Home

AASTRA 6730i

Contents

1. Keypad Key Description 0 Dials 0 Dials the Operator on a registered phone 1 Dials 1 2 ABC Dials 2 When entering text this key enters A with one press B with two presses and C with three presses 3 DEF Dials 3 When entering text this key enters D with one press E with two presses and F with three presses 4 GHI Dials 4 When entering text this key enters G with one press H with two presses and I with three presses 5 JKL Dials 5 When entering text this key enters J with one press K with two presses and L with three presses 6 MNO Dials 6 When entering text this key enters M with one press N with two presses and O with three presses 7 P QRS Dials 7 When entering text this key enters P with one press Q with two presses R with three presses and S with four presses 8 TUV Dials 8 When entering text this key enters T with one press U with two presses and V with three presses 9 WXYZ Dials 9 When entering text this key enters W with one press X with two presses Y with three presses and Z with four presses The is called the star key The is called the number sign pound key or hash key depending on one s nation ality or personal preference These can be used for special functions such as accessing voicemail The star key and pound key functions are dependant on your country s feature availabilities Contact your System Administrator for more information
2. 160 Configurable Save and Delete KeyS oooooocoococcoronccnrnncn ron en en eee rr rr 160 Authentication Support for HTTP HTTPS Download Methods Used with Broadsoft Client Management System CMS 161 Diverting Calls from Your Phone a cs al a Ee alee Lae 162 Display of Call Destination Information 0c ccc cece ene ne ee ee en ee eee rra ran enna tenets 163 Indication of Terminated Calls 0 0 00 ccc cece cence ee en nee e enn een ee ene ene ene tne ene EEE 163 Troubleshooting Solutions 00 c cece een n nee enn ron nr rra 165 Limited Warranty PP PP o A aaa Warranty 1 EXCIUSIONS coccion a aaa Warranty 1 Warranty Repair Services ei otitis gtaxid adden alas deena Warranty 1 After Warranty Service 00 a dae N a aE Warranty 1 Limited Warranty Australia Only Warranty 2 Repair Notice ooo A ayau qaq aa ama qa Aa Warranty 2 Exclusions T u eecacd ceived tabs a e een ceca A PRANS Warranty 2 Warranty Repair Services cio 0 a e a De a EP UNESA Warranty 3 After Warranty Service u u uu A Ge A an ee Warranty 3 Appendix A Time Zone Codes viciosa iria id iia dd A 1 A o O PI E E R aA E E aa E Index 1 vi 41 001376 00 Rev 01 06 2013 Welcome The Aastra 6730i offers advanced XML capability to access custom applications and is fully interoperable with leading I
3. 1 Click on Operation gt Programmable Keys Programmable Keys Configuration Key Type Value Line 1 SpeeddialvConf w 5551212 2 v 2 Pickup v 3 Line v 3 v 4 Paging v 5 6 L 7 Speeddial v 9051234567 1 v 8 XML x nttp 10 70 3 7 xml menu menu php source all Select from Key 1 through Key 8 Keys 5 and 6 can be made configurable only by your system administrator Inthe Type field select Speeddial Conf In the Value field enter the number or the extension to add to the conference for example 5551212 In the Line field select the line for which you want to use the key functionality a uu A Y N Click Save Settings 80 41 001376 00 Rev 01 06 2013 Line Keys and Programmable Keys Directory Key By default the 6730i has a Directory key configured on Key 7 However using the Aastra Web UI you can assign the Direc tory key to another available key if required Key 1 through Key 8 Keys 5 and 6 can be made configurable only by your sys tem administrator u oO O D Q D om Directory D O Key The Directory List feature allows you to store frequently used names and numbers on the phone You can also dial directly from a directory entry You can use the Directory key to access a Directory List which contains a
4. In the Line field select the line for which you want to use the key functionality a uu A WwW N Click Save Settings 41 001376 00 Rev 01 06 2013 79 Line Keys and Programmable Keys Speeddial Conference Key The 6730i allows you to configure a programmable key to be used as a speed dial conference key Speeddial Conf key while remaining in the current call This key allows a user on a call to conference another party at a pre defined number while remaining in the call For example while on an active call a user can use the Speeddial Conf key to dial a recording service and have the result ing conference recorded Note If currently in a conference the Speeddial Conf key is disabled on the active call If you configure a programmable key as a Speeddial Conf key and you press this key while on an active call the focused line changes to the dialing line A Cancel softkey displays on the phone allowing you to abort the conference speed dial if required The message Ringing displays below the number when the far end is ringing The message Conf Unavail able briefly displays when a conference is already in progress The active call is not put on hold when the speed dial number is dialed Note This feature is not compatible with centralized conferencing Configuring a Speeddial Conf Key La Aastra Web UI Note Keys 5 and 6 SAVE and DELETE keys can be made configurable ONLY by your System Administrator
5. Message Waiting Lamp 12 Transfer Key 4 Hold Key 13 Line Call Appearance keys O Volume Control 14 Speaker Key O Mute Key O Keypad 9 Goodbye Key O Navigation Keys O Redial Key O 8 Line LCD Screen O Options Key 118 Programmable Keys IP Phone Keys Key Description The following table identifies the keys on the key panel of your 6730i IP phone that you can use for handling calls Text Keys Symbol Keys Key Description Hold J Hold Key Places an active call on hold To retrieve a held call press the call appearance key beside the light that is flashing Redial Key Redials up to 100 previously dialed numbers Pressing the Redial key twice redi als the last dialed number Goodbye Key Ends an active call The Goodbye key also exits an open list such as the Options List without saving changes 00E Volume Control Key Adjusts the volume for the handset ringer and handsfree speaker For more information refer to the Adjusting Volume section in the Aastra 6730i Installation Guide provided with your phone Navigation Keys Pressing the UP and DOWN arrow keys lets you view different status and text messages on the LCD display if there is more than 1 line of status text messages These keys also let you scroll through menu selections such as the Options List and scroll through a remote number that is displayed on the phone Users can press the scrolling DOWN naviga tion key to vi
6. 41 001376 00 Rev 01 06 2013 129 Managing Calls 7 In the CFWD State screen press the DOWN arrow key to scroll to the CFWD Number screen and press CHANGE 1 Cfwd All Use YA to view Y 1 Cfwd State n lt Done Change CFWD Number Screen Y 2 Cfwd Number Change Cfwd Number lt Done Change A Cancel Set 8 Enter a phone number to apply to the current state in focus When the phone is in the state you specified and a call comes into the phone it forwards the call to the number you specify 9 Press SET to save the change 10 Forthe CFWD No Answer state In the CFWD Number screen press the DOWN arrow key to scroll to the CFWD No Rings screen and press CHANGE 1 Cfwd NoAns Use YA to view v 1 Cfwd State On lt Done gt Change Y 2 Cfwd Number CFWD No Rings Screen 4 Done gt Change o Y i Ch Ri ange no Rings F lt Y Next P Set 11 Press NEXT to select the number of rings to apply to the phone for call forwarding incoming calls Valid values are 1 to 20 Default is 1 When the phone receives an incoming call and call forward is configured on the phone the phone rings the number of times you specify in the No Rings screen and then forwards the call if there is no answer 12 Press SET to save the change 13 Press DONE to save CFWD All Number CFWD All State CFWD Busy Number CFWD Busy State CFWD No Answer Number CFWD No Answer State CFWD No Answer Rings Each time you pr
7. After you hear the greeting from the CallPark server enter the extension where you want to park the call For Sylantro Server Enter the extension number where you want to park the call fol lowed by key For ININ Server Enter the extension number where you want to park the call fol lowed by key If the call is parked successfully the response is either a greeting voice confirming that the call was parked or a hang up occurs The parked call party hears music on hold 3 If the call fails you can pick up the call using the next procedure and press the Park key again to retry step 2 Pickup a Parked Call 1 Pick up the handset on the phone 2 Enter the extension number where the call was parked 3 Press the Pickup key If the call pick up is successful you are connected with the parked call 41 001376 00 Rev 01 06 2013 73 Line Keys and Programmable Keys Last Call Return Icr Key for Sylantro Servers Using the Aastra Web UI you can configure the Last call return Icr function on a key This feature is for Sylantro servers only How it works If you configure Icr on a key and a call comes into your phone after you are finished with the call and hang up you can press the key configured for Icr and the phone dials the last call you received When you configure an Icr key the label LCR displays next to that key on the IP phone When the Sylantro server dete
8. no speakerphone phone displays Bad Encrypted Confi phone displays No Service restarting phone UIS Y PASS WOTA ninia 37 V voicemail volume control keys w warning tone for Intercom warranty exclusions X XMkEapplicatiomtitle uu saz ccsesscoscavaressuessssnenasscressascseacsazssencocapecsstatyeisectaerseetwntentpecs XML application URI XML beep support XML features XML key XML service accessing 41 001376 00 Rev 01 06 2013 Disclaimer Aastra Telecom Inc will not accept liability for any damages and or long distance charges which result from unauthorized and or unlawful use While every effort has been made to ensure accuracy Aastra Telecom Inc will not be liable for technical or editorial errors or omissions contained within this documentation The information contained in this documentation is subject to change without notice Copyright 2013 Aastra Technologies Limited www aastra com AASTRA
9. 41 001376 00 Rev 01 06 2013 85 Line Keys and Programmable Keys Configuring a Services Key La Aastra Web UI Note Keys 5 and 6 SAVE and DELETE keys can be made configurable ONLY by your System Administrator 1 Click on Operation gt Programmable Keys Programmable Keys Configuration Key Type Value Line 1 Services v 2 Pickup v 3 Line v 3 v Paging v 5 7 Speeddial vw 9051234567 1 Y 8 XML v http 10 70 3 7 xml menu menu php source all 2 Select from Key 1 through Key 8 Keys 5 and 6 can be made configurable only by your system administrator 3 In the Type field select Services 4 Click Save Settings Using the Services Key IP Phone UI 1 Press the Services key Note Specific options may display in the Services Menu if setup by your System Administrator Contact your Administrator for more information 2 Select an option from the Services Menu 3 To cancel a Service press CGS 86 41 001376 00 Rev 01 06 2013 Line Keys and Programmable Keys Phone Lock Key You can configure a programmable key on the phone to use as a lock unlock key You assign the function of the key as Phone Lock Use the following procedure to configure a key as a lock unlock key in the Aastra Web UI Configuring a Phone Lock Key La Aastra Web Ul Note Keys 5 and 6 SAVE
10. Callers List Key 1 Press the Callers List Key From the Callers List scroll through the list to find the name and number that you want to save to your Directory Press the Save Key Press the Directory Key to save the number you selected to the Directory List If the name is displayed with the number both are saved to the Directory If no name is displayed you can enter the name using the dial pad A W N 113 41 001376 00 Rev 01 06 2013 Managing Calls Saving from the Redial List Q IP Phone UI Use the following procedure to save names numbers from the Redial List to the Directory Use the following illustration as a reference Save Key Directory Key Redial Key 1 Press the Redial List Key C 2 From the Redial List scroll through the list to find the name and number that you want to save to your directory 3 Press the Save Key 4 Press the Directory Key to save the number you selected to the Directory List If the name is displayed with the number both are saved to the Directory If no name is displayed you can enter the name using the dial pad Downloading the Directory List to Your PC You can download the Directory List to your PC via the Aastra Web UI The phone stores the directorylist csv file to your PC in comma separated value
