MP SAHEN ETE SHMERADE sees IPE TAE 118 NetWworK Service ssasconessazEdsbraaM aE MARNE PKRREREE ER ERA REPE REA 119 Sarid GIESuussievi duet ru Ua E Ca adde Sud dotes e a EM I
58. D ROM 0 DVD L gt Bi Unallocated Bl Primary partition ll Extended partition Bl Logical drive 14 Initialize the new hard disk and you will then be able to use the iSCSI target as a local drive 156 Windows Vista Because Windows Vista has the Microsoft iSCSI Initiator pre installed you will not have to install this piece of software Instead start the iSCSI Initiator and follow steps 8 14 to map the Thecus IP storage as an iSCSI drive Chapter 6 Tips and Tricks USB and eSATA Storage Expansion The Thecus IP storage supports external USB hard disks through its USB ports Once a USB hard disk has successfully mounted the entire volume will be linked automatically to the default USB HDD folder The Thecus IP storage supports USB external storage devices All file names on the USB disk volume are case sensitive The Thecus IP storage also supports eSATA hard disks with its eSATA port Before attaching an eSATA or USB disk drive to Thecus IP storage you have to partition and format it on a desktop computer or a notebook first The attached device will be located at 192 168 1 100 usbhdd sd x 1 where 192 168 1 100 means the IP address of Thecus IP storage and sd x 1 stands for the first partition on the eSATA or USB disk drive Adding a Spare Disk With a RAID 1 RAID 5 RAID 6 or RAID 10 volume you can add a spare disk after the initial RAID is setup To add a spare disk follow the steps below 1 Onthe RAID Con
59. D axt LJ odule det RAID x 2 lt Ii gt add folder x RAID ID PAT Folder name Description Browseable i Yes No Public E Yes e No Share Folder Limit GE Apply Add Folder is selected then the share folder will be browseable Public Admit or deny public access to this folder If Yes is selected then users do not need to have access permission to write to this folder When accessing a public folder via FTP the behavior is similar to anonymous FTP Anonymous users can upload download a file to the folder but they cannot delete a file from the folder Share Folder Limit Enter the maximum size of the folder in Gigabytes GB The folder cannot grow beyond this limit You can enter a 0 to turn off the share folder limit This option did not apply while XFS file system selected Apply Press Apply to create the folder Folder names are limited to 60 characters Systems running Windows 98 or earlier may not support file names longer than 15 characters 104 Modify Folders On the Folder screen press the Edit button and the Modify Folder screen appears This screen allows you to change folder information After entering the information press Apply to save your changes Modify Folder x RAID ID Folder name nsync Deseriptien tisync Browseable 7 Yes No Public E Yes No Share Folder Limit 0 GB Modify Folder Item J Description En
60. IP Capacity Uged Total status Description ign C iei 172 1665157 0GB 01 GB Disable ign 2009 05 cor Add Ed Rem Fort Export share name iz Capacity Used Total Status Description ign 13C51 172 16 65 157 NIA Unknown file iqn 2008 05 co Success x i You have successfully formatted stack folder iscsi With this newly attached stack target device you will see the information displayed and also several options you can choose In general if attached stack target device has been used by another Thecus IP storage as stack target volume then the Format item will be display and system will recognize it straight away and display its capacity Otherwise the Format item will be available and the Capacity and Status items will show as N A and Unknown file system respectively 98 Next click Format to proceed with formatting After the format is complete the stack target volume will be created successfully You will see the volume s capacity and status in the Stack Target List screen C Edit a Stack Target To make any changes to stack targets click Edit for the corresponding stack target and system will bring up the following dialogue Edit iSCSI Target X Enable iSCSI Target Enable 7 Disable Stackable Target IP ign Lisername Password Bonnet Dam ccc Limit 0 9 a z Description Browseable 9 yes 7 no Public yes no Apply After your changes have been made click Ap
61. LL SE 119 AFP Apple Network Setup 2250 ccc s eto RM HA OH ERE One So D COCHE VT RRERAMS 120 NFS GLUD tte ere 121 Pp bai PM MU MM 121 TED P sss E EPE Seas reset egestas MIEL cM Pt ELM E een 122 ATTP WED DISK d ten tases ant necu Md br dta neon I Era a cea ee de teenie ees 122 MID E T I II TE 123 BON OUr SEUN rem D E 123 Application Server oxi aa SCORE ER ER RC RC COGO E 124 WHMCS QS CIV GP TIT i D ES 124 ModuteTIristellatiolissssate ves aucspsoRT PRTWVRTEN E 0201900 o DU ITA RET SI I SCOPE PrUI 124 Auto Module Installation ox socposE x xin px X d ua eros Ua D OpE EAT in ERR Red 125 Backup siii i aes Eua Raw ERR CDDUOOOEI EG e war a OC n oO Gc GR C RR RR 126 Nsync Does not apply to the 3x series ceeeeennnn n 126 Nsync Target Does not apply to the 3X series cene 129 Dual DOM Not available on N3200XXX N0503 N4200Eco N7700 N8800 ccs rcr 129 RSYNC Large Sew Cl seiccicereet saudades deste eiecii eect adsense Mtr cut EE 130 acd ome Tr 131 THECUS BackuD VUY o ssepe Recta se aE we toS d AS RR DUE 132 Windows XP Data Backup uiisssuesdevis vide sc Clear ce c cU Le c P deu Cute 133 Appie OS X Backup Utilities cried sex Sale RE RE a EYE ER EY RA EAR GR 134 External Devices voesssunue duau V EE ax EA SEE M E aM M ERR E EE RERUM M RE REM RE CREE E ES MERE 134 Printer Inforrmablobi zebkceon ep ee ebat oe cewek vespa E REUS Mee Pi Conn 134 UPS ziuinieMee EET 140 Chapter 5 Using Thecus IP Storage
62. P IP address Browse for a printer 9 Select a shared printer by name http Thecus NAS IP 631 printers usb printer Example computername printername or http computername printers printername printer Add a printer using a TCP IP address or hostname Type http lt Thecus NAS gt 631 printers usb printer in the box where lt Thecus NAS IP is the IP address of Thecus IP storage Click Next Select or install a printer and then press OK Select the manufacturer and model of your printer If your printer came with an installation disk click Have Disk If your printer is not listed consult your printer documentation for a compatible printer Printers Sof HP DeskJet 615C EF HP DeskJet 640C 542C E48C I HP Deskjet 6500 Series EF up Neck tot cone is di i If your printer model is not listed please contact your printer manufacturer for help 7 Windows will attempt to connect to the printer Connecting to http 172 16 66 64 631 printers usb printer 8 You can choose to set this printer as the default printer by checking the Set as the default printer box Click Next to continue Type a printer name Printer name l usb printer on http 172 16 66 64 631 V Bet as the default printer This printer has been installed with the HP Deskjet 6500 Series driver 9 Done Click Finish You ve successfully added usb printer on http 172 16 66 64 631 To see if the printer is workin
63. R y hu Lr caml The Browseable setting will be same method of setting for system share folder It designates whether or not this folder will be visible through web disk You may refer the figures below for reference when Yes and No are selected Add iSCSI Target Add Stack Target Enable iSCSI Target 7 Enable Disable Stackable Target IP 172 16 65 157 ign ign 2009 05 com thecus XFS iscsi vg0 isesi Y Apply Limit 0 9_ a z The Public setting will be set same as what the setting for the system share folder associated with the ACL permission setup If Public is set to Yes all users will be 97 able to access it and ACL button will be grayed out If Public is set to No the ACL button will be available on the Stack Target List window Add iSCSI Target Add Stack Target X Enable iSCSI Target 7 Enable Disable stackable Target IP 172 16 653 157 ign 19n 2009 05 com thecus XFS 1scs10 vg 1sesi Username Password Export share name Limit 0 9 a z Description Browseable Gi yes Fino Apply Click Apply to save your changes B Activate a Stack Target After your settings have been applied the system will bring you back to Stack Target List window as shown below There is one stack target device has been attached into this stack master Stack Target List Add 3Edit GQ Remove p JF Reconnect Export share name
64. RAID see Appendix B RAID Basics RAID Level You can set the storage volume as JBOD RAID O RAID 1 RAID 5 RAID 6 or RAID 10 RAID configuration is usually required only when you first set up the device A brief description of each RAID setting follows RAID Levels JBOD The storage volume is a single HDD with no RAID support JBOD requires a minimum of 1 disk but not data safety RAID O requires a minimum of 2 disks RAID 1 Offers disk mirroring Provides twice the read rate of single disks but same write rate RAID 1 requires a minimum of 2 disks RAID 5 Data striping and stripe error correction information provided 78 RAID 5 requires a minimum of 3 disks RAID 5 can sustain one failed disk Two independent parity computations must be used in order to provide protection against double disk failure Two different algorithms are employed to achieve this purpose RAID 6 requires a minimum of 4 disks RAID 6 can sustain two failed disks RAID 10 has high reliability and high performance RAID 10 is implemented as a striped array whose segments are RAID 1 arrays It has the fault tolerance of RAID 1 and the performance of RAID 0 RAID 10 requires 4 disks RAID 10 can sustain two failed disks WARNING If the administrator improperly removes a hard disk that should not be removed when RAID status is degraded all data will be lost Edit RAID On the RAID Information screen press the Edit button to go to the RAID Inf
65. Search User ID GroupID Group Name users NOTE All users are automatically assigned to the users group Edit Users 1 Select an existing user from the Local User Configuration screen 2 Click on the Edit button and Local User Setting screen appears 3 From here you can enter a new password and re enter to confirm or use the lt lt or gt gt buttons to have this user join or leave a group Click the Apply button to save your changes Edit M Local Uzer Setting Group List User Name zer Search User ID GrouplD Group Name Password DIIDIDIIDIIIII Confirm Password TITITTITITITIT Group Members GrovpID Group Name 102 users 114 Remove Users 1 Select an existing user from the Local User Configuration screen 2 Click on Remove button and the user is deleted from the system Local User Configuration Add qEdi d Remova User ID User Name 3 Pr 1007 User Local User Setting x 9 Do you want to delete this user To Local Group Configuration From the Accounts menu choose the Group item and the Local Group Configuration screen appears This screen allows you to Add Edit and Remove local groups Local Group Configuration GD Add Edt Remove Group ID Group Name 102 users Page jol b Pi a Displaying topics 1 1 of 1 Local Group Configuration Item X Desciption Press the Add button to add a user
66. TART NOTE For MAC OS X users double click on Thecus Setup Wizard dmg file 3 The Setup Wizard will start and automatically detect all Thecus storage devices on your network If none are found please check your connection and refer to Chapter 7 Troubleshooting for assistance Setup Wizard cA 4 Device Device Discovery l Discovery Version 2 0 4 No Host Name IP MAC N5500 172 16 64 222 00 11 C8 2 3 Login System 3 Network hone pod lU PUE TATTLE Configuration 3 Change Password 3 Complete NISSAN Mm m gt 4 Select the Thecus IP storage that you like to configure 43 5 Login with the administrator account and password The default account and password are both admin Setup Wizard i re IP Storage Appliance Version 2 0 4 Device Login System Discovery p System ff RR mo y Admin ID admin 4 Login RENS 3 Network Password ek kek Configuration 3 Change Password A 3 Complete Bak Net Exit 6 Name your Thecus IP storage and configure the network IP address If your switch or router is configured as a DHCP Server configuring the Thecus IP storage to automatically obtain an IP address is recommended You may also use a static IP address and enter the DNS Server address manually Setup Wizard zT IP Storage Appliance
67. The Menu Bar is where you will find all of the information screens and system settings of Thecus IP storage The various settings are placed in the following groups on the menu bar E Svstem Information y 4 system Management tg Ej System Network 731 Storage aa User and Group Authentication E Network Service E Application Server BR Backup 4 External Device Menu Bar Item q Description 1 0 0 0 0 System Information Current system status of the Thecus IP storage System Management Various Thecus IP storage system settings and information various services of the Thecus IP storage Thecus IP storage User and Group Authentication Allows configuration of users and groups Network Service Setup and manage protocols such as Samba CIFS AFP NFS FTP and other network services Application Server Printer Server and iTunes Server to set up of the Thecus IP storage Category of Backup Features set up of the Thecus IP storage External Device Thecus IP storage support printer serving and UPS backup power supplies Moving your cursor over any of these items will display the dropdown menu selections for each group In the following sections you will find detailed explanations of each function and how to configure your Thecus IP storage 54 Message Bar You can get information about system status quickly by moving mouse over Message Bar Descri
68. UI Login Configuration Web Disk Enable Disable Photo Server Enable C Disable Apply System Network Use the System Network menu to make network configuration settings as well as service support settings rg Ej System Network g WAN LANI L L1 173 WAN LAN1 WAN LAN1 Configuration From the System Network menu choose WAN LAN1 and the WAN LAN1 Configuration screen appears This screen displays the network parameters of the WAN LAN1 connection You may change any of these items and press Apply to confirm your settings See a description of each item in the following table 68 WAN LAN Configuration Host Name N4200PRO PM Domain Name thecus com WINS Server 1 WINS Server 2 MAC Address 00 14 FD 14 D6 94 Link Detected yes Link Speed 1000Mb s Jumbo Frame Disabl v Select from drop down list or input manually allow 1501 9000 L Support IP Sharing Mode Enable Disable Link Aggregation v Set IP Address by Static Dynamic IP 172 16 64 140 Netmask 255 255 252 Gateway 72 16 66 135 DNS Server 172 16 66 244 168 95 WAN LAN 1 Configuration Mem Description OOOO Domain name WINS Server MAC Address IP Sharing Mode Jumbo Frame Support Enable or disable Jumbo Frame Support of the WAN LAN1 interface on your Thecus IP storage When enabled PCs connected to the LAN2 port will be able to access the WAN LAN1 Specifies whether WAN LAN1 and LAN2
69. a security and accessibility in the case of a power failure Additionally the network UPS is also supported From the Status menu choose the UPS item and the UPS Setting screen appears Make any changes you wish and press Apply to confirm changes 177 UPS Settings UPS Monitoring Enable Disable Remote UPS Enable Disable Monitoring Remote UPS IP Manufacture w Madal w product has been tested for compatibility Battery Status N A Power N A Seconds between power failure and first notification Seconds between subsequent power failure notifications Shutdown the system when the battery charge is less than See the following table for a detailed description of each item UPS Setting tem XJ 4 DBDescipio Model Choose the UPS model number from the dropdowns Power Current status of the power being supplied to the UPS Seconds between power failure and Delay between power failure and first notification in first notification seconds failure notifications battery charge is less than should auto shutdown Apply Press Apply to save your changes Link Aggregation mode description Load Balance Round robin policy Transmit packets in sequential order from the first Balance rr available slave through the last This mode provides load balancing Round Robin and fault tolerance Failover Active backup policy Only one slave in the bond is active A different Active Ba
70. able or disable users from browsing the folder contents This setting will only apply while access via SMB CIFS and web disk Share Limit Enter the maximum size of the folder The folder will not grow beyond this limit You can enter a 0 to turn off the share folder limit Remove Folders To remove a folder press the Remove button from the specified folder row The system will confirm folder deletion Press Yes to delete the folder permanently or No to go back to the folder list Folder Qj Add 3 Edit NFS Ca snapshot 2S AC Folder name gt gt RAID ID File System Public Description J nsvnc RAIDI ext3 no nsync usbhdd RAIDI ext3 no usbhdd usbcopy RAIDI ext3 no usbcopy naswebsite RAIDJ ext3 yes naswebsite 2 iTunes music RAIDJ ext3 yes ilIunes music LL BONNY RAIDJ ext3 yes v r ie Info x The setting has been changed carry on with press Yes for confirmation 105 All the data stored in the folder will be deleted once the folder is deleted WARNING The data will not be recoverable NFS Share To allow NFS access to the share folder enable the NFS Service and then set up hosts with access rights by clicking Add Config NFS share x Add Mount point raid data nzync s Edt 9 Remove Host Name Privilege OS Support ID Mapping Config NFS share x TS Add Mount point raid data nzync Host Name XXX XXX XXX XXX Privilege Read Only Q Writable
71. accessed e Blinking red hard disk error N4200 series N5200XXX N5500 Each of the N4200 series N5200XXX N5500 s hard disk trays has a lock a latch and two LED indicators Hard Disk Trays Description Item e Solid blue Hard disk is powered on No function on N4200 series e Blinking green System is accessing data on the hard disk Access Error LED e Solid red HDD fail No function on N4200 series e Use the lock to physically secure the hard disk to the unit 4 Handle e Pull to remove the HDD tray 22 N3200XXX The N3200XXX only supports 3 5 Serial ATA SATA hard disks To install a hard disk into the N3200XXX follow the steps below 1 Open the front door of the N3200XXX 2 For 3 5 HDD a Get the hard drive rails and place them on either side of the hard drive fitting into the appropriate grooves b Holding the hard drive rails in place slide the hard disks into the N3200XXX until they snap into place c Tighten the thumbscrews a i N0503 The N0503 supports both 2 5 and 3 5 Serial ATA SATA hard disks To install a hard disk into the N0503 follow the steps below 3 Open front door of the N0503 4 For 3 5 HDD a Get the hard drive rails and place them on either side of the hard drive fitting into the appropriate grooves b Holding the hard drive rails in place slide the hard disks into the N0503 until they snap into place c Tighten the thumbscrews 5 For 2 5
72. anually run your tasks at any time Step 3 Manually edit or run your backup tasks After selecting apply you will be brought back to the Rsync Schedule Backup task list OAdd Modify Obelete Rsync Schedule Backup Task Name Source Folder Schedule Target Server Path Last Time Last Status f Action S Task 1 music photos movies Sunday 02 00 Disabled 172 16 64 144 public multimedia 2010 09 15 15 53 in progress S J Task 2 spreadsheets Sunday 02 00 Enabled 172 16 64 147 public spreadsheets Simply click the arrow to start the task whether the scheduler is enabled or disabled and click the box to cancel the ongoing task Thecus Backup Utility The Thecus Backup Utility is on your Installation CD When you click on the CD the Backup Utility will be installed under Program Groups Thecus Thecus Backup Utility If it is not installed you can copy the file Thecus Backup Utility exe to a convenient location on your hard disk and double click to execute it If you can not find Thecus Backup Utility on your CD please download it from the Thecus website http www thecus com When you execute this utility for the first time it will ask you whether to create a DB file Click Yes 1 Click Add to create a Backup task The Add New Task dialog box appears Add New Task tem q Description O 1 If unchecked the backup will be a full backup Excluded extensions Files with these
73. appened please setup UNIX Extension disable to get issue solved Hide Temporary Files If enabled it will hide Mac OS X temporary files on the NAS when viewed in Windows Samba CIFS Options for Recycle Bin Samba Recycle Bin Enable Disable Recycle bin contents are deleted after days Set as 0 for manual deletion only Recycle Bin Folder Display Enable Disable Recycle Bin Max File Size Set as 0 for unrestricted Samba Recycle Bin The Thecus IP storage is supported recycle bin via SMB CIFS protocol Simply enable the Recycle Bin function and Recycle Folder Display then all of deleted files folders will reside in the NAS Recycle Associated RDID Volume share folder Samba CIFS Options for Recycle Bin Samba Recycle Bin Disable Recycle bin contents are deleted after days Set as 0 for manual deletion only Disable Recycle Bin Max File Size GB Set as 0 for unrestricted Recycle Bin Folder Display 170 For example the system has created 2 RAID volumes with ID RAIDpm and RAID Then it will have 2 recycle bin folder appear as NAS Recycle RAID and NAS Recycle RAIDpm uuum Ly Mas RAID T Ramp P Eoo File System Status amp RAIDpm EXT4 Healthy RAID XFS Healthy JP WAS IVI ure source p NAS Recycle RAID P NAS Recycle RAIDpm rs a There are 2 more setting could help to manage