11. Roger s phone accepts the call and displays the name and number of the phone the incoming call Tim and the name or number of the original destination Mark The screens scroll between Screen 1 and Screen 2 See examples of the phones LCD below The diversion LCD screens scroll every 3 seconds Tim s Phone x462 diverted to Roger s Phone x464 Tim 463 calls Mark s phone which is busy gt Roger 464 receives the incoming call from Tim and diverts to Roger diverted from Mark 1 Roger 2 Diverting 464 P User Busy 3 Line LCD Display 3 Line LCD Display To enable this call diverting feature contact your System Administrator 162 41 001376 00 Rev 01 06 2013 Available Features Enabled by Administrators Display of Call Destination Information By default your phone displays call destination information if your phone is configured to forward calls to other destina tions The call destination information displays on multiple screens that scroll every 3 seconds The following example shows call destination information on the 6730i IP Phone Call Destination Information 1 Bob To 0409123456 Alice One 6730i IP Phone Note When both call diversion and call destination are enabled the information displays to the phone s screens in the fol lowing order Screen 1Caller info Screen 2Call destination Screen 3Call diversion If your phone does not display call destination information
12. The 6730i IP phone has a feature you can enable called XML Extensible Markup Language XML is a markup language much like HTML Your System Administrator can create customized XML menu services and load them to your IP phone These services include things like weather and traffic reports contact information company info stock quotes or cus tom call scripts You can configure XML using the Aastra Web UI only Using the Aastra Web UI you can configure a key to access XML applications Under Operations gt Programmable Keys you can assign a key the type XML Note The XML services must be set up by your System Administrator before you can use the key Contact your System Admin istrator for more information You must also specify an XML URI and a Services label using the following XML fields e XML Application URI XML Application Title The XML Application URI is the URI loaded by your phone The phone performs an HTTP GET Contact your System Administrator for the applicable XML URI to enter in the XML Application URI field The XML Application Title is the label that displays beside the XML key on your phone If you use the Services key to access the XML features the XML Application Title is the label that displays on the Services Menu in the IP Phone UI Note Contact your System Administrator for the applicable URI to enter in this field After an XML key is configured you can use the IP Phone UI to access the XML applicati
13. on page 144 BLF Xfer Key Requirements and Functionality BLF Xfer and BLF A BLF Xfer key can be configured for subscribing to an extension and monitor the status of the extension similar to the BLF key functionality Changes of the state of the monitored extension are indicated by a LED Icon BLF Xfer and Blind Transfer Calls When the focused line is in the Connected state pressing the BLF Xfer key transfers the call to the extension uncon ditionally disregarding the status of the monitored extension If transferring a call to an extension fails a message Transfer Failed displays on the phone and you can reconnect the call get the call back by pressing the line key again BLF Xfer and Call Forward When the focused line is in the Ringing state pressing the BLF Xfer key forwards the call to the extension uncondi tionally disregarding the status of the monitored extension BLF Xfer and Speed Dial When the focused line and the monitored extension are idle pressing the BLF Xfer key causes the phone to go off hook and dial the number of the extension 76 41 001376 00 Rev 01 06 2013 Line Keys and Programmable Keys Configuring a BLF Xfer Key La Aastra Web UI Note Keys 5 and 6 SAVE and DELETE keys can be made configurable ONLY by your System Administrator 1 Click on Operation gt Programmable Keys Programmable Keys Conf
14. or None the phone proceeds to enter the Add a Speed Dial Key process For more information about editing a speed dial key see Editing Speed Dial Keys on page 53 41 001376 00 Rev 01 06 2013 47 Line Keys and Programmable Keys Creating a Speed Dial Using the Speed Dial Edit Option You can use the IP Phone Ul at the path Options gt Preferences gt Speed Dial Edit to create a speed dial key Q IP Phone UI 1 Press on the phone to enter the Options List 2 Select Preferences 3 Select Speed Dial Edit The following prompt displays Press SD key All current speed dial key LEDs flash RED for programmable keys All other function key LEDs turn off during this process After you press a speed dial key for editing the phone restores all key LEDs to their previous state Note If you select a key that is currently set as a speed dial key the speed dial information displays for you to edit 4 Press an unconfigured programmable key or keypad key 5 Enter a phone number or extension to assign to that speed dial key The following example illustrates the screen display Speeddial Enter number gt 3456 After entering the number the prompt Use Save to end displays on the screen 5558 Cancel Save 6 Press Save to save the number as a speed dial key By default the phone automatically assigns the speed dial key to line 1 if available To select a different line press th
15. 6 Press Set to save the Time Zone setting 41 001376 00 Rev 01 06 2013 27 Customizing Your Phone Set Daylight Savings Time 1 Select Preferences 2 Select Time and Date 3 Select Daylight Savings 4 Select a Daylight Savings time from the list of options Valid values are e OFF e 30 min summertime e 1hsummertime Automatic Default Note The default for Daylight Savings is Automatic 5 Press Set to save the Daylight Savings setting Set Time Servers With a valid time server enabled your IP phone will synchronize the time displayed with the specified configuration server The phone will use the time from Time Server 1 unless it is not configured or unavailable in which case it will move on to Time Server 2 and if necessary Time Server 3 1 Select Preferences 2 Select Time and Date 3 Select from Time Server 1 Time Server 2 or Time Server 3 4 Enter an IP address or domain name for the time server Note The default for Time Servers is Enabled The Time Servers can be Enabled or Disabled only from the Aastra Web UI 5 Press Set to save the time server setting La Aastra Web UI 1 Click on Basic Settings gt Preferences gt Time and Date Setting Time and Date Setting Time Format 12h v Date Format WWW MMMDD NTP Time Servers Enabled Time Server 1 0 0 0 0 Time Server 2 Oo Time Server 3 0 0 0 0 2 In the Time Format field select the time fo
16. 2 If there is only one account configured on the phone then the mode setting is ignored and the phone behaves as if the mode was set to Phone 3 Using the Aastra Web UI if you change the CFWD key mode to Phone all accounts synchronize to the current set ting of Account 1 128 41 001376 00 Rev 01 06 2013 Managing Calls CFWD in Account Mode 1 Use the RIGHT and LEFT arrow keys to scroll through each account Screenname 3 Screenname3 CFWD All CFWD Busy Jan 1 12 96 Jan 1 12 96 In the above example Screennamel Screenname2 and Screenname3 are three accounts configured on the phone Screenname has CFWD All enabled Screenname 2 has CFWD disabled as indicated by no message displayed and Screenname3 has CFWD Busy enabled 2 Press the Call Forward key The Call Forward Mode screen displays Use the UP and DOWN arrow keys to scroll through each state type Indicates Rute A e CFWD Enabled ange Cfwd Mode 4 All Off Indicates Cfwd Mode Done no CFWD Pree change phone number Cfwd Mode 5 AllOn configured Pies Indicates CFWD Disabled Inthe above example CFWD Allis enabled as indicated by a check mark Vv CFWD Busy is enabled but no call forward phone number configured as indicated by a and CFWD NoAns is disabled as indicated by an X 3 Select a state for the account s in focus using the UP and DOWN arrow keys You can enable d
17. 4 Paging v 5 6 e T Speeddial 9051234567 1 v 8 XML http 40 70 3 7xmllmenu menu php source all 2 Select the key configured for speed dial 3 Inthe Value field edit the phone number extension or speed dial prefix to apply to this hard key If you enter a speed dial prefix you must enter the character at the end of the prefix number for example 123456 4 If required in the Line field select a line for which to apply the speed dial to Valid values are 1 through 6 5 Click Save Settings Note You can delete a speed dial key by removing the information from the Value field 54 41 001376 00 Rev 01 06 2013 Editing a Speed Dial Using Keypad Speed Dial in the Aastra Web UI Line Keys and Programmable Keys La Aastra Web UI 1 Click on Operation gt Keypad Speed Dial Keypad Speed Dial Key 1 2 0 on oO U0 Value 9051234567 Line 4771 2 Select from Digit 1 through Digit 9 3 In the input box edit the phone number extension or speed dial prefix for this Digit key If you enter a speed dial prefix you must enter the character at the end of the prefix number for example 123456 4 Inthe Line field select a line for which to apply the speed dial to Valid values are 1 through 6 5 Click Save Settings 41 001376 00 Rev
18. Active Empty circle Solid Red Solid Circle Solid Red Held Reverse empty blinking circle Slow Flashing Red Solid Reverse Circle Slow Flashing Red Hold private Reverse empty blinking circle Slow Flashing Red Solid Circle Solid Red Bridge active Empty circle Solid Red Solid Circle Solid Red Bridge held Reverse empty blinking circle Slow Flashing Red Solid Circle Solid Red Line key Phone Behavior State Call Line Key Pressed Non Call Line Key Pressed Idle N A Attempt to seize the line Seized Hang up Ignore Progressing Hang up Ignore Alerting Answer N A Active Hold Bridge Held Retrieve Bridge Hold private Retrieve Ignore Bridge active Hold Bridge Bridge held Retrieve Bridge 41 001376 00 Rev 01 06 2013 155 Available Features Enabled by Administrators There are features on your IP Phone that you can use ONLY if an Administrator has enabled them on your phone Those features are described in this section Contact your System Administrator for more information Outgoing Intercom Calls If your System Administrator configures the outgoing intercom feature on your phone pressing the Icom key allows your phone to find an available line and place an intercom call to a recipient To use this feature you must configure an intercom key on your phone For more information about configuring and using an Icom key see Intercom Key on page 83 Missed Call Summary Subscription A feature on the
19. Additional Features This section describes additional features you can use on the 6730i phone Star Codes All of the main call handling and extension management features using star codes can be set on your phone by your Administrator Contact your System Administrator for more information If these have not been set up you can dial any star code commands on the 55i phone the same way you would on a reg ular telephone 138 41 001376 00 Rev 01 06 2013 Additional Features Display DTMF Digits A feature on the IP phones allows users to enable or disable DTMF dual tone multi frequency digits to display to the IP phone when using the keypad to dial or when dialing from a programmed key DTMF is the signal sent from the phone to the network that you generate when you press the phones touch keys This is also known as touchtone dialing Each key you press on your phone generates two tones of specific frequencies One tone is generated from a high frequency group of tones and the other from a low frequency group If you enable the Display DTMF Digits parameter the digits you are dialing from the keypad or or from a programmable key display to the IP phone s LCD display This parameter is disabled by default no digits display when dialing You can enable the Display DTMF Digits parameter using the Aastra Web UI Configuring Display of DTMF Digits La Aastra Web UI Use the following procedure to configure the display of DTMF
20. E callersList csy 41373 41376 4443245 41356 Download the Callers List Use the following procedure to download the Callers List to your PC using the Aastra Web UI La Aastra Web UI 1 Click on Operation gt Directory Directory Files Available for Download Directory List Callers List 2 In the Callers List field click on Save As A File Download message displays 3 Click OK 4 Enter the location on your computer where you want to download the Callers List and click SAVE The callerslist csv file downloads to your computer 5 Use a spreadsheet application to open and view the Callers List 41 001376 00 Rev 01 06 2013 119 Managing Calls Account Configuration DND and Call Forwarding The 6730i has a feature that allows you to configure Do Not Disturb DND and call forwarding CFWD for multiple accounts on the phone You can set specific modes for the way you want the phone to handle DND and CFWD The three modes you can set on the phone for these features are e Account e Phone e Custom The following paragraphs describe account based DND and CFWD DND Account Based Configuration e Call Forward Account Based Configuration DND Account Based Configuration Do Not Disturb DND is a feature on the phone that prevents the phone from ringing and receiving incoming calls When DND is enabled with call forwarding CFWD any incoming calls can be call forwarded to voic
21. Lock label appears next to the key you just pressed 88 41 001376 00 Rev 01 06 2013 Line Keys and Programmable Keys Paging Key Sends the RTP Stream You can configure a Paging key on the phone that allows you to send a Real Time Transport Protocol RTP stream to pre configured multicast address es without involving SIP signaling You enter a multicast IP address es and a port number for the Paging key that when pressed initiates an outgoing multicast RTP session This is called Group Paging on the IP phones You can also specify group paging RTP addresses that the phone listens for when receiving RTP streams You can specify up to 5 listening multicast addresses at the path Basic Settings gt Preferences gt Group Paging RTP Settings For more information about Group Paging and how it works and to specify multicast addresses see Group RTP Paging receives RTP streams on page 153 Configuring a Paging Key La Aastra Web UI Note Keys 5 and 6 SAVE and DELETE keys can be made configurable ONLY by your System Administrator 1 Click on Operation gt Programmable Keys Programmable Keys Configuration Key Type Value Line 1 Paging v 239 0 1 15 10000 2 Pickup M 3 Line v 3 v 4 None i L 6 L 7 Speeddial x 9051234567 1 v 8 XML x http 10 70 3 7xml menu menu php source all 2 Select from Key 1 through Key 8 Keys 5 and 6 can be made configu
22. Notes 1 If you selected Account or Custom mode in step 2 you can enable disable each account or all accounts as applicable If you selected Phone mode the first account allows you to change the DND status for all accounts 2 Number and name of accounts that display to this screen are dependant on the number and name of accounts configured on the phone In the screen in step 4 Screenname1 is configured on Line 1 Screenname2 is configured on Line 2 and Screenname3 is configured on Line 3 Only your Administrator can create accounts for your phone Contact your Administrator for more information 6 Click Save Settings The changes takes affect immediately without a reboot 122 41 001376 00 Rev 01 06 2013 Managing Calls Using DND Modes via the IP Phone UI After you add a DND key to your phone you can toggle the DND state using this key on the phone Use the following pro cedure to enable disable DND on the IP Phone Q IP Phone UI The following procedures assume you have already configured a DND key AND assumes there are three accounts config ured on the phone Notes 1 If there is no DND key configured or if it is removed DND is disabled on the IP Phone 2 If there is only one account configured on the phone then the mode setting is ignored and the phone behaves as if the mode was set to Phone 3 Using the Aastra Web UI if you change the DND key mode to phone all accounts synchronize
23. Phone Account w 2 The Message Waiting Indicator Line field is set to ALL lines by default If required change the setting to a specific line by selecting a line from the list Valid values are All and lines 1 through 6 3 Click Save Settings 150 41 001376 00 Rev 01 06 2013 Additional Features Incoming Intercom Call Features Incoming Intercom By default the IP phone allows incoming intercom calls to be automatically answered without having to set up an Icom key on your phone The phone automatically plays a warning tone when it receives an incoming intercom call It also mutes the microphone If the intercom call comes into the phone while an active call is already present the phone puts the active call on hold and answers the intercom call You can change the behavior of how the phone handles incoming intercom calls by enabling disabling specific parame ters using the Aastra Web UI The following table describes these features Incoming Intercom Features in fe Aastra Web UI Description Auto Answer Allows you to enable or disable the IP phone to automatically answer an Intercom call If auto answer is enabled on the IP phone the phone plays a tone if Play Warning Tone is enabled to alert the user before answering the intercom call If auto answer is disabled the phone treats the incoming intercom call as a normal call Your Administrator can set a time period delay before the phon
24. gt Preferences gt Language Settings Language Settings Webpage Language English w Input Language Pyccku iv 41 001376 00 Rev 01 06 2013 35 Customizing Your Phone 2 Select a language from the Input Language field Setting this field allows you to specify the language to use when entering text and characters in the Aastra Web UI and IP Phone UI Valid values are English default Frangais French Espanol Spanish Deutsch German Italiano Italian Portugu s Portuguese Pyccku Russian Nordic Note All languages may not be available for selection The available input languages are dependant on the configuration enabled by your System Administrator 3 Click Save Settings The change is dynamic The Aastra Web Ul and IP Phone Ul allow you to enter text and characters in the language you selected Latin 2 Character Set The 6730i includes support for ISO 8859 2 Latin2 of multi national languages when displaying and inputting in the IP Phone UI and the Aastra Web UI UTF 8 is also compatible with XML encoding on the IP Phones The following table illustrates the Latin 2 character set used on the 6730i IP Phone 36 0 NBSP A 0040 160 163 o DOBO 0105 176 177 A R 0154 00C1 192 193 N 0110 0143 208 209 A r 0155 ODE1 224 225 d T 0111 0144 240 241 2 3 02D8 0141 162 163 02DB 0142 178 179 oocz 0102 194 195 N O 0147 00D3 210 211 A Y a a OOE2
25. the call waiting tone plays at regular intervals for the amount of time set for this parameter For example if set to 30 the call waiting tone plays every 30 seconds When set to 0 the call waiting tone is audible only once on the active call 4 Click Save Settings 41 001376 00 Rev 01 06 2013 147 Additional Features Preferred Line and Preferred Line Timeout The 6730i has a feature called preferred line and preferred line timeout If you enable the preferred line parameter on your phone after a call ends incoming or outgoing the display switches back to the preferred line Next time you go off hook to make another call you pickup on the preferred line You can enable the preferred line parameter using the Aastra Web Ul at the location Basic Settings gt Preferences gt General You can also set a preferred timeout parameter that specifies the number of seconds it takes for the phone to switch back to the preferred line Note You can configure Preferred Line and Preferred Line Timeout using the Aastra Web UI only The following table provides the behavior of the preferred line focus feature with other features on the phone Phone Feature Preferred Line Behavior call return The phone switches back to the focused line immediately after the call ends speed dial The line is already specified when the speed dial is created The phone switches back immediately after the call ends
26. the user name is user all lowercase and the password field is left blank If you have forgotten your password contact your System Administrator for assistance In the New Password field enter the new user password In the Password Confirm field enter the new user password again Click Save Settings page 13 Why does my phone display Bad Encrypted Config The IP phone displays Bad Encrypted Config because encrypted configuration files are enabled but the decryption process has failed Report this error to your System Administrator 166 41 001376 00 Rev 01 06 2013 Troubleshooting Solutions How do restart the IP phone Q IP Phone UI 1 Press the key on the phone to enter the Option List 2 Press the Y key to scroll to the Restart Phone option and press Enter 3 Press the key to confirm and restart the phone If you do not wish to restart your phone press the el key to cancel Note Your phone is out of service temporarily during the restart and downloading process La Aastra Web UI 1 Click on Operation gt Reset Reset Phone Restart Phone 2 Click Restart 3 Click OK at the confirmation prompt How do llock my phone You can lock your phone to prevent the phone from being used or configured You can lock the phone using any of the fol lowing e Inthe IP Phone UI at the path Options gt Phone Lock e Inthe Aastra Web UI at the path Operations
27. your System Administrator may have disabled this feature Contact your System Administrator for more information Indication of Terminated Calls An Administrator can configure your phone to display a disconnected screen Call Terminated when the far end hangs up An audible busy signal is also heard on the phone The configuration of this feature can also include the maximum time interval that the busy signal is audible Contact your System Administrator for more information The following is the call terminated screen that displays on the 6730i if this feature is enabled on your phone 6730i Call Terminated The following table identifies when a call terminated screen displays on the phone for different scenarios IF THEN 1 line active and far end disconnects the line in focus displays disconnected screen plays busy tone displays Call Terminated message on the screen the line not in focus plays busy tone 2 or more lines active and far end disconnects the line in focus displays disconnected screen plays busy tone displays Call Terminated message on the screen for 5 seconds When 5 second times out the busy tone stops the disconnected screen disappears 2 or more lines active and a line NOT in focus is disconnected no busy tone plays by the far end no disconnected screen displays no Call Terminated message displays 41 001376 00 Rev 01 06 2013 163 Available Features Enabled
28. 06 2013 69 Line Keys and Programmable Keys Accessing the XML Service After an XML application s have been saved to your IP phone and after a key has been configured to access the XML application s the customized service is ready for you to use amp IP Phone UI 1 Press the key configured for XML on the 6730i phone A Custom Features screen displays or the title you specified 2 Use the and Y to scroll through the customized features 3 For menu and directory services select a service to display the information for that customized service Message services display to the screen after pressing the key For user input services follow the prompts as appropriate 4 To exit from the Customized Features screen press the XML key again 70 41 001376 00 Rev 01 06 2013 Line Keys and Programmable Keys Sprecode Key You can set a programmable key to automatically activate specific services offered by the server For example if the spre code value of 82 is configured then by pressing the Sprecode key 82 automatically activates a service provided by the server Contact your System Administrator for information about available services La Aastra Web UI Note Keys 5 and 6 SAVE and DELETE keys can be made configurable ONLY by your System Administrator Configuring a Sprecode Key Use the following procedure to configure a sprecode key on the 6730i phone 1 Click on Operation gt Programmable