74. are To allow NFS access to the share folder enable the NFS Service and then set up hosts with access rights by clicking Add 164 The NFS is now supporting both v3 0 and v4 0 Please be noticed the mounting point indicated on the top left of Config NFS share page Let s take example for system share folder andy1 NFS3 Mount point raidO data NAS NFSExports_ andy1 NFS4 Mount point andy1 S share x NFS3 Mount point raid data NAS NFS Exports andyi NFS4 Mount point andy1 GeEdt Remove Host Name Privilege OS Support ID Mapping Sync Async Config NFS share x NFS Add Host Name XXX XXX XXX XXX All host please set other host ox xxx xxx xxx host range XKK XKK XKK XOK XX Privilege Read Only 9 Writable OS Support Unix Linux System AIX Allow source port gt 1024 ID Mapping Guest system root account will have full access to this share root root Guest system root account will be mapped ti All User on guest system will b Sync Async NFS Share Item Description 1 10 0 0 O Enter the name or IP address of the host Host has either read only or writeable access to the folder Guest System Support There are two selections available e Unix Linux System e AIX Allow source port gt 1024 Choose the one which best fits your needs IO Mapping There are three selections available e Guest system ro
75. ated Sector Count of reallocated sectors When the hard drive finds a Count read write verification error it marks this sector as reallocated and transfers data to a special reserved area spare area This process is also known as remapping and reallocated sectors are called remaps This is why on a modern hard disks you can not see bad blocks while testing the surface all bad blocks are hidden in reallocated sectors However the more sectors that are reallocated the more a decrease up to 10 or more can be noticed in disk read write speeds Current Pending Sector Current count of unstable sectors waiting for remapping The raw value of this attribute indicates the total number of sectors waiting for remapping Later when some of these sectors are read successfully the value is decreased If errors still occur when reading sectors the hard drive will try to restore the data transfer it to the reserved disk area spare area and mark this sector as remapped If this attribute value remains at zero it indicates that the quality of the corresponding surface area is low Test Type Set short or long time to test Test Result Result of the test Total time of the test If the Reallocated Sector Count gt 32 or Current Pending Sector of a hard disk drive gt 0 the status of the disk will show Warning This warning is only used to alert the system administrator that there are bad sectors on the disk and th
76. ating that you changed the files and the date of any change b You must cause any work that you distribute or publish that in whole or in part contains or is derived from the Program or any part thereof to be licensed as a whole at no charge to all third parties under the terms of this License C If the modified program normally reads commands interactively when run you must cause it when started running for such interactive use in the most ordinary way to print or display an announcement including an appropriate copyright notice and a notice that there is no warranty or else saying that you provide a warranty and that users may redistribute the program under 187 these conditions and telling the user how to view a copy of this License Exception if the Program itself is interactive but does not normally print such an announcement your work based on the Program is not required to print an announcement These requirements apply to the modified work as a whole If identifiable sections of that work are not derived from the Program and can be reasonably considered independent and separate works in themselves then this License and its terms do not apply to those sections when you distribute them as separate works But when you distribute the same sections as part of a whole which is a work based on the Program the distribution of the whole must be on the terms of this License whose permissions for other licensees extend to the
77. ation Local Group Setting x 9 Do you want delete this group Lo Batch Create Users and Groups The Thecus IP storage can also add users and groups in batch mode This enables you to conveniently add numerous users and groups automatically by importing a simple comma separated plain text txt file From the Accounts menu click Batch Mgmt and the Batch Create Users and Groups dialogue will appear To import your list of users and groups follow these steps 1 Click Browse to locate your comma separated text file The information in the text file should follow this format USERNAME PASSWORD GROUP 2 Click Open 3 Click Import to begin the user list import 117 Batch Create Users and Groups Please choose afile to upload Description Create local users and groups in batch mode Submit files containing user names passwords and group names separated by comma without any space each line represents one user ex Studenti password student group Quota The User Quota system provides a way of limiting users available storage capacity Setting a user quota gives a given user a given amount of space on EACH RAID partition For example if there are 3 RAID partitions and a user has a user quota of 300MB the user can store 300MB of data on EACH RAID partition or a total of 900MB of data The framework keeps track of the total amount of data a user has used across different folders and functions
78. ator Properties window select the Targets tab With the iSCSI target highlighted click Log On The Log On to Target dialogue will appear iSCSI Initiator Properties General Discovery Targets Persistent Targets Bound Volumes Devices Select a target and click Log On to access the storage devices for that target Click details to see information about the sessions connections and devices for that target Targets Name ign 2007 05 com thecus RAID iscsi0 vg0 test Inactive 11 If you have not enabled CHAP click OK to continue Log On to Target Target name ign 2007 05 com thecus RAID iscsi vg0 test C Automatically restore this connection when the system boots Enable multi path A Only select this option if iSCSI multi path software is already installed on your computer Advanced Cancel If you have enabled CHAP click Advanced Under Advanced Settings check the CHAP login information checkbox and enter your username and password Click OK 155 Advanced Settings General PSec Connect by using Local adapter Default Source IP Default Target Portal Default CRC Checksum C Data digest C Header digest CHAP helps ensure data security by providing authentication between a target and an initiator trying to establish a connection To use it specify the same target CHAP secret that was configured on the target for this i
79. aults are User Name admin Password admin X If you changed your password in the setup wizard use the new password Once you are logged in as an administrator disclaimer page will appear as below Please click the check box if you do not want to have this page displayed during the next login Disclaimer THECUS has no liability consequential incidental or special damages These include without limitation loss of recorded data the cost of recovery of lost data lost profits and the cost of the installation or removal of any THECUS products the installation of replacement THECUS products and any inspection testing or redesign caused by any defect or by the repair or replacement of Products arising from a defect in any THECUS products Users can now register their Thecus NAS online Simply go to the online registration page and enable the registration function The registration page states what system information will be kept in the archive Users will receive firmware upgrade and module release notice regularly I agree Don t show this message next time OR Following by disclaim page you will see the Web Administration Interface From here you can configure and monitor virtually every aspect of the Thecus IP storage from anywhere on the network My Favorite The user interface with My Favorite shortcut is allowed user to designate often used items and have them display on the main screen area The figure
80. aying files and folders Click on a file to download the file Buttons on the folder page allow you to create new folders upload files and delete files in the folder To create a new folder within the current folder press the New Folder button When the screen appears enter a name for the folder Press OK to create the folder To upload a file from your computer to the current folder press the New File upload button When the screen appears press Browse and locate the file to upload Press OK and the file will be uploaded to the current folder To delete a file or folder select the file or folder s check box Press Delete button You can also click the Select All button to select all files and folders in this folder To access folders with access control you must first login with a local user account For more information on how to setup user rights to the folders please check Chapter 4 Storage Management Share Folder Folder Access Control List ACL XP nans mas IT NC CX Web Disk Directory Tree gE BrowsingDirectory nsswetsite wt i nola AN Home A Reload Gi Search de db es E Fiter 3 nsyne Jg C usbeogy Hame Sire Type Modified 3i G usbhdd Page lofi Dane No items to daplay h Home Reload Q Search a X Aa V y Show Directories Filter 142 Folder Page Button Buton Description 00000 dp Reload Re load the current list x ona Search files in the current web disk d
81. cable from your network to the WAN port on the back panel of the N4100PRO 2 Connect the provided power cord into the universal power socket on the back panel Plug the other end of the cord into a surge protected socket 3 Press the power button on the front panel to power on the N4100PRO Checking System Status After making connections on the N4100PRO and powering up check whether the system status is normal or has trouble by observing indicators on the front panel and hard disk trays System Status Normal The system status is normal if 1 The front panel Power LED glows blue and the WAN LED glows or blinks green 2 The HDD Power LED on each HDD tray glows blue System Trouble The system has trouble if 1 Any LED glows red 1 The system emits a continuous beeping sound If the system has trouble please refer to Chapter 8 Troubleshooting 37 To connect N4200 series NAS to your network follow the steps below 1 Connect an Ethernet cable from your network to the WAN LAN1 port on the back panel of the N4200 e e Q2 d Md 2 et Q2 n 4 6 e 9 s SA n Q2 t e v ete Q2 A e LI IL m o Sos ON 9 9 0 oe 4 Md 4 CK e Me 4 et aren 29 Md tete OX 9 9 2 2 Connect the provided power cord into the universal power socket on the back panel Plug the other end of the cord into a surge
82. cation Enable or disable the system beeper that beeps when a problem occurs Email Notification Enable or disable email notifications of system problems SMTP Server Specifies the hostname IP address of the SMTP server Specifies the port to send outgoing notification emails SMTP Account ID Set the SMTP Server Email account ID Account Password Enter a new password Set email address to send email Receiver s E mail Add one or more recipient s email addresses to receive email Address 1 2 3 4 notifications Consult with your mail server administrator for email server Auth Type Select the SMTP Server account authentication type information 61 Firmware Upgrade From the menu choose the Firmware Upgrade item and the Firmware Upgrade screen appears Firmware Upgrade Firmware Select a firmware file V Save old firmware images and system configuration files before upgrading firmware in case the system needs it later on The backup files can will be stored on a USB disk if available or in the nsync folder on vour RAID partition The backup will take approximately 3 5 minutes to complete before carrying on with the firmware upgrade Apply Follow the steps below to upgrade your firmware 1 Use the Browse button to find the firmware file 2 Press Apply 3 The beeper beeps and the Busy LED blinks until the upgrade is complete e The beeper only beeps if it is enabled in the System Notification menu e Chec
83. catior Raid Volume Rep n Disk amp B x t Installed Rsyne Backup Rsync Schedule Backup Disk B x t Installed Twonkymedia Twonkymedia Disk amp mj x t Installed USB fove fil n USB Disk B x Installed Ust JSB eSATA Schedule Ba Disk amp B x tInstalled webserver Vebserver Disk amp ld x Not Installed NZBGet 1 0 0 NZBGet download Onlin m t Installed Mailserver 1 00 10 Mai server Online amp ig Installed TP Cam 01 Simnle survaitlanc Antine e i b Auto Module Source List Installed Name Version Description Location Document Action To install module or deleted p s If module list from on line then no delete option available Rescan Click to rescan from both on line and disk Module Package Irodules xir f Module Source List Installed Manna Version Description Locatian Document Action Not Installed IP Cam 2 0 1 P Cam Disk je Mot Installed Tvveonkymedia 1 0 0 Twonkymecia Disk u instal Module on Disk Not Iretalleed webserver 1 0 4 Webserver Disk After click on Action to install module the module will be under list of Module Installation Please do Enable to activate module usage Backup There are a number of ways to back up data with the Thecus IP storage a Backup x 8 Nsvnc E Nsvnc Target 3 Dual DOM Backup Nsync Does not apply to the 3x series You can backup a share folder to another Thecus IP storage Nsync Target or any FTP server for safe keeping as long as you
84. ck Next to proceed with the file system check Click Reboot to reboot without running the check File System Check ZFS is not need file svstem check 7 RAID Level Disks Status Filesystem Status Data Capacity Last Check Time RAIDS Healthy Normal 0 2 GB 41 8 GB Thecus com File System Check ZFS is not need file svstem check Once you click Next you will see the following screen Status Press Star ta Begin Latest 20 lines Information Result al Click Start to begin the file system check Click Reboot to reboot the system When the file system check is run the system will show 20 lines of information until it is complete Once complete the results will be shown at the bottom 66 Status Latest 20 lines Information i C m Ies Checking group summary information Oo C C n in tr j ou G ou onan ooo iQ i on i amp Co Co Co Co 20 ron en rao L U r Le ron 20 20 ran Lev n 20 20 20 rag L ran LeU Qn iQ Cr on Gl Oo D O O 2 CO C OO amp bO S CO D LD LO LO LO D LD LO LD D D D Ne n p on tu GO amp c amp O amp HH HM C c OH OH 6 m o m ho d 4a Oe we Oo n on of ho m oO Co Co Co Co Co Co Co Co Co Co Co Co Co Go Co 5 SE EINEN ot n Ec e a LU E E n r0 PN ort o n aa 2 g 41 41 rs 33 262144 files 3 Cr JJ Go Co Co Co Co Co C0 O ee 0 c o D Mh bh ho v E ee NE oe
85. ckup slave becomes active if and only if the active slave fails The bond s MAC address is externally visible on only one port network adapter to avoid confusing the switch This mode provides fault tolerance The primary option affects the behavior of this mode 178 Balance XOR 802 3ad Balance TLB Balance ALB XOR policy Transmit based on source MAC address XOR d with destination MAC address modulo slave count This selects the same Slave for each destination MAC address This mode provides load balancing and fault tolerance IEEE 802 3ad Dynamic link aggregation Creates aggregation groups that share the same speed and duplex settings Utilizes all slaves in the active aggregator according to the 802 3ad specification Pre requisites 1 Ethtool support in the base drivers for retrieving the speed and duplex of each slave 2 A switch that supports IEEE 802 3ad Dynamic link aggregation Most switches will require some type of configuration to enable 802 3ad mode Adaptive transmit load balancing channel bonding that does not require any special switch support The outgoing traffic is distributed according to the current load computed relative to the speed on each Slave Incoming traffic is received by the current slave If the receiving Slave fails another slave takes over the MAC address of the failed receiving slave receiving slave Balance TLB mode provides load balancing and fault tolerance A
86. cord into a surge protected socket Press the 3 Press the power button on the Front Panel to boot up the N7700 40 To connect N8200XXX N8800 series NAS to your network follow the steps below 1 Connect an Ethernet cable from your network to the WAN LAN1 port on the back panel of the N8200XXX N8800 2 Connect the provided power cord into the universal power socket on the back panel Plug the other end of the cord into a surge protected socket Press the power supply switch to turn on the power supply 3 Press the power button on the front panel to boot up the N8200XXX N8800 41 42 Chapter 3 First Time Setup Overview Once the hardware is installed physically connected to your network and powered on you can configure the Thecus IP storage so that it is accessible to your network users There are two ways to set up your Thecus IP storage using the Thecus Setup Wizard or the LCD display Follow the steps below for initial software setup Thecus Setup Wizard The handy Thecus Setup Wizard makes configuring Thecus IP storage a snap To configure the Thecus IP storage using the Setup Wizard perform the following steps 1 Insert the installation CD into your CD ROM drive the host PC must be connected to the network 2 The Setup Wizard should launch automatically If not please browse your CD ROM drive and double click on Setup exe Thecus IP Storage Appliance Setup Wizard LS
87. d parity scheme dual parity Data is striped on a block level across a set of drives just like in RAID 5 anda second set of parity is calculated and written across all the drives RAID 6 provides for an extremely high data fault tolerance and can sustain two simultaneous drive failures This is a perfect solution for mission critical applications RAID 10 RAID 10 is implemented as a striped array whose segments are RAID 1 arrays RAID 10 has the same fault tolerance as RAID level 1 RAID 10 has the same overhead for fault tolerance as mirroring alone High I O rates are achieved by striping RAID 1 segments Under certain circumstances RAID 10 array can sustain up to 2 simultaneous drive failures Excellent solution for applications that would have otherwise gone with RAID 1 but need an additional performance boost RAID 50 A RAID 50 combines the straight block level striping of RAID O with the distributed parity of RAID 5 This is a RAID O array striped across RAID 5 elements It requires at least 6 drives RAID 60 A RAID 60 combines the straight block level striping of RAID O with the distributed double parity of RAID 6 That is a RAID O array striped across RAID 6 elements It requires at least 8 disks JBOD Although a concatenation of disks also called JBOD or Just a Bunch of Disks is not one of the numbered RAID levels it is a popular method for combining multiple physical disk drives into a single virtual one As t
88. daptive load balancing includes balance tlb plus receive load balancing rlb for IPV4 traffic and does not require any special switch support The receive load balancing is achieved by ARP negotiation The bonding driver intercepts the ARP Replies sent by the local system on their way out and overwrites the source hardware address with the unique hardware address of one of the slaves in the bond such that different peers use different hardware addresses for the server 179 Appendix A Customer Support If your Thecus IP storage is not working properly we encourage you to check out Chapter 7 Troubleshooting located in this manual You can also try to ensure that you are using the latest firmware version for your Thecus IP storage Thecus is committed to providing free firmware upgrades to our customers Our newest firmware is available on our Download Center http www thecus com download php If you are still experiencing problems with your Thecus IP storage or require a Return Merchandise Authorization RMA feel free to contact technical support via our Technical Support Website http www thecus com support_tech php Customers in the US should send all technical support enquiries to the US contact window included in the following web page http www thecus com support_tech php For Sales Information you can e mail us at sales thecus com Thank you for choosing Thecus Thecus 180 Appendix B RAID Basics Overvi
89. ds or other input methods Change display language Ease of Access Let Windows suggest settings Optimize visual display eof aA Il 2 Click the right mouse button in anywhere on the Printers folder and then select Add Printer Documents Status Comments Location Favonte Links F D gt Fa Microsoft XPS Document Documents r A l Writer E Pictures Ready 2 0 41 Music More View Folders Sort By BE Desktop Group By B fae Stack By d Public Refresh iM Computer Network Paste Control Panel Paste Shortcut Z Additional Opt Undo Copy Ws Appearance ar D Clock Langua Run as administrator o Ease of Access mh Hardware and aj AutoPlay ua Personalizati w Power Optio Add Printer Server Properties C d Add Printer Choose a local or network printer Add a local printer Use this option only if you don t have a USB printer Windows automatically installs USB printers when you plug them in E Add a network wireless or Bluetooth printer Make sure that your computer is connected to the network or that your Bluetooth or wireless printer is turned on i 137 4 Select The printer that I want isn t listed Searching for available printers You can press The printer that I want isn t listed to go into next page without waiting for Searching for available printers to finish 5 Click Select a shared printer by name Find a printer by name or TC