29. Beep Support Enabled Status Scroll Delay seconds 5 Switch Ul Focus To Ringing Line Enabled Call Hold Reminder During Active Calls C Enabled Call Hold Reminder Cl Enabled Call Waiting Tone Period o o Preferred line 1 Preferred line Timeout seconds 0 Message Waiting Indicator Line All v DND Key Mode Phone w Call Forward Key Mode Account w 2 The Switch Focus to Ringing Line field is enabled by default To disable this field uncheck the box 3 Click Save Settings 144 41 001376 00 Rev 01 06 2013 Additional Features Call Hold Reminder During Active Calls The IP phones allow you to enable or disable the ability for the phone to initiate a continuous reminder tone on the active call when another call is on hold For example when this feature is enabled and the call on Line 1 is on hold and then the you answer a call on Line 2 and stay on that line a reminder tone is played in the active audio path on Line 2 to remind you that there is still a call on hold on Line 1 When this feature is disabled a ring splash is heard when the active call hangs up and there is still a call on hold You can enable or disable this feature using the Call Hold Reminder During Active Calls in the Aastra Web UI Configuring Call Hold Reminder During Active Calls Use the following procedure to configure Call Hold Reminder During Active Calls on the IP phone Note Call Hold Reminder During Active Calls is
30. CFWD key applies to the account in focus Phone The Phone mode allows you to set the same CFWD configuration for all accounts All Busy and or No Answer When you configure the initial account the phone applies the configuration to all other accounts In the Aastra Web UI only the account you configured is enabled All other accounts are grayed out but set to the same configuration Using the Aastra Web UI if you make changes to that initial account the changes apply to all accounts on the phone Custom The Custom mode allows you to configure CFWD for a specific account or all accounts You can configure a specific state All Busy and or No Answer for each account independently or all accounts On the 6730i you can set all accounts to ALL On or ALL Off Note If there is only one account configured on the phone then the mode setting is ignored and the phone behaves as if the mode was set to Phone 3 Click Save Settings 4 The changes takes affect immediately without a reboot 126 41 001376 00 Rev 01 06 2013 Managing Calls 5 Click on Basic Settings gt Account Configuration Account Configuration Account DND Call Forward State Label No Rings 1 Stacy Donaldson All Busy No Answer 2 905 1234567 All Busy poo MAM lt No Answer Save Settings The illustration above shows 2 accounts configured on the phone Accounts must be set up by your
31. CSV format You can use any spreadsheet application to open the file for viewing The following is an example of a Directory List in a spreadsheet application The file displays the name phone number and line number for each Directory entry EJ directoryList csw Note Your System Administrator can populate your IP phone Directory List with server directory files Contact your System Administrator for more details 114 41 001376 00 Rev 01 06 2013 Managing Calls Download the Directory List Use the following procedure to download the Directory List to your PC using the Aastra Web UI La Aastra Web UI 1 Click on Operation gt Directory Directory Files Available for Download Directory List Callers List 2 In the Directory List field click on Save As A File Download message displays 3 Click OK 4 Enter the location on your computer where you want to download the Directory List and click SAVE The callerslist csv file downloads to your computer 5 Use a spreadsheet application to open and view the Directory List 41 001376 00 Rev 01 06 2013 115 Managing Calls Callers List The Callers list is a stored log of your incoming calls The 6730i IP Phone stores information for up to 200 incoming calls in the Callers list Note Your System Administrator can create a custom Callers List
32. Dial Keys On the 6730i you can edit a speed dial key using any of the following methods e Using the Aastra Web UI at the path Operation gt Programmable Keys Operation gt Keypad Speed Dial e Using the IP Phone Ul at the path Options gt Preferences gt Speed Dial Edit The following illustration shows the path in the 6730i IP Phone UI for editing a speed dial key Preferences Speed Dial Edit 555 1212 1 Tones gt Press SD button gt 2 Contrast Level Use Save to end 3 Speed Dial Edit 4 Live Pialpad 5 Set Audio 6 Timejand Date 7 Language Press the Speed Dial Key Edit and Save the vNext Enter LED for Speed Dial Key Speed Dial flashes Speed Dial Edit Option Q IP Phone UI Use the following procedure to edit a speed dial key from the IP Phone UI Note A speed dial key must be already configured on the phone to edit the key 1 Press on the phone to enter the Options List 2 Select Preferences 3 Select Speed Dial Edit All current speed dial key LEDs flash RED for programmable keys All other function key LEDs turn off during this process After you press a speed dial key for editing the phone restores all key LEDs to their previous state 4 Press a speed dial key you want to edit The speed dial edit screen displays Notes 1 If a number on the keypad is setup as a speed dial key pressing the applicable number in the speed dial editing
33. In centralized conferencing you can join multiple incoming or outgoing calls to active conferences Before following this procedure at least one active conference must exist on your phone 1 As Party 1 pickup the handset or press the speakerphone key A line opens up Call Party 2 by dialing their number or answer an incoming call of a Party Wait for Party 2 to answer When Party 2 answers you can consult with them before adding them to the conference Press the Conf Key Es Press the Line Key that has the active conference For example Line 1 and Line 2 both have active conferences Pressing Line 1 joins Party 1 and Party 2 to the conference on Line 1 Pressing Line 2 joins Party 1 and Party 2 to the conference on Line 2 u Bb W N 6 Press the Conf Key again to join the Parties to the active conference 106 41 001376 00 Rev 01 06 2013 Handling Calls Ending a Conference and Transferring Remaining Parties The 6730i allows a Host to drop from a 3 way conference and let the other two parties remain connected by pressing a Transfer key Notes 1 The 6730i does not support scrolling between lines 2 The Caller ID of the dropped Host still displays on the remaining parties phones If you are the Host of a conference and want to leave that conference e While in a 3 way conference press the Transfer key on the phone Your phone leaves the 3 way conference but the remaining parties are still connected to the conferen
34. Incoming Intercom Call Features on page 151 Your System Administrator can enable outgoing intercom calls on your phone If enabled you must configure an Icom key on your phone to use for outgoing intercom calls You must configure a programmable key with the function Intercom Use the following procedure to configure a key as an Icom key using the Aastra Web UI Configuring an Intercom Key La Aastra Web UI Note Keys 5 and 6 SAVE and DELETE keys can be made configurable ONLY by your System Administrator 1 Click on Operation gt Programmable Keys Programmable Keys Configuration Key Type Value Line 1 Icom v Pickup z 3 Line v 3 v 4 Paging v 5 6 7 Speeddial v 9051234567 Ja g 8 XML wv http 10 70 3 7 xml menu menu php source all 2 Select from Key 1 through Key 8 Keys 5 and 6 can be made configurable only by your system administrator 3 In the Type field select Intercom Icom 4 Click Save Settings 41 001376 00 Rev 01 06 2013 83 Line Keys and Programmable Keys Using the Intercom Key for Outgoing Intercom Calls amp IP Phone UI 1 Press the Icom key 2 Enter the extension number of the person you want to intercom or the BLF key for that extension 3 Afterabeep tone your phone automatically connects with the remote extension and you can speak through its speaker 4 To cancel intercom press Gy
35. Keys Programmable Keys Configuration Key Type Value Line 1 Sprecode s 2 Pickup J 3 Line el Js g Paging k 5 ave 6 7 Speeddial y 9051234567 E v 8 m M ntt110 70 3 7xmUmenuimenuphp source all 2 Select from Key 1 through Key 8 Keys 5 and 6 can be made configurable only by your system administrator 3 Inthe Type field select Sprecode 4 In the Value field enter the appropriate value for accessing specific services from the server Note For values to enter in this field contact your System Administrator 5 Click Save Settings 41 001376 00 Rev 01 06 2013 71 Line Keys and Programmable Keys Park Pickup Keys The 6730i phone has a park and pickup call feature that allows you to park a call and pickup a call when required The IP phones support the Park Pickup feature on the Asterisk BroadWorks Sylantro and ININ servers The park pickup feature performs as follows e When a call comes in and you pickup the handset you can press the applicable Park key to park the call e After the call is parked you can press the Pickup key followed by the applicable value to pickup the call Administrators can configure the park and pickup keys for any line using the configuration files or the Aastra Web UI Users can make changes to customize the label of the park pick up keys using the Web UI Configuring Park Pickup Keys
36. La Aastra Web UI Note Keys 5 and 6 SAVE and DELETE keys can be made configurable ONLY by your System Administrator Use the following procedure to configure park pickup on the 6730i phone 1 Click on Operation gt Programmable Keys Programmable Keys Configuration Key Type Value Line 1 Park v 2 Pickup v 3 Line y IE x 4 Pagina v y eo gt i R 7 Speeddial y 9051234567 1 v 8 XML gt http 10 70 3 7kml menu menu php source all 2 Select from Key 1 through Key 8 Keys 5 and 6 can be made configurable only by your system administrator 3 In the Type field select Park Note The Value and Line fields are configured by the Administrator Select from Key 1 through Key 8 Inthe Type field select Pickup Click Save Settings N QQ Ww A Click on Reset then click Restart to restart the IP phone and apply the changes 72 41 001376 00 Rev 01 06 2013 Line Keys and Programmable Keys Using the Park Call Pickup Parked Call Feature Use the following procedure on the IP phone to park a call and pick up a parked call Park a Call 1 While on a live call press the Park key 2 Perform the following for your specific server For Asterisk Server Server announces the extension number where the call has been parked Once the call is parked press the CG key to com plete parking For BroadWorks Server
37. No Answer Number CFWD No Answer State CFWD No Answer Rings 16 Each time you press DONE the following Apply Changes screen displays Apply Changes 0 Cancel Confirm 17 Press to confirm the change s each time the Apply Changes screen displays 18 All the same changes are saved to all accounts on the phone CFWD in Custom Mode 1 Use the Right and Left arrow keys to scroll through each account Screenname 2 Screenname2 3 Screenname3 CFWD All CFWD Busy CFWD NoAns Jan 1 12 96 Jan 1 12 96 Jan 1 12 96 In the above example Screenname Screenname2 and Screenname3 are three accounts configured on the phone All three accounts have CFWD enabled as indicated by the CFWD All CFWD Busy and CFWD NoAns messages Press the Call Forward key The CFWD Account screens display Use the UP and DOWN arrow keys to scroll through each account Call Forward 1 Screenname Y lt Done gt Change Call Forward Indicates 2 Screennamay X CFWD Enabled lt Done Change Indicates Call Forward i 3 Screenname CFWD Disabled Don Change M Indicates Call Forward no CFWD phone Se UOH pno lt Done P Set number E v configured Call Forward 5 AllOn ADone_______bset 41 001376 00 Rev 01 06 2013 133 Managing Calls In the above example Screenname has one or more CFWD states enabled as indicated by a check mark v Screenname2 has one or more CFWD state
38. Speeddial 9051234567 1 v 8 XML w http 10 70 3 7 xml menu menu php source all Select from Key 1 through Key 8 Keys 5 and 6 can be made configurable only by your system administrator Inthe Type field select BLF to apply to this key Inthe Value field enter the phone number or extension you want to monitor In the Line field select a line for which to apply to this key Valid values are Global for all lines or 1 through 6 Qu A WU N Click Save Settings 41 001376 00 Rev 01 06 2013 57 Line Keys and Programmable Keys BLF List Key For use with the BroadSoft Broadworks Rel 13 or higher platform only The BLF List feature on the IP phones is specifically designed to support the BroadSoft Broadworks Rel 13 Busy Lamp Field feature This feature allows the IP phone to subscribe to a list of monitored users defined through the BroadWorks web portal Note Your System Administrator must have BLF List enabled on the BroadWorks Server Contact your System Administrator for more In addition to monitoring the idle and busy state the BLF List feature also supports the ringing state On the 6730i phone the LED lights next to each BLF key illuminate steady to indicate the monitored line is off hook or unregistered The LED goes off when the is idle When the monitored extension is ringing the LED flashes Note You can use a BLF List configured key to dial out For Example A receptioni
39. System Adminis trator 6 For each account enable the CFWD state by placing a check mark in one or more of the following State fields All e Busy e No Answer The All option forwards all incoming calls for this account to the specified phone number regardless of the state of the phone The phone can be in the Busy or No Answer states or can be in the idle state The phone still forwards all calls to the specified number The Busy option call forwards incoming calls only if the account is in the busy state The calls are forwarded to the specified phone number The No Answer option call forwards incoming calls only if the account rings but is not answered in the defined number of rings The call gets forwarded to the specified number Note You can use the Busy and No Answer states together using different forwarding phone numbers If these states are enabled for an account the All state is disabled and the phone is in the busy state when a call comes in the phone can forward the call to the specified phone number for example voicemail If there is no answer on the phone after the specified number of rings the phone can forward the call to a different specified number such as a cell phone number 7 For each account in the Number field enter the phone number for which you want the incoming calls to forward to if the phone is in the specified state If using the Account mode o
40. The following describes the behavior for each CFWD mode Account default The account mode allows you to configure CFWD on a per account basis Pressing a configured CFWD key applies to the account in focus Phone The Phone mode allows you to set the same CFWD configuration for all accounts All Busy and or No Answer When you configure the initial account the phone applies the configuration to all other accounts In the Aastra Web UI only the account you configured is enabled All other accounts are grayed out but set to the same configuration Using the Aastra Web UI if you make changes to that initial account the changes apply to all accounts on the phone Custom The Custom mode allows you to configure CFWD for a specific account or all accounts You can configure a specific mode All Busy and or No Answer for each account independently or all accounts On the 6730i you can set all accounts to ALL On or ALL Off Note If there is only one account configured on the phone then the mode setting is ignored and the phone behaves as if the mode was set to Phone You can enable different CFWD rules modes independently for example you can set different phone numbers for Busy All and NoAns modes and then turn them on off individually The following table describes the key and Message Waiting Indicator MWI LEDs when you enable CFWD on the IP Phone Key LED Behavior MWI LED Behavior for All Modes for All Mo
41. Tocompletea consultative transfer press Dial and remain on the line to speak with the Party 2 before either pressing the Transfer key or Goodbye key or hanging up the handset to transfer Party 1 to Party 2 Transferring Calls in Live Dial Mode Use the following procedure to transfer a call to another extension in live dial mode 1 2 3 Connect to Party 1 if not already connected Party 1 is the party you want to transfer Press the Transfer key EE You should hear a dial tone before the dialing begins Enter the extension number or the outside number to Party 2 This is the Party for which you want to transfer Party 1 To cancel the transfer prior to the completion of dialing you can either select Cancel on the display screen press the Goodbye key or hang up the handset To cancel the transfer after dialing has been completed and the ringback tone is heard you can select Cancel Note Users are not able to edit the destination number as the phone will either match the inputted number to a dial plan or wait for the set digit timeout Complete either a blind or consultative transfer a To complete a blind transfer press the Transfer key again or the Goodbye key or hang up the handset before the set digit timeout b To complete a consultative transfer press Dial or wait for the number match or timeout and remain on the line to speak with the Party 2 before either pressing the Transfer key or the Goodbye key or hangin
42. XML application allowing you to access the Callers List via an XML Key instead of the Callers List Key This allows you to configure the Callers List Key with other functions if required Contact your System Administrator for more information Your phone logs the number and name if available of the caller when they last called and the number of times they tried to reach you When the Callers list is full the oldest call records are deleted to accommodate the information of new callers If the phone number of an incoming or outgoing call matches a number that you have programmed with a name in a programmable key or in the Directory List the Callers List displays the name and number The display shows you how many callers have been added to the list since you last checked it 116 41 001376 00 Rev 01 06 2013 Caller s List Screen Display Display Item Description 450 349 0438 Indicates you have returned the call from the Callers list N MAR 04 3 30pm 2x N indicates a new call XX New Callers When you re not on the telephone and not in the Callers list the display shows you how many callers have been added to the list since you last checked it a ib Indicates an unanswered call in the Callers list La Indicates an answered call in the Callers list La Indicates a Call Waiting call in the Callers list La Indicates an incoming Call Waiting call John Burns 2x indic
43. by Administrators IF THEN An incoming call comes in on the line in focus that has a discon the line in focus with no calls on hold nected screen displaying displays a ringing screen the line in focus WITH calls on hold flashes its Line LED An incoming call comes in on another line NOT in focus and the disconnected screen no longer displays on the line in focus the disconnected screen is displaying on the line in focus A phone application is NOT in focus busy tone plays no disconnected screen displays When the phone application in focus on screen stops busy tone plays disconnected screen displays Note This indication of terminated calls feature does not affect parked calls on the phone or the conference call feature The following procedure describes how to handle the disconnected screens on your phone amp IP Phone UI 1 Press the Goodbye key The busy tone stops and the disconnected screen no longer displays or Select any Line key The busy tone stops and the disconnected screen no longer displays A dial screen displays 164 41 001376 00 Rev 01 06 2013 Troubleshooting Solutions Why is my display blank Ensure that power is being provided to your phone Make sure your phone is plugged into a power source Why is my speakerphone not working If you press the key and the speaker light flashes and you do not hear dial tone through the speaker phone the Set Audio
44. customized list of names with phone numbers and labels In addition to creating a Directory key you can also download a Directory List to your PC if required using the Aastra Web Ul Reference For more information about the Directory List see Directory List on page 108 41 001376 00 Rev 01 06 2013 81 Line Keys and Programmable Keys Configuring a Directory Key La Aastra Web UI Notes 1 Keys 5 and 6 SAVE and DELETE keys can be made configurable ONLY by your System Administrator 2 By default the Directory key is Key 7 Use the following procedure to configure a Directory key on the 6730i phone 1 Click on Operation gt Programmable Keys Programmable Keys Configuration Key Type Value Line 1 Directory M 2 Pickup v 3 Line v 3 v 4 Paging v 5 6 7 Speeddial v 9051234567 1 Y 8 XML v http 10 70 3 7ml menu menu php source all 2 Select from Key 1 through Key 8 Keys 5 and 6 can be made configurable only by your system administrator 3 In the Type field select Directory 4 Click Save Settings 82 41 001376 00 Rev 01 06 2013 Line Keys and Programmable Keys Intercom Key By default the IP phone allows incoming intercom calls to be automatically answered without having to set up an Icom key on your phone For more information about changing the behavior of incoming Intercom calls see the section
45. disabled by default La Aastra Web UI 1 Click on Basic Settings gt Preferences gt General Preferences General Display DTMF Digits O Enabled Play Call Waiting Tone M Enabled Stuttered Dial Tone M Enabled XML Beep Support M Enabled Status Scroll Delay seconds 5 Switch UI Focus To Ringing Line M Enabled Call Hold Reminder During Active Calls DJ Enabled Call Hold Reminder Cl Enabled Call Waiting Tone Period 0 Preferred line x Preferred line Timeout seconds 0 Message Waiting Indicator Line All v DND Key Mode Phone v Call Forward Key Mode Account w 2 The Call Hold Reminder During Active Calls field is disabled by default To enabled this field check the box When this feature is enabled a reminder tone is heard on the active call when another call is on hold When disabled a ring splash is heard when the active call hangs up and there is still a call on hold 3 Click Save Settings 41 001376 00 Rev 01 06 2013 145 Additional Features Call Hold Reminder on single hold In previous releases the call hold reminder ring splash was triggered when you hung up a call and there was at least one other call on hold The reminder ring splash timer started only when the active call hung up and there was still another call on hold On the IP phones you can enable or disable a feature that would start the reminder ring splash timer as soon as you put a call
46. gt Phone Lock e Ataconfigured Phone Lock key on the phone For more information about configuring a Lock Unlock key on your phone see Phone Lock Key on page 87 41 001376 00 Rev 01 06 2013 167 Troubleshooting Solutions Use the following procedure to lock an IP phone using the IP Phone UI amp IP Phone UI Lock the Phone 1 Press on the phone to enter the Options List 2 Select Phone Lock and press Enter 3 Press p gt to set the phone to lock The following message displays Phone is locked Unlock the Phone 1 Press on the phone to enter the Options List 2 Enter your user password and press Enter The phone unlocks Use the following procedure to lock an IP Phone using the Aastra Web UI La Aastra Web UI Lock the Phone 1 Click on Operation gt Phone Lock Phone Lock Lock or unlock the phone Emergency Dial Plan 911199911121110 Lock the phone Reset User Password Save Settings 2 In the Lock the Phone field click Lock The phone locks dynamically and displays the following message Phone is locked Unlock the Phone 1 Click on Operation gt Phone Lock 2 In the Unlock the Phone field click Unlock The phone unlocks dynamically and displays the following message Phone is unlocked 168 41 001376 00 Rev 01 06 2013 Limited Warranty Not applicable in Australia see below for Limited Warranty in Australia Aastra warrants this pr
47. line preferred line timeout I u programmable key descriptiOfY E E E AS 43 programmable keys about R redli EE E E ciesrincciaccin s 95 redial key 8 restarting the phone ring tone sets ring tones RTP pagina OO Piisininnrnnnmarisna craneo s save key Services key services key 9 speaker key 8 speaker mode 24 speaker headset mode speakerphone using speeddial contiguringikey fora u aaa aaa huqin das configuring prefix for creating from Keypad Speeddial in Web UI creating from phone keypad creating from programmable key in Web UI creating from SAVE key creating from Speeddial Edit Option editing saving to Redial List Callers List Directory List speeddial Xfer Speeddial Xfer key Sprecode key Index 2 Index star codes starting up the phone status scroll delay switch UI focus to ringing line T terminated calls indication I a 163 AL TAINSTOM CY a au a asa annassa a TAANE 8 transferring calls blind blind transfer to contact in directory consultive indication of pre dial and live dial mode two existing calls troubleshooting solutions changing password display blank finding IP address handset not working locking unlocking phone no dial tone s no light for VM message 165 A aeskieens Index 3