90. e Availability Thecus Technology Corp has exposed the full source code of the GPL licensed software For more information on how you can obtain our source code please visit our web site http www thecus com Copyrights This product includes cryptographic software written by Eric Young eay cryptsoft com This product includes software developed by Mark Murray This product includes software developed by Eric Young eay cryptsoft com This product includes software developed by the OpenSSL Project for use in the OpenSSL Toolkit http www openssl org This product includes PHP freely available from http www php net This product includes software developed by the University of California Berkeley and its contributors This product includes software developed by Winning Strategies Inc This product includes software developed by the Apache Group for use in the Apache HTTP server project http www apache org This product includes software developed by Softweyr LLC the University of California Berkeley and its contributors This product includes software developed by Bodo Moeller This product includes software developed by Greg Roelofs and contributors for the book PNG The Definitive Guide published by O Reilly and Associates This product includes software developed by the NetBSD Foundation Inc and its contributors This product includes software developed by Yen Yen Lim and North Dakota State Universit
91. e Backup Type Destination and Name page specify a back up location using the Browse button 5 Find and select the drive that specifies your Thecus IP storage as your backup destination and click Next 6 Click Next to display the wizard s final page and click Finish to start backing up Apple OS X Backup Utilities Mac OS X does not include any backup software However there are a number of backup solutions available for the Mac OS X including iBackup Psyncx iMSafe Rsyncx Folder Synchronizer X Tri BACKUP Impression Intego Personal Backup SilverKeeper and Apple s dotMac Backup utility to name just a few To find even more freeware and shareware backup utilities to choose from go to VersionTracker or MacUpdate and search on backup External Devices Thecus IP storage support printer serving and UPS backup power supplies The integrated print server allows you to share a single USB printer with all users on the network The UPS backup power supply provides continuous power during power outages E a a 1 af ty aa f FExternal Device Printer Information From the External Device menu choose the Printer item and the Printer Information screen will appear This screen provides the following information about the USB printer connected to the USB port 134 Printer Information Printer 1 Manufacturer NIA Model NIA Status No Printer Detected Restart printer service Remove document from queue
92. e key is lost With RAID volume encryption enabled the system performance will goes down With RAID volume encryption enabled RAID volume expansion will operated in off line mode RAID volumes with encryption enabled will be displayed with a key lock symbol next to volume ID name 76 RAID Information E Sredten dca Edit Master ID RAID Sis Disks Total Data 19C SI 0 Healthy 1 2 219 8GB 0 22GB 211 5 GB N A nata iSCSI E unused 6 Specify a stripe size 64K is the default setting 7 Specify the percentage allocated for user data by drag the horizontal bar The remaining space will be made available for iSCSI 8 Selected the file system you like to have for this RAID volume The selection is available from ext3 XFS and ZFS Select ZFS file system while snapshot is needed It is only one ZFS file system allowed to be created per system ZFS file system is only accessible by CIFS SMB not for AFP and NFS users XFS file system is not support folder quota feature RAID Information Create RAID Disk Ha Capacity MB Model Status Used Spare 1 1 907 729 WEC WD2002 OK ie IF n 2 O 1 907 729 WDC WD2002 OK E Fl 3 1 907 729 WDC V D2002 Warning go 1 4 1 907 729 WDC V D2002 OK C E zi 5 1 907 729 WDC WD2002 OK n rj 5 1 907 729 WDC Vy D2002 OK r1 r1 Yi RAID Level JBOD RDG ORAD1 ORADS CORADG RAW RAID ID RAID K Alow 0 9 aaz Asz
93. e or disable the DHCP server to automatically assign IP address to PCs connected to the LAN2 interface Start IP Specifies the starting IP address of the DHCP range End IP Specifies the ending IP address of the DHCP range DNS Server Displayed the DNS server IP address The IP Segment of WAN LAN1 and LAN2 should not overlap The IP address of the LAN2 interface should not be in the range of the WARNING Start IP address and End IP address Storage Management The Storage menu displays the status of storage devices installed in the Thecus IP storage and includes storage configuration options such as RAID and disk settings folder configuration space allocation and ISO Mount H Storage Jj Disks Q RAD B Space Allocation Stackable 5 ISO Mount Share Folder Disks Information From the Storage menu choose the Disks item and the Disks Information screen appears From here you can see various items about installed SATA hard disks Blank lines indicate that a SATA hard disk is not currently installed in that particular disk slot NOTE e The screen shot below just example from Thecus IP Storage The disk slots can from 4 to 8 depend on the model of Thecus IP storage 71 Disks Information Disk No Capacity MB Model Firmware Status Bad Block Scan l 476 940 WDC WD5003ABYX 0 01 0 JP Detected P Click to start 2 476 940 WDC WD5003ABYX 0 01 0 gt Detected Click to start 476 940 WDC WD5003ABYX 0 01 0 GP D
94. e user when new firmware and software modules are released by Thecus To enable this service simply check the Enable check box By enabling this service the items in bold will be sent to Thecus via the Internet 58 Registration Enable The following information will be recorded after registration is enabled Product model name current firmware version MAC address of WAN LANI mail address of system notification and language selection This additional information would be appreciated as well Internal HDD brand and firmware version Time Zone Other than the defined items sent upon registration there are also two additional items HDD Info and Time Zone These two optional items can also be sent to Thecus anonymously for analysis and statistics purposes To send these items simply check the desired checkboxes to help Thecus improve its products and services Registration J Enable The following information will be recorded after registration is enabled Product model name current firmware version MAC address of WAN LANI1 mail address of system notification and language selection quesos Al d Firmware ay Module Publish date Information Delivery Page l ofl Syslog Management Generates system log messages for the syslog server These messages are stored on your NAS in Nsync gt log gt messages Information can be obtained in two ways locally and remotely Local Acces
95. ears This screen displays the service support parameters of the system You can change any of these items and press Apply to confirm your settings Home 2 Metwork Service gt WebService 2 Heb C d My Favorite Ur Shutdown a Logo WebService HTTP Support Sharing T Enable Wabe Part BD Secure WebService Secure HTTP Support Sharing 9 Enable D able Port Certificate Type 2 User System Certificate File i Certificate Key File Ey CA Certficate File fe Description 1 f a fle error occurs with an uploaded SSL certificate file default settings wil be used automatically 2 The SSL certificate fie needs to reload alter the master RAID partition has been changed 3 The setting did nat apply for Web Dek vz x x and after 172 A description of each item follows Web Service Item Description HTTP WebDisk Support Enable or disable WebDisk support Enter the port number if this option is enabled The port number is default 80 Enable or disable secure WebDisk support Enter the port if this Support option is enabled Select User if there is available Certification ID ex Apply from VeriSign Or using system default by select System Certificate File Upload Certificate File if choose Certificate type User Certificate Key File Upload Certificate Key File if choose Certificate type User CA Certificate File Upload CA Certificate File if choose Certificate type User Restore
96. ebsite Raid status must be healthy degraded LJ3iTunes musie ACL restoration from a ZFS file system can only be appled to another ZFS file system ES Recursive ACL restoration does not apply to the USBHDD usbhdd folder E 3 Module Folder While the RAID partition is restoring backing up ACL its folders wil not be shown within the UT E B T ACL restoration backup cannot be applied to stacked folders 3 NAS Module Source gt pms gt DJ pmi After input the ACL backup file and click Next button system will come out the screen to list matched folders in between backup file and this RAID volume Just select the desired folders for ACL restore ACL Backup Restore x Folder name Module Folder NAS Module Source iTunes music m x naswebsite nsync pmi usbcapy usbhdd a a e ec Notice The target RAID partition i not the original RAID partion The ACL backup will only backing the share folder level no apply to its sub layer The ACL backup restore can be used among ext3 ext4 XFS file system but ZFS can only be used with other RAID volume with ZFS file system created while backup restore e If recursive has been checked during ACL restoration it will apply all of its sub folder with same permission Uninterrupted Power Source UPS Setting The Thecus IP storage can also support various uninterruptible power supply unit via either Serial or USB interface depend on model to provide extra dat
97. ect your rights with two steps 1 copyright the software and 2 offer you this license which gives you legal permission to copy distribute and or modify the software Also for each author s protection and ours we want to make certain that everyone understands that there is no warranty for this free software If the software is modified by someone else and passed on we want its recipients to know that what 186 they have is not the original so that any problems introduced by others will not reflect on the original authors reputations Finally any free program is threatened constantly by software patents We wish to avoid the danger that redistributors of a free program will individually obtain patent licenses in effect making the program proprietary To prevent this we have made it clear that any patent must be licensed for everyone s free use or not licensed at all The precise terms and conditions for copying distribution and modification follow TERMS AND CONDITIONS FOR COPYING DISTRIBUTION AND MODIFICATION O This License applies to any program or other work which contains a notice placed by the copyright holder saying it may be distributed under the terms of this General Public License The Program below refers to any such program or work and a work based on the Program means either the Program or any derivative work under copyright law that is to say a work containing the Program or a portion of it either verba
98. ed File Winter ijpa File progress 100 complete Currently copying file 4 of 4 To stop copying click Cancel Cancel 14 When the upload is finished the Wizard will ask you whether if you want to go to the website Click Finish to go to your Photo Web Server Web Publishing Wizard E Completing the Web Publishing Wizard Y ou have successfully published your files to this site Open this site when click Finish To close this wizard click Finish 15 Click on the user s icon to go to that user s album Tess Thasus Creator in Storage rM d HCLILESIE Pies andy s alitum Protect Your Source Secure v Data 148 16 You will see the user s album list Click on Album sr c Thecus Creator in Storage Mra HELET Phobos gt amd s album Protect Your Sauron Secure w Data 17 Finished You will see the pictures just selected in the album ecco ir te I STER TE n iaa Pons c Goby a Sr iwi Protect tssir Secure Data Managing Albums and Photos Icon Function Description L1 Make Cover Make selected photo your cover picture Back Return to the previous screen 149 Add Add a new album or photos Modify Edit the name and description of the selected album or photo Each name is limited to 20 characters and each description is limited to 255 characters Delete Delete the selected albums or photos e Only logged in users will see these ico
99. een created the LUN ID is configurable from 1 to 254 with a default of the next available number in ascending numerical order The LUN ID is unique and can not be duplicated except for LUN ID O 9 If you ve enabled CHAP authentication enter a username and a password Confirm your chosen password be reentering it in the Password Confirm box 10 Click OK to create the iSCSI volume Modify ISCSI Volume To Modify iSCSI volume on the current RAID volume follow the steps below 1 Under the Volume Allocation List click Modify The Modify iSCSI Volume screen appears Space Allocation RAID Information Master ip RAID Status Disks Total Data iSCSI RAID Level E Z Used Capacity Capacity Capacity RAID 5 Healthy 1 2 3 927 7 0 6GB 852 7 GB 46 4 GB Volume Allocation List iSCSI Target iSCSI Thin Provision Target Advance Option O Add 4 Modify Expand Delete du dw Type Name Capacity iSCSI iscsi10 46 4 GB Space Allocation X Create SCSI Volume RAID ID RAID Unused 4 55 148 68 GB Alocation 148 88 GB SCSI Target Volume O Enable i Disable Target Name i mic 09 a z l nin x qn Year 2010 qn Month 08 v LUN TD ja we Authentication C3 CHAP Username Limit 0 9 a2 Az Password Limit 079 gez AZ length between 12 16 Password Confirme OR Description The iSCSI block site can be set under system advance option defauk 5 512 Bytes Please use 4K b
100. elow 49 SMB CIFS Apple File Protocol AFP Network File System NFS File Transfer Protocol FTP iTunes Server Printer Server Photo Server 50 Chapter 4 System Administration Overview The Thecus IP storage provides an easily accessible Web Administration Interface With it you can configure and monitor the Thecus IP storage anywhere on the network Web Administration Interface Make sure your network is connected to the Internet To access Thecus IP storage Web Administration Interface 1 Type the Thecus IP storage IP address into your browser Default IP address is http 192 168 1 100 Login mode swil ch button To proper browser web page we recommend to use TE7 Firefox Safari Chrome or Opera Protect vour source Secure vu Data Protect vour Source Secure vor Data Fold Logm mode s vitch button To proper browser web page we recommend to use IE7 Firefox Safari Chrome or Opera Your computer s network IP address must be on the same subnet as the Thecus IP storage If the Thecus IP storage has default IP address of 192 168 1 100 your managing PC IP address must be 192 168 1 x where x is a number between 1 and 254 but not 100 This page can be displayed with Flash or with HTML Choose Flash for Flash shown in the top figure and Traditional for HTML shown in the bottom figure 51 2 Login to the system using the administrator user name and password The factory def
101. erally NO WARRANTY BECAUSE THE PROGRAM IS LICENSED FREE OF CHARGE THERE IS NO WARRANTY FOR THE PROGRAM TO THE EXTENT PERMITTED BY APPLICABLE LAW EXCEPT WHEN OTHERWISE STATED IN WRITING THE COPYRIGHT HOLDERS AND OR OTHER PARTIES PROVIDE THE PROGRAM AS IS WITHOUT WARRANTY OF ANY KIND EITHER EXPRESSED OR IMPLIED INCLUDING BUT NOT LIMITED TO THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE THE ENTIRE RISK AS TO THE QUALITY AND PERFORMANCE OF THE PROGRAM IS WITH YOU SHOULD THE PROGRAM PROVE DEFECTIVE YOU ASSUME THE COST OF ALL NECESSARY SERVICING REPAIR OR CORRECTION IN NO EVENT UNLESS REQUIRED BY APPLICABLE LAW OR AGREED TO IN WRITING WILL ANY COPYRIGHT HOLDER OR ANY OTHER PARTY WHO MAY MODIFY AND OR REDISTRIBUTE THE PROGRAM AS PERMITTED ABOVE BE LIABLE TO YOU FOR DAMAGES INCLUDING ANY GENERAL SPECIAL INCIDENTAL OR CONSEQUENTIAL DAMAGES ARISING OUT OF THE USE OR INABILITY TO USE THE PROGRAM INCLUDING BUT NOT LIMITED TO LOSS OF DATA OR DATA BEING RENDERED INACCURATE OR LOSSES SUSTAINED BY YOU OR THIRD PARTIES OR A FAILURE OF THE PROGRAM TO OPERATE WITH ANY OTHER PROGRAMS EVEN IF SUCH HOLDER OR OTHER PARTY HAS BEEN ADVISED OF THE POSSIBILITY OF SUCH DAMAGES END OF TERMS AND CONDITIONS 190
102. erating system Server Message Block Common Internet File System Do the link in network protocol Enable or Disable SMB CIFS protocol for Windows Apple Unix drive mapping e In some environments due to security concerns you may wish to disable SMB CIFS as a precaution against computer viruses File Access Cache File Access Cache is default Enable This option will help to increase the performance while single client access share folder in writing under SMB CIFS protocol Samba Recycle Bin The Thecus IP storage is supported recycle bin via SMB CIFS protocol Simply enable it then all of deleted files folders will reside in the recycle folder with hidden attribution in each share 119 In general Windows has default to invisible all of hidden folders files So please enable this option to view recycle folder Samba Anonymous Login Authentication To enable this option no matter there is share folder has been created in public access The user account and password is needed from system to access under SMB CIFS protocol On the other hand no more anonymous login is allowed Samba is Native mode The Thecus IP storage is supported Samba mode options In the ADS environment with Native mode selected then Thecus IP storage is capable to become local master position UNIX Extension The default is enable for Samba usage with situation using Mac OSX with smb connection may have permission issue
103. erver Setting Item Description O lt O Nsync Target Server Enable or Disable Nsync Target support To enable Nsync task to go thru firewall you have to open port TCP 1194 on your firewall in both directions Nsync Target Does not apply to the 3X series From the Backup menu choose the Nsync Target item and the Nsync Setting screen appears Enable or Disable your Nsync Target Server Press Apply to confirm your settings If the Thecus Nsync feature has chose to use Rsync to replicate data between two systems For the target side to allow source cross data the Rsync target server needs to assign a username and password for authentication Once Nsync Target has been enabled the other Thecus NAS product is able to operate remote replication to this NAS system Nsync Setting Neyne Target Server Enable CI Disable Reyne Setting Reyne Target Server O Enable Disable Username Password Apply Dual DOM Not available on N3200XXX N0503 N4200Eco N7700 N8800 NAS The unique Dual DOM feature can now perform Auto Repair The Thecus NAS will backup up to five versions of the system configuration either by the default timing of 1 00am every day automatically or as scheduled by the user This unique Auto Repair will be triggered if the primary DOM has a booting issue In this instance the 2 DOM will take over the boot function Then the system will automatical
104. ese ports choose LAN2 from the System Network menu and the LAN2 Configuration screen appears Press Apply to save your changes LAN Configuration MAC Address 00 14 FD 14 D6 95 Jumbo Frame Disabld w Select from drop down list or input manually allow 1501 9000 SES Support IP 192 168 2 254 Netmask 255 255 255 0 Link Detected no Link Speed r DHCP Server Configuration DHCP Server Enable Disable Start IP End IP Gateway DNS Server 172 16 66 244 Apply LAN2 Configuration Item J Description Netmask Netmask Specifies the Network Mask of the LAN2 interface Gateway When Thecus NAS as a DHCP server from LAN2 it can have another route to balance traffic bandwidth for its DHCP clients Specifies the LAN2 port link status Specifies the LAN2 port link speed Before enabling Jumbo Frame Support please make sure your network equipment supports Jumbo Frame If your equipment is incompatible you might not be able to connect to your Thecus IP storage If the IP sharing mode setting is set to Enable under WAN LAN1 port then this 2 gateway cannot be configured 70 DHCP Server Configuration A DHCP server can be configured to assign IP addresses to devices connected to the LAN2 port To configure these ports choose LAN2 from the System Network menu DHCP Configuration DHCP Server Enabl
105. eset to Factory Default screen appears Press Apply to reset Thecus IP storagefactory default settings 160 Problems with Time and Date Settings The administrator is able to select an NTP Server to keep Thecus IP storage time synchronized However if Thecus IP storage can not access the Internet you may encounter a problem when setting the Time and Time Zone If this happens 1 Login to the Web Administration Interface 2 Navigate to System Management gt Time 3 Under NTP Server select No 4 Set the Date Time and Time Zone 5 Click Apply In addition if Thecus IP storage is able to access the Internet and you want to keep the NTP Server clock isc org by default please make sure the DNS Server is correctly entered thereby allowing the NTP Server name to correctly resolve See System Network gt WAN LANI1 gt DNS Server Dual DOM Supports for Dual Protection The most advance and useful of Thecus IP storage depend on models is Dual DOM implemented In the normal circumstance it has no need to have this feature involved But with irresistible cause like power cut or human error by accident occurred especially during system booting stage this will become the great feature to prevent system down time Practically while it happened system will try to recovery the DOM 1 from DOM 2 first If it is unachievable then system can boot from DOM 2 And all of this procedure can be operated by LCM The Dual DOM in DOM1 is
106. etected b Click to start E NA NA N A NA NA Total Capacity 1430820 MB Disk Power Management Disk Power Management OFF v Minute Apply Disks Information Item Description Z o Indicates the status of the disk Can read OK Warning or Failed Bad Block scan Yes to start scan Bad Block Total Capacity Shows the total SATA hard disk capacity Disk Power The administrator can set the disk to power down after a period of Management inactivity When the Status shows Warning it usually means there are bad sectors on the hard disk It is shown only as a precaution and you should consider changing the drives S M A R T Information On the Disks Information screen the status of each disk will be displayed in the Status column Clicking on an OK or Warning link will display the S M A R T Information window for that particular disk You may also perform disk SMART test simply to click Test to start with The result is only for reference and system will not take any action from its result 72 SMART INFO E Info l X Tray Humber 5 v DC V D2002FYPS U Power Un ours Hours Temperature Cebius 35 Test Test Type 9 short 2 long Test Result Click to start Test Time za S M A R T Information Power ON Hours Count of hours in power on state The raw value of this attribute shows total count of hours or minutes or seconds depending on manufacturer in power on state Realloc