48. more infor mation about loading language packs see your System Administrator Press Set to set the language on the phone The change is dynamic When you exit the Options Menu the phone displays all menu items in the language you selected La Aastra Web Ul 1 2 3 41 Note You must have the language pack s already loaded to your phone in order to use them For more information about loading language packs see your System Administrator Click on Basic Settings gt Preferences gt Language Settings Language Settings Webpage Language English v Input Language Pycckuit v In the Webpage Language field select a language to apply to the Aastra Web UI Note All languages may not be available for selection The available languages are dependant on the language packs cur rently loaded to the IP phone by your System Administrator English is the default language and cannot be changed or removed Click Save Settings The change is dynamic The Aastra Web UI displays all screens in the language you selected 001376 00 Rev 01 06 2013 31 Customizing Your Phone Language Input The 6730i supports text and character inputs in various languages English German French Spanish Italian Portuguese Russian and Nordic Inputting textual or character information into the IP Phone Ul can be done using the keypad on the phone You enable the Language Input feature using the Aastra Web UI or the I
49. on hold even when no other calls are active on the phone When enabled the phone initiates a reminder ring splash periodically for the single call on hold When disabled no reminder ring splash is audible You can enable or disable this feature using the Call Hold Reminder parameter in the Aastra Web UI Configuring Call Hold Reminder Use the following procedure to configure Call Hold Reminder on the IP phone Note Call Hold Reminder is disabled by default La Aastra Web UI 1 Click on Basic Settings gt Preferences gt General Preferences General Display DTMF Digits C Enabled Play Call Waiting Tone Enabled Stuttered Dial Tone Enabled XML Beep Support Enabled Status Scroll Delay seconds 5 Switch UI Focus To Ringing Line Enabled Call Hold Reminder During Active Calls C Enabled Call Hold Reminder C Enabled Call Waiting Tone Period 0 Preferred line 1 v Preferred line Timeout seconds 0 Message Waiting Indicator Line an iv DND Key Mode Phone v Call Forward Key Mode Account w 2 The Call Hold Reminder field is disabled by default To enabled this field check the box When this feature is enabled the reminder ring splash timer starts as soon as you put a call on hold even when no other calls are active on the phone The phone initiates a reminder ring splash periodically for the single call on hold When disabled no reminder ring splash is audible 3 Cli
50. on the pre configured multicast address The Phone displays the Paging message to the phones LCD It uses the G711 uLaw CODEC for multicast RTP The recipient can drop the incoming page if required The recipient can also set Do Not Disturb DND to ignore any incoming pages For incoming RTP multicasts the ringing display is dependant on the setting for the Allow Barge In parameter See Allow Barge In on page 151 If this parameter is disabled and there is no other call on the phone then the paging is automatically played via the default audio device If there is an existing call on the phone the call initially displays in the ringing state The user has the option to accept ignore the call If the Allow Barge In parameter is enabled the RTP multicast call barges in and any existing calls are put on hold If an RTP multicast session already exists on the phone and the phone receives another incoming RTP multicast session the priority is given to the first multicast session and the second multicast session is ignored The behavior for the incom ing calls in this case is also based on the setting for the Allow Barge in parameter The incoming call is handled as if there were an existing call already on the phone Configuring Group RTP Paging La Aastra Web UI Use the following procedure to configure RTP streaming on the receiving end for Paging applications using the Aastra Web UI 1 Click on
51. option in the phones Options list has been set up for headset use Press a second time and if the light goes out the phone has been set up to be used only with a headset or handset If the light stays on steady and you hear dial tone the phone has been set up so that you can alternate between the speakerphone and the headset by pressing O See the section Set Audio on page 24 for instructions on how to change the Set Audio option Why can t I get a dial tone Check for any loose connections and that the phone has been installed properly For installation instructions please refer to the Installation and Setup section in the Aastra 6730i Installation Guide provided with your phone Why doesn t my phone ring Check the ring volume on your phone It may be turned down or turned off To adjust the ringer volume setting press the volume key when the phone is on hook and idle For more information refer to the Adjusting Volume section in the Aastra 6730i Installation Guide provided with your phone Why is the light not coming on with a new Voice Mail Message Your phone system or service provider must provide Visual Message Waiting service for this function to work Check with your System Administrator for more information Why is my handset not working Check to ensure that the handset cord is fully connected to both the phone and handset See the section Connecting a Handset or Headset in the Aastra 6730i Insta
52. password you can reset it and enter a new password The reset user password feature resets the pass word to the factory default which is blank no password You can reset a user password using the Aastra Web UI only Note Valid values when creating or changing a password are 0 to 4294967295 integers only symbols and alpha characters are not allowed Default password is an empty string field is blank Reset a User Password Use the following procedure to reset a user password La Aastra Web UI 1 Click on Operation gt Phone Lock Phone Lock Lock or unlock the phone Emergency Dial Plan 911199911121110 i Lock the phone Reset User Password Save Settings 2 In the Reset User Password field click Reset The following screen displays Reset User Password Please enter the current and new passwords Current Password e New Password seeecees Password Confirm eecccece Save Settings 3 In the Current Password field leave this blank 4 In the New Password field enter a new password 5 In the Password Confirm field re enter your new user password 6 Click Save Settings 38 41 001376 00 Rev 01 06 2013 Customizing Your Phone Restarting Your Phone You may want to restart your phone to check for updates for your phone on the server You may occasionally need to restart your phone to set changes or updates to your phone or network settings You may also need to restart yo
53. the following procedures to delete a single entry or all entries from the Directory List Use the following illustration as a reference Delete a Single Entry 1 Press the Directory Key 2 Press Y and to find the entry you want to delete 3 Press the Delete Key The DELETE again to erase this item prompt displays DELETE again to erase this item Delete Key Directory Key 4 Press the Delete Key again at the prompt to erase the entry 112 41 001376 00 Rev 01 06 2013 Managing Calls Delete All Entries 1 Press the Directory Key 2 Press the Delete Key The DELETE again to erase all items prompt displays DELETE again to erase all items 3 Press the Delete Key again to erase all entries from the Directory List The Directory empty prompt displays Directory empty Use Save to add Save an Entry to the Directory List You can save entries names and numbers from other sources to your Directory using any of the following methods e Saving from the Caller List e Saving from the Redial List Saving from the Callers List Q IP Phone UI Use the following procedure to save names numbers from the Callers List to the Directory Use the following illustration as a reference Save Key Directory Key lt
54. the transfer select Cancel on the display screen or press the Goodbye key Indication of Transferred Calls When you transfer an active call the near end phone displays a Call Transferred screen when a call is transferred and the far end call is dropped The following is the Call Transferred screen on the 6730i phone Call Transferred The following procedure describes how to handle the Call Transferred screen on your phone amp IP Phone UI 1 Press the Goodbye Gy key The Call Transferred screen no longer displays or Select any Line key The Call Transferred screen no longer displays and is replaced by a dial screen 41 001376 00 Rev 01 06 2013 101 Handling Calls Conferencing Calls The 6730i IP phone offers two methods of conferencing e Local conferencing in pre dial and live dial mode default method e Centralized conferencing for Sylantro and Broadsoft Servers Administrator must enable this method Local Conferencing The 6730i phone supports up to 3 parties including yourself in a conference call This is called Local Conferencing and is the default method of conferencing on the 6730i Note Your System Administrator can set your Conference key to speed dial a specific number Contact your System Admin istrator for more information When you use the Conference key to initiate a conference call the following screen displays In a conference call the call timer moves to the left You use the
55. to the current state in focus When the phone is in the state you specified and a call comes into the phone it forwards the call to the number you specify 9 Press Set to save the change 10 For the CFWD No Answer state in the CFWD Number screen press the Down arrow key to scroll to the CFWD No Rings screen and press Change 1 Cfwd NoAns Use WA to view 1 Cfwd State On lt Done gt Change 2 Cfwd Number lt Done gt Change 3 No Rings No Rings 1 CFWD No __ p gt Rings Screen lt Done gt Change Y Next 11 Press the Next key to select the number of rings to apply to the phone for call forwarding incoming calls Valid values are 1 to 20 Default is 1 When the phone receives an incoming call and call forward is configured on the phone the phone rings the number of times you specify in the No Rings screen and then forwards the call 41 001376 00 Rev 01 06 2013 135 Managing Calls 12 Press Set to save the change 13 Press Done to save CFWD All Number CFWD All State CFWD Busy Number CFWD Busy State CFWD No Answer Number CFWD No Answer State CFWD No Answer Rings Each time you press Done the following Apply Changes screen displays Apply Changes O Cancel Confirm 14 Press to confirm the change s each time the Apply Changes screen displays All changes are saved to the phone for all accounts Missed Calls Indicator The I
56. unlock the phone Emergency Dial Plan 911 999 112 110 Lockthe phone Reset User Password Save Settings 2 Inthe Emergency Dial Plan field enter the 3 digit number used in your local area to contact emergency services For multiple numbers enter a between each emergency number For example 911 110 Default for this field is 911 999 112 110 3 Click Save Settings to save the emergency dial plan to your phone Reference For more advanced options you can set on your phone see Additional Features on page 138 41 001376 00 Rev 01 06 2013 41 Line Keys and Programmable Keys This section describes the Multiple Line Call Appearance Keys L1 and L2 and the customizable programmable keys located at the top on the phone Programmable Keys gt Multiple Line Call Appearance Keys Multiple Line and Call Appearance Keys The 6730i has 2 hard line call appearance keys each with a corresponding status light Up to 4 more lines for a total of 6 line call appearance keys can be set using the programmable keys at the top of the phone Each programmable key also has a corresponding status light These line call appearance keys and lights can represent physical lines calls for your extension or calls from a group that your extension is part of By pressing a line call appearance key you connect to the line or a call it