107. etting up an Nsync Target on an Thecus IP storage Nsync Device On the Nsync target server the administrator of that server has to set up a user account with a folder named nsync and grant write access 1 On the Nsync server add a user for Nsync source ex nsyncsource1 For instructions on how to add a user on the Thecus IP storage see Chapter 4 User and Groups Authentication Local User Configuration Add Users 2 On the Nsync server grant that user ex nsyncsource1 write access to the nsync folder For instructions on how to set up a folder s ACL see Chapter 4 Starage Management Shore Folder Folder Access Control List ACL 3 Once this is done the target server will start accepting Nsync tasks from server using that ID and password Setting Up an Nsync Target on another Device other than Thecus IP storage If you selected Legacy FTP Server when setting up your Nsync task the Thecus IP storage will use the FTP protocol to back up the share folder On the external storage device make sure there is a folder named nsync and the Auth ID has writable permission in that folder Designating Thecus IP storage as an Nsync Target 128 The Thecus IP storage can act as an Nsync server enabling another Nsync equipped Thecus NAS at a remote location backup their files to this Thecus IP storage From the System Network menu choose the Nsync Target item and the Nsync Target Server screen appears Nsync Target S
108. ew A Redundant Array of Independent Disks RAID is an array of several hard disks that provide data security and high performance A RAID system accesses several hard disks simultaneously which improves I O performance over a single hard disk Data security is enhanced by a RAID since data loss due to a hard disk failure is minimized by regenerating redundant data from the other RAID hard disks Benefits RAID improves I O performance and increases data security through fault tolerance and redundant data storage Improved Performance RAID provides access to several hard disk drives simultaneously which greatly increases I O performance Data Security Hard disk drive failure unfortunately is a common occurrence A RAID helps prevent against the loss of data due to hard disk failure A RAID offers additional hard disk drives that can avert data loss from a hard disk drive failure If a hard drive fails the RAID volume can regenerate data from the data and parity stored on its other hard disk drives RAID Levels The Thecus IP storage supports standard RAID levels 0 1 5 6 10 and JBOD You choose a RAID level when you create a system volume The factors for selecting a RAID level are e Your requirements for performance e Your need for data security e Number of hard disk drives in the system capacity of hard disk drives in the system The following is a description of each RAID level RAID O RAID O0 is best suited fo
109. ey should replace those disks as soon as possible 73 Bad Block Scan On the Disks Information screen you may also perform disk bad block scan simply to click Click to start to start with The result is only for reference and system will not take any action from its result Disks Information Disk Mo Capacity MB Model Firmware Status Bad Block Scan 1 1 907 729 WDC V D2002FYPS 0 04 0 DR DK b Check to start 2 1 907 729 WDC WD2002FYPS 0 04 0 BR OK b lekto start 3 1 807 728 WDC WD2002FYPS 0 04 0 oe Warning b Click to start 4 1 807 729 WDC WwD2O0 2FYPS 0 04 0 ar OK P Clck to start J 1 907 729 WDC VD2002FYPS 0 04 0 ie OK b Check to start 1 907 729 WDC WO2002FYPS 0 04 0 ip OK bk hick to start 7 1 807 729 WDC WD2002FYPS5 0 04 0 GR OK P Click to start A 1 507 729 WDC WD2002FYPS 04 0 Ge OK F Click to start Total Capacity 15261832 MB The testing result will be default RAID Information From the Storage menu appears stay till system reboot with Yet to start displayed as choose the RAID item and the RAID Information screen This screen lists the RAID volumes currently residing on the Thecus IP storage From this screen you can get information about the status of your RAID volumes as well as the capacities allocated for data and iSCSI There is also a graph which represents how the RAID volume is currently allocated RAID Information 9o gp Edit Mas RAID RAID E Level Situs e RAID 5 Health
110. figuration Screen tick the checkbox of the hard disk you wish to designate as a Spare disk 2 Click Add Spare The disk will be configured as a spare disk The system automatically rebuilds the spare disk when one of the disks in the RAID set fails Remote Administration You can set up your Thecus IP storage for remote administration With remote administration you can access your Thecus IP storage over the Internet even if your Thecus IP storage is behind a router This is especially useful if you are traveling and suddenly need a file from your Thecus IP storage Setting up remote administration is a three part process and will require the following equipment Thecus IP storage device Cable DSL Router with Dynamic DNS support Home PC Internet Connection Router setup will differ slightly depending on router used For this example we will use the Asus WL500g because it has support for Dynamic DNS Contact your router hardware vendor for setup help 157 Part Setup a DynDNS Account 1 Goto http www dyndns org from your home PC 2 Click on the Sign Up Now link 3 Check the Check boxes select a user name i e N8800 enter your email address i e xxx example com check Enable Wildcard and create a password i e xxxx 4 Wait for an email from www dyndns org 5 Open the email and click on the link to activate your account Part Il Enable DDNS on the Router 1 Go to the router setup screen and
111. file name extensions will be skipped and not back up to the destination Comments If you wish enter comments here for your records 2 To schedule the task to run at regular intervals click on the Schedule icon for that task You can schedule the task to run Monthly or Weekly 3 To check the log for that task click on the Log icon for that task Thecus Backup Utility also supports MAC OS X Just copy the Thecus Backup Utility dmg to your MAC OS X machine and double click to execute it Windows XP Data Backup If you use Windows XP Professional you can also use the Windows Backup Utility Ntbackup exe to backup your files If you use Windows XP Home Edition follow these steps to install the utility 1 Insert the Windows XP CD into a drive and double click the CD icon in My Computer 2 When the Welcome to Microsoft Windows XP screen appears click Perform Additional Tasks 3 Click Browse this CD 4 In Windows Explorer navigate to ValueAdd gt Msft gt Ntbackup 5 Double click Ntbackup msi to install the backup utility Once installed you can use the Windows Backup Utility by following the steps below 133 1 Click Start and point to All Programs gt Accessories gt System Tools gt Backup to start the wizard 2 Click Next to skip past the opening page Choose Backup files and settings from the second page and then click Next 3 Select which option you want to back up 4 Click Next and in th
112. for noncommercial distribution and only if you received the program in object code or executable form with such an offer in accord with Subsection b above The source code for a work means the preferred form of the work for making modifications to it For an executable work complete source code means all the source code for all modules it contains plus any associated interface definition files plus the scripts used to control compilation and installation of the executable However as a special exception the source code distributed need not include anything that is normally distributed in either source or binary form with the major components compiler kernel and so on of the operating system on which the executable runs unless that component itself accompanies the executable If distribution of executable or object code is made by offering access to copy from a designated place then offering equivalent access to copy the source code from the same place counts as distribution of the source code even though third parties are not compelled to copy the source along with the object code 188 You may not copy modify sublicense or distribute the Program except as expressly provided under this License Any attempt otherwise to copy modify sublicense or distribute the Program is void and will automatically terminate your rights under this License However parties who have received copies or rights from you under this License will no
113. formation accounts passwords printers computers network information and other data Microsoft calls Active Directory a namespace where names can be resolved ADS Benefits ADS lets Thecus IP storage integrate itself with the existing ADS in an office environment This means the Thecus IP storage is able to recognize your office users and passwords on the ADS server Other major benefits ADS support provides include 1 Easy integration of Thecus IP storage into the existing office IT infrastructure The Thecus IP storage acts as a member of the ADS This feature Significantly lowers the overhead of the system administrator For example corporate security policies and user privileges on an ADS server can be enforced automatically on Thecus IP storage 2 Centralized user password database The Thecus IP storage does not maintain its own copy of the user password database This avoids data inconsistency between Thecus IP storage and other servers For example without ADS support an administrator might need to remove a specific user privilege on Thecus IP storage and each individual server With ADS support the change on an ADS server is known to all of its ADS members 184 Appendix D Licensing Information Overview This product included copyrighted third party software licensed under the terms of GNU General Public License Please see THE GNU General Public License for extra terms and conditions of this license Source Cod
114. g correctly or to see troubleshooting information for the printer print a test page 139 UPS Setting The Thecus IP storage can also support various uninterruptible power supply unit via either Serial or USB interface depend on model to provide extra data security and accessibility in the case of a power failure From the Status menu choose the UPS item and the UPS Setting screen appears Make any changes you wish and press Apply to confirm changes UPS Setting UPS montornn C Enable Disable Manufacture v Model a means the product has been tested for Compatibility Battery Status WA Power NA Seconds between power failure and first notification i 5 Seconds between subsequence power failure notifications Z Shutdown the svstem when the batterv charge 1s less than 3 Apply See the following table for a detailed description of each item UPS Setting tem X Descipion Model Choose the UPS model number from the dropdowns Battery Status Current status of the UPS battery UPS first notification seconds failure notifications Amount of UPS battery remaining before system battery charge is less than should auto shutdown Apply Press Apply to save your changes 140 Chapter 5 Using Thecus IP Storage Overview Once the Thecus IP storage is setup and operating users on the network may manage all varieties of digital music photos or f
115. has less HDD supported can refer web UI while RAID migration operated 82 Below is a table listing of possible RAID migration schemes RAID 1 HDDx2 to RAID 5 HDDx3 RAID 1 HDDx2 to RAID 5 HDDx4 RAID 1 HDDx2 to RAID 5 HDDx5 RAID 1 HDDx2 to RAID 5 HDDx6 RAID 1 HDDx2 to RAID 5 HDDx7 RAID 1 HDDx2 to RAID 5 HDDx8 HDDx16 RAID 1 HDDx3 to RAID 5 HDDx4 RAID 1 HDDx3 to RAID 5 HDDx5 RAID 1 HDDx3 to RAID 5 HDDx6 RAID 1 HDDx3 to RAID 5 HDDx7 RAID 1 HDDx3 to RAID 5 HDDx8 HDDx16 RAID 1 HDDx4 to RAID 5 HDDx5 RAID 1 HDDx4 to RAID 5 HDDx6 RAID 1 HDDx4 to RAID 5 HDDx7 RAID 1 HDDx4 to RAID 5 HDDx8 HDDx16 RAID 1 HDDx5 to RAID 5 HDDx6 RAID 1 HDDx5 to RAID 5 HDDx7 RAID 1 HDDx5 to RAID 5 HDDx8 HDDx16 RAID 1 HDDx6 to RAID 5 HDDx7 RAID 1 HDDx6 to RAID 5 HDDx8 HDDx16 RAID 1 HDDx7 to RAID 5 HDDx8 HDDx16 RAID 5 HDDx3 to RAID 5 HDDx4 RAID 5 HDDx3 to RAID 5 HDDx5 RAID 5 HDDx3 to RAID 5 HDDx6 RAID 5 HDDx3 to RAID 5 HDDx7 RAID 5 HDDx3 to RAID 5 HDDx8 HDDx16 RAID 5 HDDx4 to RAID 5 HDDx5 RAID 5 HDDx4 to RAID 5 HDDx6 RAID 5 HDDx4 to RAID 5 HDDx7 RAID 5 HDDx4 to RAID 5 HDDx8 HDDx16 RAID 5 HDDx5 to RAID 5 HDDx6 RAID 5 HDDx5 to RAID 5 HDDx7 RAID 5 HDDx5 to RAID 5 HDDx8 HDDx16 RAID 5 HDDx6 to RAID 5 HDDx7 RAID 5 HDDx6 to RAID 5 HDDx8 HDDx16 RAID 6 HDDx7 to RAID 6 HDDx8 HDDx16 83 D uc ae RAID 6
116. have appropriate access right on that target If the files on your Thecus IP storage are lost for any reason you can restore those files from the target Thecus IP storage To backup files regularly you can set up a 126 scheduled task to run only once daily weekly or monthly You can also limit the bandwidth of your Nsync tasks so other users on the network can share the bandwidth equally Under the Backup menu click Nsync and the Nsync window appears Nevne QU Add Pedi a Restore amp Del EJ Task name Server Share Folder Last Time Last Status Schedule Action Bandwidth Setting pv Below is a description of each field Item J Description o Click to delete an Nsync task Backup files on Nsync target is also deleted Nsync Task name Action Administrator can run or stop an Nsync task by pressing the action button Bandwidth Setting Bandwidth control on Nsync tasks Add Nsync Task From the Nsync screen click Add to display the Add Nsync Task screen Nsync x Add Nsync Task Tast name Meve tak 1 Target Server Manufacturer imi HAS C Legacy FTP Serer C1 Hatke Bayne Servet Hoye Mode i Synchronize Compare source and target then delete unexist files C3 Incremental Copy fle from source to tanget Target Server IF address Share Folder niswebesta E Authorged Usemame on Target Server Password on Target Server Test Connection Schedule Enable Dexa
117. he customer if the product fails within the warranty period and under normal usage Thecus Technology Corporation is not responsible for any damage or loss of data deemed to be caused by its products It is highly recommended that users conduct necessary back up practices Safety Warnings For your safety please read and follow the following safety warnings PN PN P b b Read this manual thoroughly before attempting to set up your Thecus IP storage Your Thecus IP storage is a complicated electronic device DO NOT attempt to repair it under any circumstances In the case of malfunction turn off the power immediately and have it repaired at a qualified service center Contact your vendor for details DO NOT allow anything to rest on the power cord and DO NOT place the power cord in an area where it can be stepped on Carefully place connecting cables to avoid stepping or tripping on them Your Thecus IP storage can operate normally under temperatures between 5 C and 40 C with relative humidity of 20 85 Using Thecus IP storage under extreme environmental conditions could damage the unit Ensure that the Thecus IP storage is provided with the correct supply voltage AC 100V 240V 50 60 Hz Plugging the Thecus IP storage to an incorrect power source could damage the unit Do NOT expose Thecus IP storage to dampness dust or corrosive liquids Do NOT place Thecus IP storage on any uneven surfaces DO NOT place Thecus IP
118. he name implies disks are merely concatenated together end to beginning so they appear to be a single large disk As the data on JBOD is not protected one drive failure could result total data loss 182 Stripe Size The length of the data segments being written across multiple hard disks Data is written in stripes across the multiple hard disks of a RAID Since multiple disks are accessed at the same time disk striping enhances performance The stripes can vary in size Disk Usage When all disks are of the same size and used in RAID Thecus IP storage disk usage percentage is listed below RAID Level RAID O Percentage Used 100 1 n x 100 n 1 n x 100 RAID 1 RAID 5 RAID 10 50 RAID 50 n 1 n x 100 RAID 60 JBOD n HDD number n 2 n x 100 100 RAID 6 n 2 n x 100 183 Appendix C Active Directory Basics Overview With Windows 2000 Microsoft introduced Active Directory ADS which is a large database information store Prior to Active Directory the Windows OS could not store additional information in its domain database Active Directory also solved the problem of locating resources which previously relied on Network Neighborhood and was slow Managing users and groups were among other issues Active Directory solved What is Active Directory Active Directory was built as a scalable extensible directory service that was designed to meet corporate needs A repository for storing user in
119. hy l3 ge 0 6 GB 852 7 GB 46 4 GB Volume Allocation List iSCSI Target iSCSI Thin Provision Target Advance Option 4 amp Add t Modify Expand Delete ir is mame Tvpe Capacity iSCSI iscsi10 46 4 GB Space Allocation X All data in the volume will be removed as well Are you sure 2 Press YES All data in the volume will be removed ISCSI Thin Provisioning With this function the iSCSI capacity can be more flexible and more efficiently serve more users The idea for iSCSI thin provisioning is sharing the available physical capacity to a number of iSCSI target volumes and also setup virtual capacity to expand the physical size while it needed To setup iSCSI thin provisioning go to Space Allocation under the Storage category The iSCSI thin provisioning volume needs to be created first Simply click iSCSI Thin Provision Target You can refer the screen shot below 89 Space Allocation RAID Information Master RAID z Disks Total Data iSCSI ID Status x a RAID Level Used Capacity Capacity Capacity RAID 0 Healthy 1 2 219 8 0 2 GB 84 8 GB 70 GB Volume Allocation List T MM MS f iSCSI Target iSCSI Thin Privision Target Advance Option iSCSI Thin Privizion Volume Qaa Type Name Capacity Next setup the physical capacity for iSCSI thin provision volume by dragging the Allocation bar to the desired
120. ic RAIDI ext3 yes iTunes music J BONNY RAIDI ext3 ves Snap Snapshot configuration If added folder has located in the RAID volume with ZFS file system then the folder management screen with Snap button will be configurable Snapshot List for msyne 172 16 66 39 anapzhot X Snapshot Schedule o Tale Shot 9 Remove Snapshot Date Snapshot Take Shot Click to take snapshot right away Click to remove snapshot schedule Schedule Click to open snapshot schedule setup screen Clicking on schedule button then schedule setup screen appear Checked the enable check box to activate the snapshot scheduled operation 107 Snapshot List for navne 172 16 66 39 2napchor X Snapshot Schedule Enabled Snapshot Schedule _ Automatically remove oldest snapshot Schedule Rule Monthly Day 0 Hour The Thecus IP storage snapshot is supported total 16 versions Once checked Automatically remove oldest snapshot the oldest will be removed to let newest to added on top Otherwise if the check box is unchecked and snapshot versions are up to 16 then system will appear warning message and won t execute the task till available version count The snapshot schedule rules can be setup for monthly weekly or daily Clicking on Apply after firmed with desired schedule These taken snapshot is only accessible though CIFS SMB by manually type NAS IP address snapshot and invisible from
121. ile Thecus 01 without assign mounting name system automatically has folder Thecus 01 created 102 3 WF naswebsite 0755 N5200 NEWUI 172 16 66 40 ERO WEG WEO PHBE IAM H Av Q t 8 Q 7 F y O88 HX Ee WALD 2 W72166640waswebee o EE B RBAX CHE a al ACS 6xxx re Adobe Acrobat 7 0 Pro ind AMCC D maT ea Q ROS BIEPEDCRE HBS M AMD Andy Private ut Andy Weekly Report 4 N5200 NEWUI 172 16 66 40 SHE bl ATOM GJ Besttech GT CJ BT Seed gt fib a dez Es 0T D mx WO 105250 KB WS 105290 KB RSIS S HERE EAS gH x Share Folder From the Storage menu choose Share Folder and the Folder screen appears This screen allows you to create and configure folders on the Thecus IP storage volume Folder Gadd pect remove Des arar ES ci Fol er name gt gt Quota Limit K AID ID File System Publie t Emyn RAID ext3 no t Ej usbhdd ias RAD ext3 no t GQjusbeopy is RAID ext3 ne t C maswebsite ic RAID ext3 yes t Gj NAS Module Source ias RAID ext3 ves t Bonny is RAID ext3 yes DE Module Folder ias RAID exti yas 4 n gt Adding Folders On the Folder screen press the Add button and the Add Folder screen appears This screen allows you to add a folder After entering the information press Apply to create new folder 103 Folder r r Zu Quota Limit RAID ID File System Public RAID ext nc LAID ext nc RAID ext nc RAID axt 2 RAID ext y RAI
122. iles by simply using their web browsers To manage your personal files or access public files on the Thecus IP storage just enter its IP address into your browser default IP address is http 192 168 1 100 and you will be taken to the Thecus IP storage Login page Before proceeding make sure that WebDisk Support or Secure WebDisk Support is enabled in the Service Support screen in the system s Network menu See Service Support in Chapter 4 Network Service gt HTTP Web Disk Login Page To login to the system enter your user name and password and select Web Disk or Photo server then click Login to log into the system You will be taken to the selected interface Th s Thecus Creator in Storage Login mode switch button To proper browser web page we recommend to use IE7 Firefox Safari Chrome or Opera rotect vour source Secure vou Data Using the Web Disk Does not apply to the 3X series Web Disk Thecus IP storage provide a Web Disk function that allows you to access the system over the Internet from any browser 141 E In the Login page type in the User ID and password that were previously set for you in the Accounts menu See Chapter 4 User and Group Authentication Local User Configuration The Web Disk page appears showing folders currently available to you this is controlled via the Access Control List ACL Click on a folder name to enter the folder The folder s page appears displ
123. ill list in task list 175 Step 3 Manually edit or run your backup tasks After selecting apply you will be brought back to the Rsync Schedule Backup task list Rsync Schedule Backup Add zsEdt Del E Task name Source Folder Schedule Target Server Path Last Time Last Status Action 5 andy andy andy1 andy2 Disable 192 168 0 102 and 2011 11 06 In progress L Marow pr andy3 pm Enable 192 168 0 102 and j Simply click the arrow on the Action section to start the task and click the box to cancel the ongoing task If any setting needs to be changed for task tick the check box in front of associated task then press Edit button to bring up the screen The S sign in each task is denoted Synchronize and I is denoted Incremental for backup mode of associate task ACL Backup and Restore The ACL backup and restore feature are allowed system ACL Access Control List been backup on RAID volume based to other location and restore it while needed Let s take example to see how it works There is system with RAID volume RAID select Backup to backup this RAID volume s ACL to other location The current RAID volume RAID has share folder as listed on right hand screen shot Home gt Backup gt ACL Backup Restore C Hel Shared Folders ACL Backup Restore ACL Service amp Backup C Restore Wadd e T S Folder name gt gt
124. ink e Blinking green network activity e Solid green network link e Blinking green network activity currently inaccessible USB disks and USB printers 5 Power Button e Power on off 1U4600 e Solid blue Device is powered on e Blinking blue eSATA hard disk is connected and active 6 Reset Button e Resets the 1U4600 e Press for five seconds during boot process to reset IP address and admin password e Locks are provided for added security 8 LCD Display e Displays current system status and warning messages e Displays hostname WAN LAN1 LAN2 IP address RAID status and current time 10 Down Button v 11 Enter Button 1 12 Escape Button ESC 19 N8200XXX NS80O0 series The Thecus N8200XXX N8800 series front panel has the device s controls indicators and hard disk trays 7 8910 j 4 d Au I TTL Ae YYIL Front Panel 1 Power Button e Power on off N8200XXX N8800 2 Power LED e Solid green System is power on 4 System fan alarm e Solid red system fan failure notification LED 5 Mute button Mute the system fan alarm 3 Reboot Button e Press to system reboot 6 USB Port USB 2 0 port for compatible USB devices such as USB disks USB printers 7 Up Button A e Push to scroll up when using the LCD display 8 Down Button W e Push to enter USB copy operation screen 9 Enter Button 1 e Push to enter LCD operate password for basic system setting 10 Escape Button e Push to leave the current LCD me
125. ion Browseable Gi yes Fino The Export share name will become the network share name and displayed through network access such as SMB You may refer the figures below to see the result Please note the naming limitation Add iSCSI Target Add Stack Target X Enable iSCSI Target Enable 7 Disable Stackable Tarzet IP 172 16 5 en M E ign ign 2O0 6 com thecus aaaaiscsil velabed M Username Password Description Brovwseable ves nc Public Cy yes no 96 From the figure above the Export share name is pmmeeting The figures below show the result before and after via Microsoft Network Access with settings have been completed P 172 16 66 186 B AE RR RBA ICAM AH QOQ O B Pe pm Gg ED Y w72 16 66 186 EIE Ga v Ej 2 j is Tf 4 cami x N y FT s nsync S usbcopy 4 VideoTest LoS msetltoSR 2 He BAKe HRABE HERA UA HIA 2 BERT WWASER re gu RLETI am EOE UPnP EE AYA x60IBM T 172 16 66 186 SRE HE RR RBA TA HAH O X se ax iu Ribs gh Thecus q RARIS G fitt ESR No Stack Target DER Stack target with export BRE ED E 472 16 66 186 share name pmmeeting Es C ERFIN Sis Tit 2 sis E neos Q SERA ASEM Airset UA SENSE BAE 3 sA gy TRLLD FSRBSENS am eae UPnP eS MEn Ribs gh Thecus 4 KAES G Ai y Axi Oy MRTE a VideoTest Lo I tpsetbRDINU
126. ion and sharing between Windows SMB CIFS UNIX Linux and Apple OS X environments The Thecus IP storage s user friendly GUI supports multiple Languages Product Highlights File Server First and foremost the Thecus IP storage allows you to store and share files over an IP network With a Network Attached Storage NAS device you can centralize your files and share them easily over your network With the easy to use web based interface users on your network can access these files in a snap To learn about the Web User Interface go to Chapter 5 Using the Thecus IP Storage gt Using WebDisk FTP Server With the built in FTP Server friends clients and customers can upload and download files to your Thecus IP storage over the Internet with their favorite FTP programs You can create user accounts so that only authorized users have access To set up the FTP Server refer to Chapter 4 System Administration gt Network service FTP iTunes Server With the built in iTunes server capability the Thecus IP storage enables digital music to be shared and played anywhere on the network To set up the iTunes Server refer to Chapter 4 Application Server gt iTunes Configuration Backup Server Don t leave precious data to chance With advanced backup capabilities you can easily upload mission critical files to the Thecus IP storage and even automate your backup tasks for true peace of mind To find out how to backup your files w
127. irectory Must input the complete file name Ld new file Directory Creates a new folder or directory iX delete Deletes selected files or folders ia Rename Rename a directory or file show Directories Show the files and folders in the directory Search files in the directory You can only input some word string Owner of the file There is also the way by using right click button to i Directory Tree a ae bring up contact windows as short cut to operate what you needed 3E Tunes music utes atesti A New File Directory Au Reload PA Cancel 143 Photo Server Does not apply to the 3X series photo server Using the Photo Server users can view and share photos and even create their own albums right on the Thecus IP storage You will see your own photo gallery and all public photo albums on the network To manage any picture files you must first select the item by clicking the box then entering your user name and password to log in to the photo server T is Thecus Creator in Storage i MARALIN EOST Phoios abin s album TES Protect sc Secure Data Windows XP Publishing Wizard There are many ways for a local user to upload pictures into their photo album Users of Windows XP can upload their pictures using the Windows XP Publishing Wizard 1 Click on the XP Publishing Wizard icon on top right core 2 The XP Web Publishing Wizard Client screen appears Click on
128. isable amp Enable Disable Time Type amp Daily E Weekly Monthly Fill out all the necessary details and choose your parameters Add Rsync Backup Task Description This is how it will appear in the task list Descript the task details Backup Mode Synchronization mode Makes your source match your target completely deleting and adding files on your target as they are deleted and added on your source Incremental Mode Makes your source match your target and keep all old files adding files on your target as they are added on your source but NOT deleting files on your target as they are deleted on your source NAS that you wish to backup Target Server Port Input the Rsync Target Server IP address which you are going to backup over port number has no need to change only if the default port number has been used in other purpose Destination Path Input existed Rsync target server share folder path to Sub folder backup source over The sub folder may left blank if it is not apply User name and This is the username and password need to fill in for Password associate Rsync Target Server that you are going to copy data over executed If there is an error review the instructions and make sure all necessary fields has filled correctly Schedule To run Rsync backup manually please choose Disable or Enable the schedule to execute the Rsync task This saves your Rsync backup task and w
129. istrator to remotely turn on the system without even leaving their own seat To schedule system on and off refer to Chapter 4 System Management gt Scheduled Power On Off Package Contents The Thecus IP storage should contain the following common items e System Unit x1 QIG Quick Installation Guide x1 CD Title x3 Acronics backup CD Twonky media server CD amp Universal CD Ethernet Cable x1 Accessory bag x1 HDD Compatibility list Card x1 Multiple Languages Warranty Card x1 Power cord x1 Your N3200XXX package should contain additional items e 3 5 HDD rail x6 Power Adaptor Power cord x1 Your N0503 package should contain additional items e 3 to5 HDD cage xi Installed e 3 5 HDD rail x6 Power Adaptor Power cord x1 Your N4200 series package should contain additional items e Power adapter Power cordx1 Your N5500 package should contain additional items e USB Cable A B Type x1 Your 1U4200XXX package should contain additional items e Power Cord B 1U4200XXXRx1 Your 1U4600 package should contain additional items e Power Cord B 1U4600Rx1 e USB Cable A B Type x1 Your N8800 N8200XXX series package should contain additional items e Power Cord x1 Please check to see if your package is complete If you find that some items are missing contact your dealer 10 Front Panel N2200XXX The Thecus N2200XXX s front panel has the device s controls indicators and hard disk trays O N o
130. it to other physical drives or change the RAID array all together To migrate a RAID 0 RAID 1 RAID 5 or RAID 6 volume follow the steps below 1 From the RAID Configuration screen click Migrate RAID 2 A list of possible RAID migration configurations will be listed Select the desired migration scheme and click Apply 3 The system will begin migrating the RAID volume 81 sk No Capacky MB Model Status used Avaliable Disk 1 907 729 1 907 729 1 807 729 2 3 4 1 907 729 5 1 907 729 6 1 907 729 RAID 1 RAID 0 Offine ORAD 6 gt RAID 6 Orine E RAD 1 RAD S Onine WDC WD2002 OK ral J s WRC VgD2002 OK Ie WDC veD2002 Viammng O O WDC WD2002 OK WDC V D2002 OK 1 c WDC WD2002 OK i r1 RAID Levet CY RAID 0 gt RAID 0 Offine O RAD 1 RAID 6 Onine i fea MER fn N pf Ve pl arsed ar P erp n 5 offing RAID 5 gt RAID 5 rine Migrating a RAID volume could take several hours to complete With RAID level migration function the limitation as listed below 1 During RAID level migration it is not allowed reboot or shutdown system 2 The RAID migration from R1 to R5 or R1 to R6 the all services will restart and volumes iSCSI is read only but user data is capable read write during operation The migration scheme below is based on Thecus IP Storage series products in maximum possible combination The other model which
131. item follows NFS Server Setting Item J Description o NFS Enable or Disable NFS support Apply Click Apply to save your changes FTP Thecus IP storage can act as a FTP server enabling users to download and upload files with their favorite FTP programs From the Network Service menu choose the FTP item and the FTP screen appears You can change any of these items and press Apply to confirm your settings FIP Enable Disable secure FTP Explicit Enable 9 Disable Port 2 Passive Port Range 30000 32000 3000 FIP ENCODE h Allow Anonymous FTP Access pw Auto Rename Upload Bandwidth Download Bandwidth ies A description of each item follows FTP Enable FTP Service on Thecus IP storage has also security FTP setting enabled non standard port Passive Port Range limited port range for the FTP server to use 30000 32000 FTP ENCODE If your FTP client or operating system does not support Unicode e g Windows 95 98 ME or MAC OS9 8 select the same encoding as your OS here in order to properly view the files and directories on the server Available options are BIG5 HZ GB2312 GB18030 ISO EUC JP SHIFT JIS and UTF 8 Allow Anonymous FTP Upload Download Allow anonymous FTP users to upload or 121 Access download files to from public folders Download Allow anonymous FTP users to download files from public folders No access Block anonymous FTP user access Aut
132. ith the Thecus IP storage refer to Chapter 4 Backup gt Nsync Does not apply to the 3x series Printer Server With the Thecus IP storage s Printer Server you can easily share an IPP printer with other PCs connected to your network To set up the Printer Server refer to Chapter 4 External Device gt Printer Information Multiple RAID Thecus IP storage supports multiple RAID volumes on one system So you can create RAID O for your non critical data and create RAID 1 5 or 6 depend on model for mission critical data Create the RAID levels depending on your needs To configure RAID modes on the Thecus IP storage refer to Chapter 4 Storage Management gt RAID Information ISCSI Capability Thecus IP storage is not only a file server but it also supports iSCSI initiators Your server can access Thecus IP storage as a direct attached storage over the LAN or Internet There is no easier way to expand the capacity of your current application servers All the storage needs can be centrally managed and deployed This brings ultimate flexibility to users To set up an iSCSI volume refer to Chapter 4 Storage Management gt Space Allocation gt Allocating Space for ISCSI Volume Superior Power Management Thecus IP storage supports schedule power on off With this feature administrator can set at what time to turn on or off the system This feature is a big plus for people who want to conserve energy Wake On LAN enables admin
133. k Thecus website for the latest firmware release and release notes e Downgrading firmware is not permitted Do not turns off the system during the firmware upgrade process This will lead to a catastrophic result that may render the system inoperable WARNING eSave old firmware images and system configuration files before upgrading firmware in case the system needs it later on The backup files can will be stored on a USB disk if available or in the nsync folder on your RAID partition The backup will take approximately 3 5 minutes to complete before carrying on with the firmware upgrade Schedule Power On Off Using the Thecus IP storage System Management you can save energy and money by scheduling the Thecus IP storage to turn itself on and off during certain times of the day From the menu choose the Schedule Power On Off item and the Schedule Power On Off screen appears To designate a schedule for the Thecus IP storage to turn on and off first enable the feature by checking the Enable Schedule Power On Off checkbox Then simply choose an on and off time for each day of the week that you would like to designate a schedule by using the various dropdowns Finally click Apply to save your changes 62 On Off Schedule Enable Scheduled On Off Action Time Action Time Sunday v v v v Monday v v v v Tuesdav v v v v Wednesday v v S Thursday v v v v Friday v v v v Saturday v v v v Apply Exam
134. lick to log out of Web Administration Interface System Information Information provides viewing on current Product info System Status Service Status and Logs The menu bar allows you to see various aspects of the Thecus IP storage From here you can discover the status of the Thecus IP storage and also other details d Svstem Information General c m 4 statis Ly System Log Online Registration Syslog Management General Information Once you login you will first see the basic Product Information screen providing Manufacturer Product No Firmware Version and System Up Time information Product Information Manufacturer Thecus Product No N4200PRO Firmware Version 5 00 00 15 Up Time 3 hours 8 minutes Item Description gt System Service Status N3200XXX N0503 N4100PRO NA4200series N5200XXX N5500 1U4200 XXX 1U4600 N7700 series N2200XXX N8200XXX N8800 series From the Status menu choose the System item System Status and Service Status screens appear These screens provide basic system and service status information 56 System Status CPU Activity 0 CPU Fan Speed OK System Fan 1 Speed OK Up Time 3 hours 10 minutes Service Status AFP Status Stopped NFS Status Stopped SMB CIFS Status Running FTP Status Stopped TFTP Status Stopped Nsync Status Running UPnP Status Stopped SNMP Status Stopped System Status Item Description
135. list 2 Choose your backup mode Synchronization mode Makes your source match your target completely deleting and adding files on your target as they are deleted and added on your source Incremental Mode Makes your source match your target and keep all old files adding files on your target as they are added on your source but NOT deleting files on your target as they are deleted on your source 3 Choose your source folder s These are the folders on your source NAS that you wish to backup 131 4 Input your target s IP address and port number This is the NAS which you are going to use as a backup port number is optional 5 Input your destination folder and create a backup folder Your destination path is the name of an existing folder on your NAS where you wish to backup your 6 Input your username and password This is the username and password you set in Rsync Target on your target NAS 7 Choose a folder to keep your backup log in This lists all the changes during each backup in a single file 8 Test your connection If there is an error review the instructions and make sure you didn t miss a step 9 Enable or disable regular automatic backups To run backups manually choose disable your settings will still be saved 10 Apply This saves your backup task in the Rsync Schedule Backup task list running your automatic backup tasks in the background as well as allowing you to easily edit or m
136. llation click I Agree and then click Next 153 Software Update Installation Wizard License Agreement Please read the following license agreement To continue with setup you must accept the agreement END USER LICENSE AGREEMENT FOR MICROSOFT SOFTWARE Microsoft iSCSI Initiator 2 0 IMPORTANT PLEASE READ THIS END USER LICENSE AGREEMENT EULA CAREFULLY BY INSTALLING COPYING OR OTHERWISE USING THE SOFTWARE THAT 3 C Do Not Agree Print lt Back Cancel 6 The iSCSI Initiator will now install automatically Click Finish once completed Software Update Installation Wizard Completing the Microsoft iSCSI Initiator Installation Wizard You have successfully completed the iscsi200 Setup Wizard To close this wizard click Finish 7 Start the iSCSI Initiator by double clicking its icon on the desktop The iSCSI Initiator properties window will appear Microsoft iSCSI Initiator 8 Select the Discovery tab Under Target Portals click Add iSCSI Initiator Properties Target Portals Address Part Adapter IP Addr ISNS Servers Name 9 Enter the IP address of Thecus IP storage Click OK 154 Add Target Portal Type the IP address or DNS name and socket number of the portal you want to add Click Advanced to select specific settings For the discovery session to the portal IP address or DNS name Port MICE OK IAA GO 3260 10 On the iSCSI Initi
137. llowing table for a detailed description of each item Change Administrator and LCD Entry Password Description New Password Type in a new administrator password Confirm Password Type the new password again to confirm Apply Press this to save your changes Config Mgmt From the menu choose the Config Mgmt item and the System Configuration Download Upload screen appears From here you can download or upload stored system configurations System Configuration Download Upload Upload Please choose a file to upload See the following table for a detailed description of each item System Configuration Download Upload Item _ _ Description Save and export the current system configuration Upload Import a saved configuration file to overwrite current system configuration Backing up your system configuration is a great way to ensure that you can revert to a working configuration when you are experimenting with new system settings The system configuration you have backup can be only restore in same firmware version And the backup details have excluded user group accounts 64 Factory default From the menu choose the Factory Default item and the Reset to Factory Default screen appears Press Apply to reset Thecus IP storage to factory default settings Reset To Factory Default Resetting to factory defaults will not erase the data stored in the hard disks but WILL revert all the settings
138. lock sze while more than 2TB capacity wil be configured in Windows XP Please use 512 Bytes block sre for application lke VMware etc 2 Modify your setting Press ok to change 87 Expand Volume The iSCSI volume is now able to expand its capacity from unused space From the volume list simply select the iSCSI volume you like to expand and click the Expand button Space Allocation RAID Information Master Ib RAID Status Disks Total Data iSCSI RAID Level ised Capacity Capacity Capacity T RAID J Healthy 1 23 Bo 0 6 GB 852 7 GB 46 4 GB Volume Allocation List iSCSI Target SCS Thin Provision Target Advance Option QD Add 23 Modify Delete Type Marne Capacity iSCSI iscsil 46 4 GB You will then see the dialog box displayed below Drag the Expand Capacity bar to the size you want Then press Expand to confirm the operation Space Allocation x Expand 18 C51 Thin Privizion Volume Name iscsi Unused 34 74 38 GB Expand Capacity 714 38 GB Description The I3C3I services will be stoped during ISCST expand execution please be noticed Delete Volume To delete volume on the current RAID volume follow the steps below 1 Under the Volume Allocation List click Delete The Space Allocation screen appears 88 Space Allocation RAID Information Master ID RAID ctatus Disks Total Data iSCSI RAID Level Used Capacity Capacity Capacity T RAID 5 Healt