57. up and down arrow keys to scroll to a party on the list You use the right arrow key to select the party to drop Pre Dial amp Live Dial Mode By default when users are initiating a conference call or transfer they will not hear a dial tone before dialing begins pre dial mode The phone does not automatically dial out the number until the user presses the Conf key This allows the users to make changes to the dialing number before initiating the call Administrators can configure a live dial mode In live dial mode when the user is completing a conference call or transfer they will hear a dial tone before dialing begins In addition the phone will either match the number to the dial plan or wait for the set digit timeout In the default pre dial mode users are able to edit the destination number prior to dialing whereas in live dial mode they are not able to however the Dial and Cancel softkeys are provided while the user inputs the number 102 41 001376 00 Rev 01 06 2013 Handling Calls IP Phone UI Using Local Conferencing in Pre Dial Mode Use the following procedure to create a conference call using local conferencing in pre dial mode Use the following illus tration as a reference Key 1 When you begin a conference you are the first party in the conference Party 1 Pic
58. want to save the new Directory entry to use Line 1 press Save to save the new entry to the Directory List If you want the new entry to use a different line use the Y key to select a different Line and press Save The new entry you added is saved to the Directory List Saved Directory John Burns Adding an Entry to the Directory List from the Save Key You can also add a new entry to the Directory List from the Save Key Key 5 Notes 1 Use the ef Key when required for backspacing 2 You can exit the entry process any time by pressing the Ss Key or the Directory Key 1 Press the Save Key The Save to prompt displays 2 Press the Directory Key The Enter Number prompt displays 3 Enter a phone number using the numbers on the keypad and press Save To backspace and erase a mistake press el or press the Delete Key Key 6 The Press 1st letter to enter name prompt displays 4 Entera nameto associate with the phone number you just entered and press Save Use the keypad to select the letters Continue to press the number key to access the next letter for that key for example press 2 three times to access C Press gt to move to the next space or wait a moment and the cursor automatically advances To insert a space between letters press p gt To backspace and erase a mistake press ef or press the Delete Key The Line prompt displays The default is Line 1 5 If you want to save the new Directory entry to us
59. you want to delete 3 Press the Delete Key 4 Press the Delete Key again at the prompt to erase the item Delete All Items Ey IP Phone UI 1 Press cC 2 Press the Delete Key then press the p gt Key at the prompt to erase all items DELETE again to erase this item Delete All Redial List is empty Mute You can use the Mute key to mute the handset headset or speakerphone When you use the mute key on your phone you cannot be heard on an active call or on a conference For muted calls the Mute key LED is ON IP Phone UI Press the C key at any time to mute handset headset or handsfree The mute light flashes slowly and you can hear the caller but they cannot hear you To switch mute on or off press c Note Ifyou place a muted call on hold the phone automatically takes the call off mute when you reconnect to the call 96 41 001376 00 Rev 01 06 2013 Receiving Calls When a call is ringing at your extension you see the nbound Call Screen The line call appearance light flashes quickly for the incoming call Laflamme amp Assoc 555 1234 Answering an Incoming Call Q IP Phone UI To answer the call e For handsfree operation press Gy the line call appearance key for the incoming call e Press O for handsfree or headset operation Lift the handset for handset operation Note The audio mode setting you have selected in the options lis
60. 01 06 2013 55 Line Keys and Programmable Keys Do Not Disturb DND Key The IP phones have a feature you can enable called Do not Disturb DND The DND function allows you to turn do not disturb ON and OFF Note You can configure DND using the Aastra Web UI only If DND is ON callers calling into the phone hear a busy signal or a message depending on how your System Administra tor set up the configuration server The second line on the screen of the IP phone shows when DND is set and the DND key light remains lit If the phone shares a line with other phones only the phone that has DND configured is affected You can set DND on the programmable keys using the Aastra Web UI only DND is not configurable from the IP phone UI Configuring a DND Key La Aastra Web UI Note Keys 5 and 6 SAVE and DELETE keys can be made configurable ONLY by your System Administrator 1 Click on Operation gt Programmable Keys Programmable Keys Configuration Key Type Value Line 1 DoNotDistub w 2 Pickup v 3 Line v js E 7 Speeddial y 9051234567 1 y 8 XML w http 10 70 3 7 xml menu menu php source all 2 Select from Key 1 through Key 8 Keys 5 and 6 can be made configurable only by your system administrator 3 In the Type field select Do Not Disturb to apply to this key 4 Click Save Settings to save the DND key setting 56 41 001376 00 Rev
61. 01 06 2013 Line Keys and Programmable Keys Busy Lamp Field BLF Key The BLF feature on the IP phones allows a specific extension to be monitored for state changes BLF monitors the status busy or idle of extensions on the IP phone Note BLF feature availability is dependant on your call manager Contact your System Administrator for more information Example A Supervisor configures BLFs on his phone for monitoring the status of a worker s phone use busy or idle When the worker picks up his phone to make a call a busy indicator on the Supervisor s phone shows that the worker s phone is in use and busy On the 6730i the busy and idle indicators are the LEDs next to each BLF key The LED illuminates steady to indicate the monitored line is off hook or unregistered The LED goes off when the line is idle You can set BLF on the programmable keys using the Aastra Web UI only BLF is not configurable from the IP phone UI Note You can also use a BLF configured key to dial out Contact your System Administrator for more information Configuring a BLF Key La Aastra Web UI Note Keys 5 and 6 SAVE and DELETE keys can be made configurable ONLY by your System Administrator 1 Click on Operation gt Programmable Keys Programmable Keys Configuration Key Type Value Line 1 BLF 9050001111 2 y 2 Pickup v 3 Line x db a 4 Paging v 5 A 7
62. 0103 226 227 SE 2 n O 0148 DOF3 242 243 4 5 7 8 2 LES 8 S 0044 013D 0154 0047 0048 0160 164 165 166 167 168 169 z v Y le Ba A OOB4 013E 015B 02C7 OOBS 0161 180 181 182 183 184 185 A Clee DOC4 0139 0106 00C D10C 00C9 196 197 198 199 200 201 O GIO lt RIU 00D4 0150 00D 6 OOD 0158 016E 212 213 214 215 216 217 x all OOE4 0134 0107 00E 010D 00E9 228 229 230 231 232 233 A a M Q olo6lo F l OOF4 0151 OOF6 OOF 0159 D16F 244 245 246 247 248 249 Ajeno en S T Z m 015E 0164 0179 OOAD 170 171 172 17 Ez O15F 0165 0174 O2DD 186 187 188 189 EJE E i 0118 OOCB 0114 00CD 202 203 204 205 UTA UTE DODA 0170 OODC OODD 218 219 220 221 ss x e es 1 0119 OOEB 011B OOED 234 235 236 237 A A DOFA 0171 OOFC OOFD E F 12 017D 017B 174 175 Z 2 D17E 017C 190 191 A Y L ID DOCE 010E 206 207 TID 0162 OODF 222 223 ijd OOEE O10F 238 239 t 0163 02D9 250 251 252 253 254 255 41 001376 00 Rev 01 06 2013 Customizing Your Phone User Password This category allows you to change the user password for your phone Changing your password ensures that only you can alter your phone settings and helps keep your system secure You can change your user password using the IP Phone UI or the Aastra Web UI If you change the password Then you need to using the IP Phone UI u
63. 2 ABC2AA abc2aa 3 DEF3E def3 4 GHI4 ghi4 5 JKL5 jkis 6 MNO60 mno6 7 PQRS7B pars7 amp 8 TUV8 tuv8 9 WXYZ9 wxyz9 l lt SPACE gt lt SPACE gt No A Italian Key Uppercase Characters Lowercase Characters 0 0 0 1 1 5 84 1 5 _84 2 ABC2 C abc2 c 3 DEF3EEE def3 e 4 GHI4 ghi4 5 JKL5 jkl5 6 MNO6 mno6 7 PQRS7 paqrs7 8 TUV8 tuv8 9 WXYZ9 wxyz9 lt SPACE gt lt SPACE gt A 41 001376 00 Rev 01 06 2013 Customizing Your Phone 33 Customizing Your Phone Portuguese Key Uppercase Characters Lowercase Characters 0 0 0 1 1 5 84 1 5 _ 8 2 ABC2 AAAC abc2 3 DEF3EE def3 4 GHI4i ghi4i 5 JKL5 jkl5 6 MNO6000 mno6666 7 PQRS7 pqrs7 8 TUV8 tuv8 9 WXYZ9 wxyz9 lt SPACE gt lt SPACE gt A Russian Key Uppercase Characters Lowercase Characters 0 0 0 1 1 _ amp 1 3 _ amp 0 2 ABBI2ABC a6Br2abc 3 AEEK33DEF He x33def 4 UNKSIAGHI niakn4ghi 5 MHO TI5JKL MHoOn5jkl 6 PCTy6MNO pcty6mno 7 XUY47PQRS7 xUu7pqrs 8 WLU bbI8STUV WL bbI8tuv 9 b3IOAOWXYZ b3I0A9WXYyZ lt SPACE gt lt SPACE gt A A Nordic Key Uppercase Characters Lowercase Characters 0 0 0 1 1 _ amp 1 amp 2 ABC2 AAA abc2 3 DEF3E def3 4 GHI4 ghi4 5 JKL5 jkl5 6 MNO60 mno6 7 PQRS7B pgrs7f3 8 T
64. 30i Use the following procedures to set speed dial on the 6730i IP phone 46 41 001376 00 Rev 01 06 2013 Line Keys and Programmable Keys Press and Hold to Create a Speed Dial applicable to programmable keys and keypad keys amp IP Phone UI Pressing and holding down a programmable key or keypad key on the phone initiates a speed dial feature Note When creating a speed dial for a key on the IP Phone you must select a key that has no preassigned function key must be set to None 1 Press a programmable key or a number key on the keypad for three seconds A screen displays with the prompt Enter number gt 2 Enter a phone number or extension to assign to that speed dial key The following example illustrates the screen display Speeddial Enter number gt 3456 After entering the number the prompt Use Save to end displays on the screen 3331 A Cancel Save 3 Press Save to save the number as a speed dial key By default the phone automatically assigns the speed dial key to line 1 if available To select a different line press the Change key and select a different line or use the phone s keypad to select a number 1 9 or use the Y and to make your selection Line 1 AY Change lt Cancel Save 4 Press Save to save the speed dial key to the line specified Note Press and hold a speed dial key to edit that speed dial key If you try to edit a digit key set to Empty
65. 6730i IP Phone can be redirected to an XML script This allows the server to provide the phone with available options rather then accessing them from the phone side You access the XML script by selecting the Services Menu You can still access the Services Menu from the phone side by pressing and holding the Options key to display the phone side Services Menu IMPORTANT NOTES If no Options URI script is configured the local Options Menu on the phone displays as normal If you configure password access to the Options Menu this password is required when accessing the local Option Menu but is not required for the Options Key redirection feature Pressing the Options Menu for redirection from the server does not interfere with normal operations of the phone for example pressing the options menu when on a call does not affect the call If the phone is locked you must unlock the phone before accessing the Options Menu redirect feature After pressing the Options Key the phone displays a screen that allows you to unlock the phone before continuing On the 6730i the redirection feature works after selecting the Services Menu To display the original Options Menu press and hold the Options key Contact your System Administrator for more information about this feature XML Applications and Off Hook Interaction If enabled by your Administrator the 6730i can be prevented from going into the off hook dialing state when the handset is off ho