139. ly load the most recent system configuration backup image to repair the primary DOM 129 r Dual DOM Schedule Backup v Enable Disable Dual DOM schedule backup Auto 7 Daily pw Weekly Y v Cy Mo nthly wt w Status Dual DOM Backup Status lask Name Date Firmware Rsync Target Server BS Backup JS Cual DOW Backup 15 3sync Target i sync When it comes to backing up your data it s very important to have flexibility Rsync Backup provides you with many options including local or remote backup backup scheduling different syncronization settings and password protection Being based on the Linux operating system it is also much more stable and experiences much less frequent data loss during transfer than other remote backup systems For this tutorial you will need to use Rsync Target Step 1 and Rsync Step 2 3 under Backup Step 1 Enabling Rsync on your target backup NAS Log in to your target backup NAS through the UI in your web browser Go to Rsync Target under Backup in the menu of the UI Home gt Backup gt Rsync Target Rsync Setting Rsync Target Server Enable Disable Username Password Apply 1 Enable Rsync Target Server 2 Add a username and password they can be different than your NAS s username and password 3 Select Apply 130 Now Rsync is turned on on your NAS which means it can be used as a target for Rsync backup in other words only the backu
140. n 35 OVervVIGW iuvickivixksksETARMEMRERENNFREREKERERERIRERERIRIRKRENRRMNRKEREREFERERERERRERR RR RERERMES 35 Before You Begln ieiiak kaa au nna un RR RC CODE OECD GO M CR Gn E RC ROC CRT CR 35 Cable Connections sciori acra s baa s wa ba cic e ni Roni D CR b ba aja Oei ri Rb eC AREE 35 Checking SVSLem tdbuSasecsspocEEREEERT VEREAMER EE REISPEPEDIPEMOERERRTVERVAMA VARI 37 System Status NOFMadl ssepe ac idc PERI nes A VA Nicki Ei Ep OA o ba dat 37 SVSter TEOBIDIG sso V uiuis Co uta ca sce vos uad ui utin Ca an da duco cO UOS VUE UP 37 Chapter 3 First Time Setup ssiiisccsdvecseantaacsiscnsiercucsnncdedumeceuaisacs 43 e I BRULAVATRIRTETTTITIDIDOICILLTLTILRMOCTTTTPRUEURMCUEMMMT 43 Thecus Setup Wizard suse anu A UL KraREX ELEC EE FXeva eVA E AME dm FERE OF Fa Fa caa KR 43 LCD Operation NA4100PRO N5200XXX N5500 1U4200XXX 1U4600 N7700 series NaG200 XXX N8900 SeFl6S esinsin kaniin c Rura e Du 45 LCD Operation N3200XXX NO0503 eee rn nnn rnm 47 OLED Operation NA4200 serles iesessossasssssskusrECREREREEsEERREREEREREEEREEMENEEENEEREEE 48 Typical Setup PFOCGGULFe iiiseuksaun is ain GOD OO KGISP GRRGOR REG RO Gon GO KG oe 49 Chapter 4 System Administration eere 51 linc Ew w e M a 51 Web Administration Interface ee eeee eee nnn nnn 51 MY gie mirc c PER 52 MENU Baf ECCE UU I UM 54 Misizizreisicl rslgc e ren casa tetm A enue weeaaaN 55
141. n has enabled then while login to the system the modules will have associated icon to allow all of valid users to login through fai USB eSATA Usb_eSATA Schedule Backup Module 162 UI Login Configuration Adjusts UI Login Configuration settings you can enable disable the Web Disk Photo Server and modules functions according to your needs For the 3X series users need to install the photo server module or web disk module to access these functions UI Login Functions Web Disk Enable Disable Photo Server Enable Disable Module Enable Disable Share Folder From the Storage menu choose Share Folder and the Folder screen appears This screen allows you to create and configure folders on the Thecus IP storage volume Shared Folders e raEdit x9 Remove amba 3napshot 25 239 Add Edit R NFS Samb at AGL Folder name gt gt Quota Limit RAID ID File System Public gt ng nsync RAID xfs no gt E usin mi AID xfs no bhdd RAID f b ing usbcopy a RAID xfs no E naswebsite RAID xfs yes iTunes music AID xfs yes iT RAID f 23 Module Folder RAID xfs yes b MAS Module Source _ UD xfs yes 2 NAS Module 5 RAID f gt Dandy eu RAID xfs no gt Jandyl ER RAID xfs na Adding Folders On the Folder screen press the Add button and the Add Folder screen appears This screen allows you to add a folder After entering the information press Apply to create new folder
142. n that column and has that level of access to the folder Continue selecting groups and users and assigning them access levels using the column buttons To remove a group or user from an access level column press the Remove button in that column When you are finished press Apply to confirm your ACL settings If one user has belonged to more than one group but different privilege than the priority Deny gt Read Only gt Writable To setup sub folders ACL click on symbol to extract sub folders list as screen shot shows below You may carry on with same steps as share level ACL setting 109 Folder P poe pm 1 in T QJ Add Ed Gd Ramove Lop NFS Lop US ACL Fplder name RAID ID Fie System Public Description D Darne aasa exti no naync gt Butha aaa ext yes usbhdd b Sj usbeopy aaaa ext nao usbcopy b D aareebsite aaaB ext no naswebsite b La iTunes eme CEEI exti yes Teiss musit D E teat aaas ext yes A 7j uati CEEE exti na b LIECEK na b Lj NatBench na NOTE The ACL can be set for share and sub folders level not for files The ACL screen also allows you to search for a particular user To do this follow the steps below 1 In the blank enter the name of the user you would like to find 2 From the drop down select the group you would like to search for the user in 3 Click Search Local Groups W job Search Local Users Local Groups Local Users The system will list up to 1 00
143. nce Online A e Not Installed Usb eSATA Backup 1 0 1 Schedule backup utility Online amp Not Installed Raid Replication 1 0 0 Duplication for created R Online 8 gl Not Installed Twonkymedia 1 0 0 Media server in DLNA Online amp Not Installed DLM2 1 0 19 HITPFIPBTI Muled Online amp e Not Installed MySQL 5 1 00 02 MySQL database Online ig Not Installed webserver 1 0 4 Web Server Online amp Not Installed USBCopy 1 03 USB copy module in two Online ling Not Installed Rsync Backup 1 0 2 Rsync backup Online The other way to have auto module installed is using universal CD shipped with system It has contained file modules zip which included all modules while system shipped Please refer the screenshot below The modules list getting on line of Thecus website will newly than thecus zip from shipped CD But the installation from Thecus website could have unpredictable duration due to bandwidth concern 125 Home gt Application Server gt Aute Module Installation Help My favorite OL Shutdown Logout Module Package CAMfakepathimodules zip E Upload Rescan Module Source List Installed Name Version Description Locatior Document ction Not Installed DLM2 Download Manager Disk amp Bd x ev tInstalled IP Cam IP Cam Disk amp B x t Installed Mail Server Servet Disk amp mj x t Installed SQL QL 5 description Disk Bd x t Installed NZBGet NZBGet Disk im x t Installed Raid Repli
144. nitiator User name ign 1991 05 com microsoft thecus 2c1 tb4b4 thecus Target secret C Perform mutual authentication To use mutual CHAP specify an initiator secret on the Initiator Settings page and configure that secret on the target 12 Right click My Computer on the desktop and select Manage 3 Desktop a My Documents gu p x A TEE Collapse E ae AITE Explore we ATA Open cH Sw FAT3 Search ok DDE gj see publid Map Network Drive 5 Ea Faeo Disconnect Network Drive L Dr Cont Delete E 4 My Netwe Rename T Recycle E Properties 13 Click on Disk Management and you will see a new hard disk listed EI Computer Management Im File Action View Window Help e ome Aas m Computer Management Local Volume File System Status lil System Tools EJAITEXP2 C Partition Basic Healthy System 4 89 GB fil Event Viewer i Partition Basic Healthy 64 75 GB E Shared Folders Partition Basic Healthy 4 88 GB Local Users and Groups t E Performance Logs and Alerts x Device Manager eu Storage Removable Storage Disk Defragmenter e Disk Management Services and Applications pP amp Disk 0 Basic AITEXP2 C DATA D FAT32 G 74 53 GB 4 89 GB NTFS 64 75 GB NTFS 4 89 GB FAT32 Online Healthy System Healthy Healthy Disk 1 H M1 Unknown 69 59 GB 69 59 GB Not Initialized Unallocated cS C
145. ns e To prevent system errors Thecus IP storage sets the following limitations on photo files e Each file upload is limited to a size of 8MB Files exceeding 8MB will NOT be uploaded and no error message will appear e Only these photo file types will be uploaded jpg gif bmp png pcx psd bmp e If duplicate file names exist during upload process system will add a number in front of the original file name abc gt 1abc Creating Albums To create a photo album follow the steps below 1 Click the Add button to create a new album 2 Enter a name for the album and enter a description if you wish Then click on the Create Album button Password Protecting Albums If you would like to put a password on a particular album follow these steps 1 Select the album to be protected click on the Edit button and the Album Edit screen will appear 2 The owner of the album can enter an album password to protect the album so that only people with the correct password can view the album Uploading Pictures to Albums Uploading pictures to albums using the Web User Interface is easy 1 When the album is created click the album icon to enter the album Initially the album is empty 2 Click the Add button to upload pictures into the album The Upload Photos screen will appear Users can select and upload up to 8 pictures at a time 3 Oncethe picture is uploaded you can view it in the album The owner of the alb
146. nu ESC 20 Hard Disk Trays 1U4200XXX N2200XXX N8200XXX Each of above mentioned models hard disk trays has a lock a latch and two LED indicators Hard Disk E tem Description O Z O 0 O 1 HDD Power LED e Solid blue Hard disk is powered on 2 HDD e Blinking green System is accessing data on the hard disk Access Error LED e Solid red HDD fail e Use the lock to physically secure the hard disk to the unit 4 Latch e Use to open and remove or close and secure the tray 5 Handle e Pull to remove the HDD tray 1U4600 N7700 series NS8800series Each of mentioned above models hard disk trays has a lock a latch and two LED indicators Hard Disk Trays Item Description O 1 0 0 O 1 HDD Power LED e Solid blue Hard disk is powered on 2 HDD e Blinking green System is accessing data on the hard disk Access Error LED e Solid red HDD fail e Use the lock to physically secure the hard disk to the unit 4 Latch e Use to open and remove or close and secure the tray 5 Handle e Pull to remove the HDD tray 21 N4100PRO The N4100PRO s hard disk trays each have a lock a latch and two indicators HDD Power Lock Accessi Error Description e The tray lock lets you physically secure the HDD with accessory keys e Use the latch to open and remove or close and secure the tray HDD Power LED e Solid blue HDD is powered on Access Error LED e Blinking yellow data is being
147. o Rename If checked the system will automatically rename files that are uploaded with a duplicate file name The renaming scheme is filename where represents an integer You may set the maximum bandwidth allocated to file uploads Selections include Unlimited 1 2 4 8 16 and 32 MB s Download Bandwidth You may set the maximum bandwidth allocated to file downloads Selections include Unlimited 1 2 4 8 16 and 32 MB s To access the share folder on Thecus IP storage use the appropriate user login and password set up on the Users page Access control to each share folder is set up on the ACL page Storage Management gt Shore Folder gt ACL TFTP Thecus IP storage can act as a TFTP Server enabling users to download and upload files with their favorite TFTP programs From the Network Service menu choose the TFTP item and the TFTP screen appears You can change any of these items and press Apply to confirm your settings IFIP IFTE Enable Disable Port Share Folder The folder 5 not found among the list Folder Permission IF Read mesos Enable TFTP Service on the Thecus IP storage Checked WAN LAN1 or LAN2 to enable port use Specifies the port number of an incoming connection on a non standard port Share Folder Select the file stored folder it can not be empty Folder Permission Select the folder permission HTTP Web Disk From the Network Service menu choose the HTTP Web
148. oad Upload Samba CIFS There are options allow Admin to Enable Disable to operate Thecus IP storage associated with Samba CIFS protocol With the option changed it will need to reboot system to activate 168 Samba CIFS Samba Service Enable Disable File Access Cache Enable Disable Samba Anonymous Login Authentication Enable Disable Samba Native Mode Yes Native Mode No Compatible Mode Optimize Block Size Enable 5 Disable Windows Server Backup to NAS Folder backup File level Full backup Block level Server Signing Auto Mandatory Disable Samba Service Used for letting the operating system of UNIX series and SMB CIFS of Microsoft Windows operating system Server Message Block Common Internet File System Do the link in network protocol Enable or Disable SMB CIFS protocol for Windows Apple Unix drive mapping NOTE e In some environments due to security concerns you may wish to disable SMB CIFS as a precaution against computer viruses File Access Cache File Access Cache is default Enable This option will help to increase the performance while single client access share folder in writing under SMB CIFS protocol Samba Anonymous Login Authentication To enable this option no matter there is share folder has been created in public access The user account and password is needed from system to access under SMB CIFS protocol On the other hand no m
149. ols 3353 8 63 iSCSI Thin Pririzion Dads QPMest E Delete iSCSI target volume creation The maximum virtual size is 14300GB 16000GB 1700GB 1 iSCSI target volume Space Allocation Create 13 51 Thin Pririzion RAID ID RAID Urused 18 4 333 28 GB 14300CB Vertual Bize aT 2543 GB SCSI Target Volsnte 7 Enable E Disable Target Name Linitx0 3 a z inn Year 2009 iw This screenshot lists iSCSI target volumes created under thin provisioning The 2 4 iSCSI target volume under thin provisioning has been created with a capacity of 14300GB 92 18C SI Thin Privizion Volume ray a T lt EPExpand ie Dalate ive Mama Lapacity ACAI Thien 2 recon Volome ACSI Then Seacuson Valse 333 3 GS iSCSI Thin Privizion QUAS quM GB Delete Tepe Nam Capacity BCH Thin Previon ass303601 1700 GB SUSI Thun Preesseon 2554036007 14300 C3 This message appears if there is no more room for new iSCSI target creation Space Allocation x Not enough fre space to alocata E takes at least GB free space to alipcate CSLUS volume Each RAID volume can only create one iSCSI thin provision volume Each thin provision volume can only create 5 iSCSI target volumes The notification will send out while the physical size of iSCSI thin provision capacity has used up to 90 Advance Option There are 2 options is currently allow Admin to Enable Disable to ope
150. on 5 USB Port e USB 2 0 port for compatible USB devices such as USB disks and USB printers 6 System Fan e System fan that exhausts heat from the unit 7 Power Connector e Connect the included power cord to this connector 30 1U4200XXXR Power Connector Power Connector Power Switch Power Switch USB Ports Type LON2 Port Power LED Power LED System Fan eSATA Port Serial Port WAN ZLANL Port Locator LED 1U4200 Back Panel eSATA Port e eSATA port for high speed storage expansion cameras USB disks and USB printers switch or router 1U4200XXXS The rear panel of the 1U4200XXXS is similar to the 1U4200XXXR but with a single power connector Power Connector Power Switch USB Ports Type LAN2 Port System Fan eSATA Part Serial Part WAMN LAN1 Port Locator LED 31 1U4600R The rear panel of the 1U4600R houses most of the USB and Ethernet connections as well as the eSATA port system fan and power connector See the table below for descriptions of each Power Connector Power Connector Power Switch Power Switch USB Ports A Type LAN2 Port Power LED Power LED System Fan eSATA Port Serial Port USB Ports B Type WAN LAN1 Port 1U4600 Back Panel eSATA Port e eSATA port for high speed storage expansion cameras USB disks and USB printers switch or router e Connect the included power cords to these connectors 1U4600S The rear panel of the 1U4600S is similar to the 1U4600R but
151. onnect to the Photo Web Server 8 Select Thecus IP storage Photo Gallery Wizard to publish your pictures to Thecus IP storage Web Publishing Wizard Where do you want to publish these files Select a service provider to host your Web site If you do not have a membership account one will be created for you Service providers MSN Groups Share your files with others or store them for your personal use N8800 Photo Gallery N8800 N8800 Photo Gallery Vizard 9 Login into Thecus IP storage with your local user name and password 146 Web Publishing Wizard N8800 Photo Gallery Wizard Powered by THECUS Please input ID and Password ID Password Welcome to Thecus Thecus Technology Corp 10 Create your album by entering an album name and clicking on the Create Album button Web Publishing Wizard N8800 Photo Gallery Wizard Powered by THECUS Service On Gallery Album name _ ay Welcome to Thecus Deste Albom Thecus Technology Corp 11 Select the album you want to upload your pictures to 12 Confirm the target album Web Publishing Wizard N8800 Photo Gallery Wizard Powered by THECUS The selected Album is user album Are you sure publish photos into the Album Welcome to Thecus Thecus Technology Corp 13 Windows will show you that the picture upload is in progress 147 Web Publishing Wizard Please wait while your files are copi
152. ont control panel OLED Controls Icon Function Description A Up Button Select the previous configuration settings option v Down Button USB copy confirmation display 4 Enter Enter the selected menu option sub menu or parameter setting ESC Escape Escape and return to the previous menu There are two modes of operation for the OLED Display Mode and Management Mode Display Mode During normal operation the OLED will be in Display Mode Display Mode Item Description 1 1 0 0 O Host Name WAN LAN1 LAN2 Link Aggregation CPU Fan 2009 05 22 12 00 The N4200 series will rotate these messages every one two seconds on the OLED display 48 Typical Setup Procedure From the Web Administration Interface you can begin to setup your Thecus IP storage for use on your network Setting up the Thecus IP storage typically follows the five steps outlined below For more on how to use the Web Administration Interface see Chapter 4 Web Administration Interface Step 1 Network Setup From the Web Administration Interface you can configure the network settings of the Thecus IP storage for your network You can access the Network menu from the menu bar For details on how to configure your network settings refer to Chapter 4 System Network Step 2 RAID Creation Next administrators can configure their preferred RAID setting and build their RAID volume You can access RAID settings from the menu bar of the
153. or high speed storage expansion 27 N5200XXX The N5200XXX rear panel features ports and connectors Back Panel Item switch or a router switch or router 3 Serial Port e This port is for an external UPS device 4 eSATA Port e eSATA port for high speed external storage expansion 5 USB Port e USB 2 0 port for compatible USB devices such as USB disks and USB printers 6 System Fan e System fan that exhausts heat from the unit 7 Power Connector e Connect the included power cord to this connector 28 N5500 The N5500 rear panel features ports and connectors I E y 0008 as Qe f TIL 4 5 Back Panel Item ipti switch or router switch or router 3 Serial Port e This port is for external UPS device 4 eSATA Port e eSATA port for high speed storage expansion 5 USB Port Type A e USB 2 0 port for compatible USB devices such as USB disks and USB printers 6 System Fan e System fan that exhausts heat from the unit 7 Power Connector e Connect the included power cord to this connector 8 USB Port Type B USB 2 0 port to connect PC Type B of target mode 29 N7700 series The N7700 rear panel features ports and connectors Back Panel Item Description Z switch or router switch or router 3 Serial Port e This port is for an external UPS device 4 eSATA Port e eSATA port for high speed storage expansi
154. ore anonymous login is allowed Samba is Native mode The Thecus IP storage is supported Samba mode options In the ADS environment with Native mode selected then Thecus IP storage is capable to become local master position Optimize Block Size This function controls the behavior of Samba when reporting available disk space This function was added to allow advanced administrators to increase block size to increase write performance without re compiling the code Disabled 4k Enabled 256k Windows Server Backup to NAS The Windows Server 2008 has built in backup solution If the backup source is whole Windows system please choose Full backup otherwise Folder backup Server Signing This is setting while Samba server has been used in US of FDCC If the system has used only in Windows environment choose Mandatory otherwise Auto 169 Samba CIFS Options for Mac O5 X Allocated buffering size Enable Disable UNIX Extensions Enable Disable Hide Temporary Files Enable Disable Allocated Buffering Size This parameter allows an administrator to adjust the size of the buffer dedicated to Samba clients The default size of 2GB generally results in improved Samba client performance However Mac OS X may incorrectly display file sizes under 2GB UNIX Extension The default is enable for Samba usage with situation using Mac OSX with smb connection may have permission issue When it h
155. ormation screen Using Edit RAID you can select RAID ID and the Spare Disk RAID Configuration Ix RAID Information Expand Migrate RAID Edit Disk Ma Capacity MB Model Status Lise Spare 1 476 940 WOC WD5S00346B Or 2 476 940 WOC WD5S00346 Or 3 476 940 WOC WDS0034B Or 4 Mia N A M A RAID Level BGI ID Fi RAID ID RAID K plow 079 asz Asz v Master RAID Take effect after checked box Encryption Password Allow 1 18 characters Confirm Password Quick Raid Enable this setting to enhance RAID creation time if there is no partition existed inside of hard disk Stripe SizetkB w Data Percentage File Syster E v erm RAID Configuration I x 9 All current active services will be stopped when operation is in progress Are you sure to update setting now No 79 RAID Configuration X RAID Infomation update Successfully AJ Remove RAID Click to remove the RAID volume All user data and iSCSI has been created in selected RAID volume will be removed To remove a RAID volume follow the steps below 1 On the RAID List screen select the RAID volume by clicking on its radio button and click RAID Information to open the RAID Configuration screen 2 On the RAID Configuration screen click Remove RAID 3 The confirmation screen appear you will have to input Yes with exactly wording case to complete Remove RAID operation RAID Configuration x
156. ot account will have full access to this share root root 165 Guest system root account will be mapped to anonymous user nobody nogroup on NAS All user on guest system will be mapped to anonymous user nobody nogroup on NAS Choose the one which best fits your needs Sync Async Choose to determine the data Sync at once or Async in arranged batch To choose Async could have better throughput but risky if system getting trouble like power cut may loose the data which still in memory buffer and not yet write to disk Apply Click to save your changes Samba Configuration On the Folder screen press the Samba button and the Samba Configuration screen appears This screen allows you to setup samba configuration for associated folder After entering the information press Apply to activate input settings Shared Folders Add z Edit B Remove NFS snapshot EA ACL Folder name gt gt Quota Limt RAID ID File System Public gt D nsync ES RAID xfs no gt Jusbhdd E RAID xfs no Jusbcopy as RAID xfs no gt naswebsite RAID xfs yes t JiTunes music its RAID xfs yes J Module Folder RAID xfs yes gt _NAS Module Source RAID xfs yes Dandy RAID xfs no gt Dandyl PS RAID xfs no Samba Configuration X Folder name Description Browseable Add Folder Item Description O Z O Z OoOo O Folder Name Enter the name of the folder Provide a description for
157. ou may not distribute the Program at all For example if a patent license would not permit royalty free redistribution of the Program by all those who receive copies directly or indirectly through you then the only way you could satisfy both it and this License would be to refrain entirely from distribution of the Program If any portion of this section is held invalid or unenforceable under any particular circumstance the balance of the section is intended to apply and the section as a whole is intended to apply in other circumstances It is not the purpose of this section to induce you to infringe any patents or other property right claims or to contest validity of any such claims this section has the sole purpose of protecting the integrity of the free software distribution system which is implemented by public license practices Many people have made generous contributions to the wide range of software distributed through that system in reliance on consistent application of that system it is up to the author donor to decide if he or she is willing to distribute software through any other system and a licensee cannot impose that choice This section is intended to make thoroughly clear what is believed to be a consequence of the rest of this License If the distribution and or use of the Program is restricted in certain countries either by patents or by copyrighted interfaces the original copyright holder who places the Program under this
158. p NAS needs to be activated in this Way Rsync Step 2 Setting up your backup task and schedule on your source NAS Log in to your other NAS your source NAS through the UI in your web browser Go to Rsync Backup under Backup in the menu of the UI From the Rsync Schedule Backup task list choose Add OAdd Modify ODelete Rsync Schedule Backup Task Description multimedia backup Backup Mode 2 9 Synchronize Compare source and target then delete unexist files Incremental Copy file from source to target usbcopy naswebsite samba P2P DownLoad shared iTunes music music 4 5 photos n movies Y Target Server Port 172 16 64 144 Destination path Subfolder B public multimedia Please click Shift or Ctrl button and click mouse left button to select multiple folder or remove selected folder e Please fill in the destination path to select a specific backup folder on the target side e You may leave it empty to have the files automatically backup to the existing folder on the target side Please make sure there are existing folders with the same name on both target and client side Username adminl Password 6 sss 8 Schedule Enable Disable Enabled Disabled 9 o2 1 00 1 Daily 9 Weekly Monthly Sunday Apply 1 0 Back Fill out all the necessary details and choose your parameters 1 Name your task This is how it will appear in the task
159. par Add Nsync Task Task Name The name of your Nsync task Target Server Select replication to method it has 3 options can choose from 127 Manufacturer NAS To other Thecus IP storage with security tunnel build up Legacy FTP To the 3 party FTP server or Thecus IP storage while it has acted as FTP server Native Rsync Server Using rsync to replicate data to other Thecus IP storage Nsync Mode Synchronize mode or Incremental mode Target Server IP The IP address of your target server Address Source Folder The share folder you want to backup Authorized Username The account name on the target server on Target Server Password on Target The password for the username on the target server Server Test Connection Click to check the connection to the Target Server Schedule Enable or Disable schedule backup of your share folders The time when the Nsync task will run Type Select whether to run the Nsync task daily weekly or monthly Daily input the time of day to execute Nsync task Weekly input which day of the week to execute the task Monthly decide which day of the month to execute the task Press Add to submit your settings Before starting an Nsync Task make sure the target server s Nsync Server or FTP Server is enabled Using Native Rsync Server to backup data to other Thecus NAS devices needs to enable target server and setup a valid username and password to grant access permission S
160. ple Monday On 8 00 Off 16 00 System will turn on at 8 00 AM on Monday and off at 16 00 on Monday System will turn on for the rest of the week If you choose an on time but do not assign an off time the system will turn on and remain on until a scheduled off time is reached or if the unit is shutdown manually Example Monday On 8 00 System will turn on at 8 00 AM on Monday and will not shut down unless powered down manually You may also choose two on times or two off times on a particular day and the system will act accordingly Example Monday Off 8 00 Off 16 00 System will turn off at 8 00 AM on Monday System will turn off at 16 00 PM on Monday if it was on If the system was already off at 16 00 PM on Monday system will stay off Administrator password From the menu choose the Administrator Password item and the Change Administrator Password screen appears Enter a new password in the New Password box and confirm your new password in the Confirm Password box Press Apply to confirm password changes There is also password for enter LCD setting you could setup here Enter a new password in the New Password box and confirm your new password in the Confirm Password box Press Apply to confirm password changes 63 Change Administrator Password New Password Confirm Password Apply Change OLED Display Password New Password Confirm Password Apply See the fo
161. ply to confirm any modifications Once changes are applied the associated information will be updated on the Stack Target List window D Stack Target ACL If the stack target Public setting set to Yes then the ACL button will be grayed out However if Public setting is set to No then the ACL button will be available for you to setup user access permissions for the stack target ACL settings will be exactly the same as system folder that you may have setup previously ACL setting x Recursive Deny Read Only Writable Local Groups v DP Search users rmm 99 E Reconnect a Stack Target The enabled stack target devices may be disconnected by situations such as power outages or network disconnects When this happens the Reconnect button will available To attempt to reconnect the stack target click Reconnect Stack Target List Oas GEL QRemove gt Export share name IP Capacity UsedTotal Status Description ign icai 172 1665157 0GB 0 1GB Disable ign 2009 05 cor Stack Target List 4 AA IEA gt a y Reconnect Acc J EO Lemove P Keconnect P tatus Description ign Export share name IP Capacity Used Total sta tsest 172 16 65 157 0GB 0 1 GB Disable iqn 2008 05 co Success i You have successfully reconnect to the stack folder iscsi ISO Mount The ISO Mount feature is very useful tool from Thecus products With it users can mount an ISO file and having export name to display all de
162. protected socket 3 Press the power button on the Front Panel to boot up the N4200 To connect the N5200XXX N5500 to your network follow the steps below 1 Connect an Ethernet cable from your network to the WAN LAN1 port on the back panel of the Nb200XXX N5500 ey 2 Connect the provided power cord into the universal power socket on the back panel Plug the other end of the cord into a surge protected socket Press the power supply switch to turn on the power supply 38 To connect the 1U4200XXX 1U4600 to your network follow the steps below 1 Connect an Ethernet cable from your network to the WAN LAN1 port on the back panel of the 1U4200XXX 1U4600 2 Connect the provided power cord into the universal power socket on the back panel Plug the other end of the cord into a surge protected socket Press the power supply switch to turn on the power supply If you are installing the 1U4200XXXR 1U4600R be sure to connect both power cables If you do not the system will assume one power supply has failed and an alarm will sound 39 3 Press the power button on the front panel to boot up the 1U4200XXX 1U4600 To connect N7700 series NAS to your network follow the steps below 1 Connectan Ethernet cable from your network to the WAN LAN1 port on the back panel of the N7700 2 Connect the provided power cord into the universal power socket on the back panel Plug the other end of the
163. ps below 152 Windows 2000 XP 1 First download the iSCSI Initiator from the Microsoft website http www microsoft com You can find this software by entering iSCSI Initiator into the search box on their homepage 2 Once the download is complete install the iSCSI Initiator by double clicking the EXE file You may be presented with the following security warning Click Run to continue Open File Security Warning Do you want to run this file Name Initiator 2 04 build3273 x86fre exe Publisher Microsoft Corporation Type Application From U JohniisCsi Cancel potentially harm your computer Only run software from publishers y While files from the Internet can be useful this file type can you trust What s the risk 3 You will now install the iSCSI Initiator using the Setup Wizard Click Next to continue Software Update Installation Wizard Use this wizard to install the following software update Microsoft iSCSI Initiator Before you install this update we recommend that you Back up your system Close all open programs You might need to restart your computer after you complete this update To continue click Next Software Update Installation Wizard Microsoft iSCSI Initiator Installation Microsoft iSCSI Initiator will be installed Installation Options 7 i M Software Initiator pa r lt Back Cancel 5 Read the license agreement To continue with the insta
164. ption am RAID Information Display the status of created RAID volume Click D to go to RAID information page as short cut Disks Information Display the status of disks installed in the a system Click to go to Disk information page as P short cut Display system FAN Status Click to go to System Status page as short cut Green The system is connected to the Internet Red The system is unable to connect to the Internet EJ Web Disk Photos News Log Language i Help My favorite r Shutdown Logout e Web Disk Click this to log into the Web Disk e Photos Click this to log into the photo server News Accesses online registration and the latest release news e Log Accesses the system log New logs will be displayed with an icon here Language Selection The Thecus IP storage supports multiple Languages including English Japanese Traditional Chinese Simplified Chinese French German Italian Korean Spanish Russia Polish Portugal On the menu bar click Language and the selection list appears This user interface will switch to selected Language for Thecus IP storage Help Click this to toggle the help page open and browse or search through the UI help database The current page s help section will be displayed first My Favorite Add Remove the current page from the Home page 55 Shutdown Choose Shutdown or Reboot from the dropdown menu to shutdown or reboot your NAS e Logout C
165. r Password prompt will show on the LCD At this time the administrator has to enter the correct LCD password System will check whether the correct LCD password has been entered The default LCD password is 0000 If correct password is entered you will enter into the Management Mode menu Management Mode Item Description Change Admin Passwd Change administrator s password for LCD operation Reset to Default Reset system to factory defaults Exit Management Mode and return to Display Mode 46 You can also change your LCD password using the Web Administration Interface by navigating to System Management gt Administrator Password For more on the Web Administration Interface see Chapter 4 System Management LCD Operation N3200XXX N0503 LCD Controls Use the Down V Up A Enter J and Escape ESC keys to operate LCD to view system information and USB copy The following table illustrates the keys on the front control panel LCD Controls Icon Function Description v Down Button Select the previous configuration settings option A Up Button Select the next configuration settings option 4 Enter Enter to display USB copy operation ESC Escape Escape to give up USB copy Press and hold for 3 seconds to turn off the LCD s backlight Press any button to switch the backlight back on Display Mode During normal operation the LCD will be in Display Mode Display Mode tem Description Cu
166. r applications that need high bandwidth but do not require a high level of data security The RAID O0 level provides the best performance of all the RAID levels but it does not provide data redundancy RAID O uses disk striping and breaking up data into blocks to write across all hard drives in the volume The system can then use multiple hard drives for faster read and write The stripe size parameter that was set when the RAID was created determines the size of each block No parity calculations complicate the write operation RAID 1 RAID 1 mirrors all data from one hard disk drive to a second one hard disk drive thus providing complete data redundancy However the cost of data storage capacity is doubled 181 This is excellent for complete data security RAID 5 RAID 5 offers data security and it is best suited for networks that perform many small I O transactions at the same time as well as applications that require data security such as office automation and online customer service Use it also for applications with high read requests but low write requests RAID 5 includes disk striping at the byte level and parity information is written to several hard disk drives If a hard disk fails the system uses parity stored on each of the other hard disks to recreate all missing information RAID 6 RAID 6 is essentially an extension of RAID level 5 which allows for additional fault tolerance by using a second independent distribute
167. rate Thecus IP storage associated with iSCSI setting The details as listed in following screenshot With the option changed it will need to reboot system to activate Space Allocation RAID Information Master ID RAID Status Disks Total Data iSCSI RAID Level Used Capacity Capacity Capacity t RAID 5 Healthy 1 2 3 927 7 0 6 GB 852 7 GB 46 4 GB Volume Allocation List iSCSI Target iSCSI Thin Provision Targgt Advance Option Add Modify 9 Expand Delete Tvpe Mame Capacity iSCSI iscsi10 46 4 GB 93 Space Allocation X e The setting has been changed carry on with press Yes for confirmation Space Allocation X i iSCSI block size have setting success iSCSI Block Size Select the block size with 4K while the iSCSI volume size is over 2TB iSCSI CRC Checksum To enable this option the initiator can connect with Data digest and Header digest enabled CAC Checksum Data digest Header digest Stackable NAS The Thecus IP storage s capacity can be expanded even further using the stackable function With it users can expand the capacity of their network storage systems up to 5 other stack target volumes which are located in different systems These can be stacked through single network access like SMB or AFP acting as a share folder type Stackable Config to act as Stack Master Available target device from 1U4500 N5200 PRO Capacity Expansion HUB Switch Can connect total 5
168. read it carefully to prevent damaging your unit during installation Before You Begin Before you begin be sure to take the following precautions 1 Read and understand the Safety Warnings outlined in the beginning of the manual 2 If possible wear an anti static wrist strap during installation to prevent static discharge from damaging the sensitive electronic components on the Thecus IP storage 3 Be careful not to use magnetized screwdrivers around the Thecus IP storage s electronic components Cable Connections To connect the N2200XXX to your network follow the steps below 1 Connect an Ethernet cable from your network to the WAN LAN1 port on the back panel of the N2200XXX 2 Connect the provided power cord into the power socket on the back panel Plug the other end of the cord into a surge protected socket 35 3 Press the power button to boot up the N2200XXX To connect the N3200XXX N0503 to your network follow the steps below 1 Connect an Ethernet cable from your network to the WAN LAN1 port on the back panel of the N3200XXX NO503 2 Connect the provided power cord into the power socket on the back panel Plug the other end of the cord into a surge protected socket 36 3 Open the front door then press the power button to boot up the N3200XXX NO503 ST sss GE amm PT Make the following connections on the Thecus N4100PRO and then power up the unit 1 Connect an Ethernet
169. rrent host name of the system Current WAN LANI IP setting Current LAN2 IP setting Current RAID status Current system fan status Current system temperature Current system date and time The system power on time since last start The N3200XXX N0503 will rotate these messages every three seconds on the LCD display If the RAID array is in a degraded state the LCD display will be stopped in display mode and show which disk is degraded in the array RAID Degraded Disk USB Copy The USB Copy function enables you to copy files stored on USB devices such as USB disks and digital cameras to the N3200XXX NO0503 with a press of a button To use USB copy follow the steps below 1 Plug your USB device into an available USB port on the Front Panel 2 In Display Mode press the Enter 1 3 The LCD will display USB Copy 47 4 Press Enter J and theN3200XXX NO503 will start copying USB disks connected to the front USB port The LCD will display the USB copy progress and results OLED Operation N4200 series OLED Operation The mentioned models above are equipped with an OLED on the front for easy status display and setup There are four buttons on the front panel to control the OLED functions OLED Controls Use the Up A Down V Enter J and Escape ESC keys to select various configuration settings and menu options for N4200series configuration The following table illustrates the keys on the fr
170. rsaRnCEF RSE AMAA FEN EM EPSSEEE SEM RNSANEREFIZRNEEEESENMAQIP FE D ESEDSME EE EEE 184 What is Active Directory iis aa yi Co an GRO CKCR RC SCR CCRC DG RECTE RIDGE RR RC RE Wl a 184 ADS BenellEs ssi eun idR ER ra ch GbR aa tren 184 Appendix D Licensing Information eere 185 e SW C TE NUNTIUS CIE 185 Source Code Availability eeeeeeeeeeee 185 CGIC License T6rims ouo uaesuesoEeME EE EFE FEEMIMN UEM EE EE REF N DEED IE MESE UMEN MEE 186 GNU General Public License nne ohnnnhuuuhuuuuuuuuuuuuuuuuuRuRAR RR 186 Chapter 1 Introduction Overview Thank you for choosing the Thecus IP Storage Server The Thecus IP storage is an easy to use storage server that allows a dedicated approach to storing and distributing data on a network Data reliability is ensured with RAID features that provide data security and recovery over multiple Terabyte of storage are available using RAID 5 and RAID 6 depending on model Gigabit Ethernet ports enhance network efficiency allowing Thecus IP storage to take over file management functions increase application and data sharing and provide faster data response The Thecus IP storage offers data mobility with a disk roaming feature that lets you swap working hard drives for use in other Thecus IP storage securing the continuity of data in the event of hardware failure The Thecus IP storage allows data consolidat
171. s When Local is selected log messages can be viewed directly through samba However to access the Nsync folder through samba the folder must be set as browseable and the user must be given ACL permissions In OS X UNIX extensions must be disabled under Network Service gt Samba CIFS in the UI Remote Access They can also be viewed remotely by selecting Remote and inputting a Remote IP Address into the input field This will allow a TFTP program such as TFTPd32 to access the system log remotely from a computer Syslog Daemon Enable Disable Target GI Local t Remote Log Level v Remote IP Address 59 System Management The System Management menu gives you a wealth of settings that you can use to configure your Thecus IP storage system administration functions You can set up system time system notifications and even upgrade firmware from this menu p i System A anarement Ti A Bl a P n grad OT NN Dm 3creguie Ji Administrator Pa go Contig Aiemt kr Ja fii 4 factory Liermit QO Reb oot amp Shutdi tay File System Check g Wake Un LAN E Date and Time System Date and settings From the Date and time menu choose the item and the screen appears Set the desired Date Time and Time Zone You can also elect to synchronize the system time on Thecus IP storage with an NTP Network Time Protocol Server System Date and Time Settings Date 12 22 2010 3 Time 13 00 Time Zone
172. size Space Allocation X Create 15 C 5I Thin Privizion Volume RAID ID RAID Unused 28 61 28 GB Allocation 21 9 GB After the size has been determined click OK to confirm Now you will see the iSCSI thin provisioning volume is available from the list Please refer to the screenshot below 90 Space Allocation RAID Information Master ID RAID S Disks Total Data 1SCSI RAID Level B Used Capacity Capacity Capacity RAID 0 Healthy 12 219 8 0 2 GB 84 8 GB 91 9 GB Volume Allocation List iSCSI Target iSCSI Thin Privizion Target Advance Option iSCSI Thin Privizion Volume ds Expand o Delete iSCSI Thin Privizion lt Ada 72 Lun Type Name Capacity YE Now you can start to create iSCSI targets to join the newly created iSCSI thin provision volume Basically the iSCSI target under iSCSI thin provisioning has exactly same settings screen as the standard iSCSI target volume creation The only difference is the Virtual Size of capacity Unlike creating standard iSCSI target volumes the capacity has been physically allocated The iSCSI target volume creation under thin provisioning can virtually be up to 16000GB 16TB Let s take the example below 1 The physical size for the iSCSI thin provision volume is 333 88GB You can refer the screenshot above 2 The iSCSI target volume under thin provisioning starts with 333 38GB in physical size and you may use drag the Virtual Size bar to select the desired
173. sword field is for the password of ADS Active Directory Server not Thecus IP storage 112 Local User Configuration From the Accounts menu choose the User item and the Local User Configuration screen appears This screen allows you to Add Edit and Remove local users Local User Configuration amp 3 Add gs Edit Remove User ID User Name Id 4 Pag jof1 D D GP No topics to display Local User Configuration Item Descipton 9 Press the Add button to add a user to the list of local users Press the Edit button to modify a local user Press the Remove button to delete a selected user from the system Add Users 1 Click on the Add button on Local User Configuration screen and Local User Setting screen appears 2 On the Local User Setting screen enter a name in the User Name box 3 Enter a User ID number If left blank the system will automatically assign one 4 Enter a password in the Password box and re enter the password in the Confirm box 5 Select which group the user will belong to Group Members is a list of groups this user belongs to Group List is a list of groups this user does not belong to Use the lt lt or gt gt buttons to have this user join or leave a group 6 Press the Apply button and the user is created 113 Add Password Confirm Password Group Members GroupID Group Name 102 r Local User Setting Group List User Name
174. t have their licenses terminated so long as such parties remain in full compliance You are not required to accept this License since you have not signed it However nothing else grants you permission to modify or distribute the Program or its derivative works These actions are prohibited by law if you do not accept this License Therefore by modifying or distributing the Program or any work based on the Program you indicate your acceptance of this License to do so and all its terms and conditions for copying distributing or modifying the Program or works based on it Each time you redistribute the Program or any work based on the Program the recipient automatically receives a license from the original licensor to copy distribute or modify the Program subject to these terms and conditions You may not impose any further restrictions on the recipients exercise of the rights granted herein You are not responsible for enforcing compliance by third parties to this License If as a consequence of a court judgment or allegation of patent infringement or for any other reason not limited to patent issues conditions are imposed on you whether by court order agreement or otherwise that contradict the conditions of this License they do not excuse you from the conditions of this License If you cannot distribute so as to satisfy simultaneously your obligations under this License and any other pertinent obligations then as a consequence y
175. t number of an incoming connection on a non standard port External IP Input the public IP address of router while Thecus secure FTP server has been enabled It could help to response ftp client with correct communicate information Passive Port Range limited port range for the FTP server to use 30000 32000 FTP ENCODE If your FTP client or operating system does not support Unicode e g Windows 95 98 ME or MAC OS9 8 select the same encoding as your OS here in order to properly view the files and directories on the server Available options are BIG5 HZ GB2312 GB18030 ISO EUC JP SHIFT JIS and UTF 8 Allow Anonymous FTP Upload Download Allow anonymous FTP users to upload or Access download files to from public folders Download Allow anonymous FTP users to download files from public folders No access Block anonymous FTP user access Auto Rename If checked the system will automatically rename files that are uploaded with a duplicate file name The renaming scheme is filename where represents an integer Upload Bandwidth You may set the maximum bandwidth allocated to file uploads Selections include Unlimited 1 2 4 8 16 and 32 MB s Download Bandwidth You may set the maximum bandwidth allocated to file downloads Selections include Unlimited 1 2 4 8 16 and 32 MB s WebService HT TP Web Disk From the Network Service menu choose the HTTP Web Disk item and the WebService screen app
176. tails from mounted ISO file From the main menu the ISO Mount feature is located under Storage Please refer the figure below for reference Select on the ISO mount function and you will have the screen shot appear as following ISO Mount lv e I Mounted Path ISO Path ISO Size No iso mount information to display Paze of1 Description Maximum 30 ISO files can be mounted in total 100 A Add a ISO file From the figure above select ISO file from drop down share list ISO Mount nsync usbhdd usbcopy ISO Path ISO Size naswebsite iTunes music After selection system will bring up Mount table for further setting screen VI ISO filter 4 j naswebsite Mounted Path ISO Path ISO Size _ BT Seed J Andy Weekly Report AMD Besttech GT J ACS xxx LJ AMCC 7 Thecus 02iso Thecus 01iso _ Adobe Acrobat 7 0 Pro J ATOM Andy Private Id 4 Pagef oft b M No iso mount information to display File Selected Mount as Description Only ISO 9660 file system can be mounted Top 50 Folders Top 50 Files Please tvpe in the full path of the ISO if not listed V ISO filter 4 naswebsite JBT Seed J Andy Weekiy Report J AMD Besttech GT J ACS Oxxx us O1 is Adobe Acrobat 7 0 Pro aJ ATOM __j Andy Private KI lt Page fi b Pll a No iso mount information to display Description Onty ISO 9660 file system can be mounted Top
177. the ADS NT server name e g adservername ADS NT Realm Specifies the ADS NT realm e g example com Administrator ID Enter the administrators ID of Windows Active Directory or Windows NT which is required for Thecus IP storage to join domain Administrator Enter the ADS NT Administrator password Password Apply To save your settings 111 To join an AD domain you can refer the figure and use the example below to configure the Thecus IP storage for General Network Identification Hardware User Profiles Advanced associated filed input E System Properties m 2 alx Windows uses the following information to identify your computer on the network Full computer name computer domain local ADS Server Name masc Domain domain local ie cia La Work Group Domain Name ADS Realm Whe Totename this computer on joi a domaini click Properties Properties Mate The identification of the computer cannot be changed because The computer is a domain controller Cancel Apply AD Domain Example Work Group Domain domain Name Administrator Xokckck OK IK OK Password The DNS server specified in the WAN LAN1 configuration page should be able to correctly resolve the ADS server name e The time zone setting between Thecus IP storage and ADS should be identical The system time difference between Thecus IP storage and ADS should be less than five minutes The Administrator Pas
178. the link to install the Publishing Wizard 144 T is Thecus Creator In Storage a AAPA ER SLL com HADO WA o4 00 P rotect vour Source Secure four Data 3 Windows XP will ask whether you want to run or save this file Click Save to save the register file File Download Security Warning Do you want to run or save this file Mame xPPublish reg Type Registration Entries 377 bytes From 172 16 66 158 While files from the Internet can be useful this file type can potentially harm your computer IF vou da nat trust the source do nat run or save this software What s the risk 4 Once the register file is installed use the Windows file manager to browse the folder that contains the picture you want to publish On the left pane there will be an icon labeled Publish this folder to the Web 5 Click on this icon and Web Publishing Wizard will start 145 Web Publishing Wizard EX Welcome to the Web Publishing Wizard This wizard will help you publish your files over the Internet or a local network so that other people can view them in their Web browsers To continue click Next 6 Select the pictures you want to publish to the Photo Web Server by placing a check mark on the top left hand corner of the picture Click Next Wok Pubinhize F izari Charpa Tou pie Seleccion YA casn pulblerh Gree key hh Ba chee maka pce ck r suani ip pobluh Pb clear ii check bos 7 Your PC will start to c
179. the recycle bin for deleted folders files 1 Setup the Day to remove deleted folders files which has resided in recycle bin permanently Left default value O if desired to clean up recycle bin manually 2 Setup the Size for recycle bin to allow deleted folders files can store Left default value O with no limitation e The deleted files folders which have resided in recycle bin will keep its permission On the other hand only the admin and owner can view read write these folders files e If deleted single file size is large than 2GB then it won t reside in the recycle bin but erase permanently FTP Thecus IP storage can act as a FTP server enabling users to download and upload files with their favorite FTP programs From the Network Service menu choose the FTP item and the FTP screen appears You can change any of these items and press Apply to confirm your settings FIP Support FTP Service Enable Disable Secure FTP Explicit Enable 9 Disable External IP _ for FTP on NAT environment Passive Port Range 30000 32000 E FTP Character Set Allow Anonymous FTP Access pw Auto Rename E Upload Bandwidth Download Bandwidth 171 A description of each item follows P FTP Enable FTP Service on Thecus IP storage Security FTP Enable or disable Security FTP be sure the client FTP software has also security FTP setting enabled Port Specifies the por
180. tim or with modifications and or translated into another Language Hereinafter translation is included without limitation in the term modification Each licensee is addressed as you Activities other than copying distribution and modification are not covered by this License they are outside its scope The act of running the Program is not restricted and the output from the Program is covered only if its contents constitute a work based on the Program independent of having been made by running the Program Whether that is true depends on what the Program does 1 You may copy and distribute verbatim copies of the Program s source code as you receive it in any medium provided that you conspicuously and appropriately publish on each copy an appropriate copyright notice and disclaimer of warranty keep intact all the notices that refer to this License and to the absence of any warranty and give any other recipients of the Program a copy of this License along with the Program You may charge a fee for the physical act of transferring a copy and you may at your option offer warranty protection in exchange for a fee 2 You may modify your copy or copies of the Program or any portion of it thus forming a work based on the Program and copy and distribute such modifications or work under the terms of Section 1 above provided that you also meet all of these conditions a You must cause the modified files to carry prominent notices st
181. to the list of local groups Edit Press the Edit button to modify a selected group from the system Press the Remove button to delete a selected group from the system 115 Add Groups 1 On the Local Group Configuration screen click on the Add button 2 The Local Group Setting screen appears 3 Enter a Group Name 4 Enter a Group ID number If left blank the system will automatically assign one Select users to be in this group from the Users List by adding them to the Members List using the lt lt button 6 Click the Apply button to save your changes Add X Ul Local Group Setting Users List Group Name Search Group ID 103 UserID User Name User Members List UserID User Name Edit Groups 1 On the Local Group Configuration screen select a group name from the list 2 Press the Edit button to modify the members in a group 3 To add a user into a group select the user from the Users List and press the lt lt button to move the user into the Members List 4 To remove a user from a group select the user from Members List and press the button 5 Click the Apply button to save your changes Edit x Local Group Setting Users List Grovp Name Search Grovp ID UserID User Name User Members List UserID User Name 116 Remove Groups 1 On the Local Group Configuration screen select a group name from the list 2 Press Remove to delete the group from the system Local Group Configur
182. um can delete or modify the pictures with the Delete or Modify buttons on the top right hand corner 150 EXIF Information While viewing pictures you can also have Thecus IP storage display the EXIF information for each photo ji c Therus Ceealor in Sianga E mm T EL Protect su scura Secure vwa Data Simply click the EXIF button to display EXIF information To hide this information click the EXIF button again Slide Shows Slide shows are a great way to enjoy pictures stored on your Thecus IP storage You can click on the Start Slide Show icon on the top right hand corner to start the slide show Thagus Thecus Creator in Sragi r pere EMO oboe andy x nlibum gt Sga SCM PG Filerzunie z DISCHI IPG File Sine 73H53 bytes i rm STAI BE Ret 11559 Fiet z eet aukohale Fc beet z tt mm Exmceure Times 2 208 xr dente fh 1S 8 um WERE PEGBnes gt fut urb Metering Pick Huti Segt n Protect drm Secure Data To stop the slide show click on the Stop Slide Show icon on the top right hand corner 151 Mapping a Client PC to the Thecus IP Storage You can map share folders on Thecus IP storage so that you can access them as if they were drives on your computer You can connect to the shared network folders on Thecus IP storage as follows Windows 1 Go to the My Computer folder in Windows 2 In the menu bar select Tools and then Map Network Drive 3 The Map Network Drive
183. wered on e Solid green Network link e Blinking orange Network activity e Solid green Network link e Blinking orange Network activity e Solid red HDD failed e Blinking orange HDD activity e Solid red HDD failed e Blinking orange HDD activity e Solid red HDD failed e Blinking orange HDD activity e Solid red HDD failed e Blinking orange HDD activity e Solid red HDD failed e Blinking orange HDD activity USB disks and USB printers e Solid blue Device is powered on seconds 13 N4100PRO The N4100PRO s front panel displays the unit s array of status LED s and is also where you ll find the power buttons See the table below for a detailed explanation of each Power Busy WAN LAN Error USB Port Thecus Power switch H4188PRD Up Button ESC Button Down Button Enter Button Description HDD Trays e There are four hard disk drive HDD trays Each tray supports a 3 5 inch SATA HDD The trays have locks for added physical security and keys are provided with the package Power LED Busy LED e Blinking orange system startup or maintenance data inaccessible Off system startup complete system operating normally Solid green network link LAN LED Blinking green network activity Error LED e Solid red system error detected Power Button e Power on off N4 100PRO e e Solid green network link e Blinking green network activity e e 14 N4200 series The Thecus N4200series front panel has
184. window appears 4 Assign a drive letter for the share folder 5 Click the Browse button to find the folder over your network Alternatively you may enter the folder name you wish to connect to or enter its IP address i e 192 168 1 100 share 6 Click Finish When the Connect As window appears enter your user name and password 7 Click OK The share folder appears as the drive you assigned You can now access this folder as though it were a drive on your computer Apple OS X On an Apple computer you can connect to shared computers and servers using a network address 1 2 Choose Go Connect to Server Enter the network address for the server in the Server Address text box When connecting using SMB CIFS protocol type Smbs 19216921 L0 Polder When connecting using AFP protocol type afp 192 168 1 100 Folderl Click Connect When MAC OS X is trying to connect Thecus IP storage it will ask for a User Name and Password which has access to the folder When MAC OS X has connected to Thecus IP storage successfully an icon representing the folder will appear on the MAC OS X desktop You can access the folder by double clicking on the icon Mapping Thecus IP storage as an iSCSI Drive With Thecus IP storage you are able to map it as an iSCSI drive With iSCSI you can remotely access Thecus IP storage at great speeds as if it were installed as a local drive in your computer To do this simply follow the ste
185. y Disks Total Data iSCSI Used Capacity Capacity Capacity 1 2 3 927 7 GB 0 3 GB 852 7 GB N A Elpata O iscsi C unused 74 Create a RAID On the RAID Information screen press the create button to go to the CREAT RAID screen In addition to RAID disk information and status this screen lets you make RAID configuration settings Using Create RAID you can select stripe size choose which disks are RAID disks or the Spare Disk RAID Configurations Item Description Number assigned to the installed hard disks Capacity of the installed hard disks Model number of the installed hard disks Status of the installed hard disks If this is checked current hard disk is a part of a RAID volume Spare If this is checked current hard disk is designated as a Spare fora RAID volume Check a box to designate this as the Master RAID volume See the NOTE below for more information Stripe Size This sets the stripe size to maximize performance of sequential files in a storage volume Keep the 64K setting unless you require a special file storage layout in the storage volume A larger stripe size is better for large files Data Percentage The percentage of the RAID volume that will be used to store data Create Press this button to configure a file system and create the RAID storage volume To create a RAID volume follow the steps below 1 On the RAID Information screen click create 2 On the RAID Configuration screen
186. y This product includes software developed by the Computer Systems Engineering Group at Lawrence Berkeley Laboratory This product includes software developed by the Kungliga Tekniska H gskolan and its contributors This product includes software developed by the Nick Simicich This product includes software written by Tim Hudson tjh cryptsoft com This product includes software developed by Christopher G Demetriou for the NetBSD Project 185 CGIC License Terms Basic License CGIC copyright 1996 1997 1998 1999 2000 2001 2002 2003 2004 by Thomas Boutell and Boutell Com Inc Permission is granted to use CGIC in any application commercial or noncommercial at no cost HOWEVER this copyright paragraph must appear on a credits page accessible in the public online and offline documentation of the program Modified versions of the CGIC library should not be distributed without the attachment of a clear statement regarding the author of the modifications and this notice may in no case be removed Modifications may also be submitted to the author for inclusion in the main CGIC distribution GNU General Public License Version 2 June 1991 Copyright 1989 1991 Free Software Foundation Inc 51 Franklin St Fifth Floor Boston MA 02110 1301 USA Everyone is permitted to copy and distribute verbatim copies of this license document but changing it is not allowed PREAMBLE The licenses for most software are designed to
Download Pdf Manuals
Related Search
Related Contents
ZI-MD300 / ZI-MD300G ZI-MD500 / ZI-MD500H Referenzmodell ein Offenes Archiv-Informations-System 据付工事説明書 - トーヨーキッチン Capacidad de hacer que los empleados - 99 Consulting Benutzerhandbuch 4. Vers une société d`information et de communication. RayBio® Human MMP-13 ELISA Kit 101416 LS-170 Video Processor User Manual 報告書 - IPA 独立行政法人 情報処理推進機構 G8 溶離液 HSi 第1液 (S) Copyright © All rights reserved.
Failed to retrieve file