66. 70 3 74ml menu menu php source all Services XML Application URI XML Application Title BLF List URI sip 9192 168 104 13 Save Settings 2 Select from Key 1 through Key 8 Keys 5 and 6 can be made configurable only by your system administrator 3 In the Type field select BLF List BroadSoft BroadWorks 4 Inthe Line field select a line number that is actively registered to the appropriate SIP proxy you are using Valid values are Global for all lines or 1 through 6 5 Inthe BLF List URI field enter the name of the BLF list defined on the BroadSoft BroadWorks Busy Lamp field page for your particular user For example sip 9 192 168 104 13 Note Contact your System Administrator for the BLF List URI 6 Click Save Settings 41 001376 00 Rev 01 06 2013 59 Line Keys and Programmable Keys Flash Key You can set a programmable key to generate a flash event when it is pressed on the 6730i You do this by setting the key to flash The IP phone generates flash events only when a call is connected and there is an active RTP stream for exam ple when the call is not on hold Configuring a Flash Key La Aastra Web UI Note Keys 5 and 6 SAVE and DELETE keys can be made configurable ONLY by your System Administrator 1 Click on Operation gt Programmable Keys Programmable Keys Configuration Key Type Value Line 1 Flash v
67. 78 Speeddial Conterence Key u saan gee asqa wawaqa aa anaa aida 80 Directory KEY cii ns u augur A E E A EAEE aan 81 Intercom Key vii a 83 Services Key uu oiea EE EE E EE E A EE SAE EA E E E R GE E E TEE EEA 85 Phone Lock Key crisis ia rai neraet ia ee eee ee ee 87 Paging Key Sends the RTP Stream una e AAA 89 NONE OY E E E a E E 91 Deleting a Key eens a usu a a tds 92 Making Calls rita oa 93 Dialing GNUMDER A A a ae 93 Using Handsfree Speakerphone 93 USING a Heddset 2 uuu eon ccna A A e Tyee k aasma paq aphanta AAA AAA ae 94 A teen ee aida stan aqasha teen Maw Shas a ed aaa kausa isn HIAa aqu waqa ae eases ek wet eed 95 MON T ic aiid A A sae aim AAs awka dee eneseaes 96 iv 41 001376 00 Rev 01 06 2013 Contents Receiving CAl S erensia eeii anen A A dic 97 Answering AN Incoming Call aan naa aa anaq Medea aa wawa Medea a ceded eee ceded eee Yawa asada 97 Sending an Incoming Call to Voicemail oococinin iii ad a a 97 Handling EAS A A due bas aenianennatennsd 98 Placing a Call on Hold uuu u A A A A Wee 98 Transferring Calls usss A A A A A A IC aiea ieii 99 Conferencing Cale y uuu A A ee Sasha 102 Ending Calls eo u quema ies sak mantras wie medi ane Kang MEL E nla ean anata ase 107 Ma aging CANS nsieasiario arica 108 Directory List u q suspi actin bes a as a iO iba 108 A RR 116 Account Configuration DND and Cal
68. Aastra Model 6730i IP Phone User Guide Release 3 2 2 Service Pack 3 Hot Fix 1 41 001376 00 Rev 01 06 2013 Software License Agreement Aastra Telecom Inc hereinafter known as Seller grants to Customer a personal worldwide non transferable non sub licenseable and non exclusive restricted use license to use Software in object form solely with the Equipment for which the Software was intended This Product may integrate programs licensed to Aastra by third party Suppliers for distri bution under the terms of this agreement These programs are confidential and proprietary and are protected as such by copyright law as unpublished works and by international treaties to the fullest extent under the applicable law of the jurisdiction of the Customer In addition these confidential and proprietary programs are works conforming to the requirements of Section 401 of title 17 of the United States Code Customer shall not disclose to any third party such confidential and proprietary programs and information and shall not export licensed Software to any country except in accordance with United States Export laws and restrictions Customer agrees to not reverse engineer decompile disassemble or display Software furnished in object code form Customer shall not modify copy reproduce distribute transcribe translate or reduce to electronic medium or machine readable form or language derive source code without the express written consent of
69. Administrator can enable disable this feature if required Contact your System Administrator for more information Keys States and LED Behavior There are two call states on the phones that support SCA bridging Bridge active A bridged call is in progress Bridge held The 3rd party i e non SCA party in the bridge is on hold The following tables provide the key states and LED behavior in an SCA bridge call for users involved in an SCA call and users not involved in the SCA call 154 41 001376 00 Rev 01 06 2013 Line Keys and Idle Screens Additional Features State Call LED Call Caller ID Non Call LED Non Call Caller ID Idle N A N A Off N A Seized Solid Green None Solid Red None Progressing outgoing call Green Called Party Solid Red None Alerting incoming call Blinking Unselected Red N A Active Solid Green Far end Solid Red Far end Held Slow Flashing Green Far end Slow Flashing Red Far end Hold private Slow Flashing Green Far end Solid Red Far end Bridge active Solid Green Far end Solid Red Far end Bridge held Slow Flashing Green Far end Solid Red Far end Programmable Line Keys State Call Icon Call LED Non Call Icon Non Call LED Idle Small circle None Small Circle None Seized N A N A Solid Circle Solid Red Progressing outgoing call Empty circle Solid Red Solid Circle Solid Red Alerting incoming call Empty blinking circle Flashing Red N A N A
70. Basic Settings gt Preferences gt Group Paging RTP Settings Group Paging RTP Settings Paging Listen Addresses 2 In the Paging Listen Addresses text box enter the multicast IP address es and port number on which the phone listens for incoming multicast RTP packets Enter the IP address in dotted decimal format for example 239 0 1 15 10000 239 0 1 20 15000 You can enter up to 5 listening multicast addresses If this field is blank the Paging Listening capability is disabled on the phone Notes 1 Recipient of a Paging call can set a global Do Not Disturb DND to ignore any incoming pages 2 For incoming Paging the phone uses the Intercom configuration settings The incoming Page is dependant on the Allow Barge In parameter setting and the Idling On Call state 3 Click Save Settings 41 001376 00 Rev 01 06 2013 153 Additional Features Shared Call Appearance SCA Call Bridging Shared Call Appearance SCA is when incoming calls are presented to multiple phones simultaneously For example it is the ability to assign the boss extension to a key on the secretary s phone Calls can be transferred between two phones with the same extension key by simply putting the call on hold at one phone and picking it up on the other Status LEDs light and flash in unison allowing all people sharing the extension to see the status at a glance The phones include an enhanced SCA for the servers that support
71. IP phones allows missed calls that have been redirected by the server to be incremented in the missed calls indicator on the phone it was initially directed to This feature is called the Missed Call Summary Subscription and can be configured by your System Administrator For this feature to work you must configure voicemail on the phone that the call was initially directed to For example phones A B and C are connected to the server Your Administrator configures the server to direct calls coming into phone B which has voicemail configured to be forwarded to phone C When phone A calls phone B the server forwards the call to phone C With the Missed Call Summary Subscription enabled phone B receives notifica tion from the server that the call was forwarded and the missed calls indicator is incremented on phone B See the illus tration below Phone A Phone C ki Mal 8 towards call to C APN phone B F owards call to ES Missed calls indicator increments on phone B Note Voicemail must be configured on phone B Note Your System Administrator can configure the Missed Call Summary Subscription feature on a global or per line basis Customizable Callers List Key Your System Administrator can specify an XML URI that creates a custom Callers List application for your phone When you press the Callers List key the phone accesses a custom XML URI Callers List instead of the standard Callers List Con tact your System Administrator f
72. IT key for submission of the field information and a CANCEL key for exiting the login screen Appropriate messages display if the phone reaches a timeout while trying to connect to the server or if a Username or Password are incorrect Once the login information for a specific user is entered and accepted by the server the phone reboots and downloads the user profile IP Phone Ul when Broadsoft CMS is Enabled When the Broadsoft CMS feature is enabled on the IP Phone the following screens display Login Screen Username Screen Password Screen 41 001376 00 Rev 01 06 2013 161 Available Features Enabled by Administrators Diverting Calls from Your Phone Your Administrator can enable disable a feature on your phone that allows incoming calls to be diverted to another phone if required When an outgoing call from your phone is being diverted to another destination i e via call forward the phone dis plays the Caller ID phone number and or caller name of the new destination and the reason for the call diversion Simi larly at the new destination the Caller ID of the original call destination displays Call Diversion Example Tim calls Mark at x400 Mark s phone is busy Mark s phone diverts the incoming call to another destination Roger x 464 Tim s phone displays name and extension of where the call is being diverted to and reason for diverting the call The screen scrolls between Screen 1 and Screen 2
73. KY Cayman EST 41 001376 00 Rev 01 06 2013 A 2 Appendix A Time Zone Codes A 3 Time Zone Name Time Zone Code LC St Lucia AST Ll Vaduz CET LT Vilnius EET LU Luxembourg CET LV Riga EET MC Monaco CET MD Chisinau EET MK Skopje CET MQ Martinique AST MS Montserrat AST MT Malta CET MU Mauritius MUT MX Mexico City CST MX Cancun CST MX Merida CST MX Monterrey CST MX Mazatlan MST MX Chihuahua MST MX Hermosillo MST MX Tijuana PST Ni Managua CST NL Amsterdam CET NO Oslo CET NR Nauru NRT NU Niue NUT NZ Auckland NZS NZ Chatham CHA OM Muscat GST PA Panama EST PE Lima PES PL Warsaw CET PR Puerto Rico AST PT Lisbon WET PT Madeira WET PT Azores AZO PY Asuncion PYS RO Bucharest EET RU Kaliningrad EET RU Moscow MSK RU Samara SAM RU Yekaterinburg YEK RU Omsk OMS RU Novosibirsk NOV RU Krasnoyarsk KRA RU Irkutsk IRK RU Yakutsk YAK RU Vladivostok VLA RU Sakhalin SAK RU Magadan MAG RU Kamchatka PET RU Anadyr ANA SE Stockholm CET SG Singapore SGT Sl Ljubljana CET SK Bratislava CET SM San Marino CET SR Paramaribo SRT SV El Salvador CST 41 001376 00 Rev 01 06 2013 41 001376 00 Rev 01 06 2013 Appendix A Time Zone Codes Time Zone Name Time Zone Code TR Istanbul EET TT Port of Spain AST TW Taipei CST UA Kiev EET US Eastern EST US Central CST US Mountain MST US Pacific PST US Alaska AKS US Aleutian HAS US Hawaii HST UY Montevideo UYS VA Vatican CET YU Belgra
74. P PBX platforms Featuring a 3 line display the 6730i supports up to 6 lines with call appearances and allows you to make and receive calls transfer conference and more The 6730i IP telephone provides communications over an IP Network using the SIP IP telephony protocol and has two hardware platforms one with text keys and one with symbol keys About This Guide This guide explains how to use your new 6730i phone Not all features listed are available by default Contact your System Administrator to find out which features and services are available on your system Your System Administrator also has the ability to customize some features on this phone Reference For information on more advanced settings and configurations administrators should refer to the Aastra Models 9000i and 6700i Series SIP IP Phones Administrator Guide Documentation Aastra 6730i SIP IP Phone Installation Guide Contains installation and set up instructions general features and func tions and basic options list customization This Installation Guide is included in the box with your phone Aastra 6730i SIP IP Phone User Guide Describes the most commonly used features and functions for an end user This User Guide can be downloaded from http www aastra com Aastra Models 9000i and 6700i Series SIP IP Phones Administrator Guide Contains advanced Administrator information and procedures for setting up the 6730i IP Phone on a network This Adminis
75. P Phone UI You can then use text and characters in a specific language when performing inputs on the phone The following tables identify the language characters that you can use to enter text and characters on the 6730i Keypad Input Alphabet Tables English default Key Uppercase Characters Lowercase Characters 0 0 0 1 1 5 _ amp 1 _ 84 2 ABC2 abc2 3 DEF3 def3 4 GHI4 ghi4 5 JKL5 jkl5 6 MNO6 mno6 7 PQRS7 pqrs7 8 TUV8 tuv8 9 WXYZ9 wxyz9 lt SPACE gt lt SPACE gt A A French Key Uppercase Characters Lowercase Characters 0 0 0 1 1 3 _ amp 1 _ amp 2 ABC2AAC AA abc2 3 DEF3 def3 4 GHI4Ii ghi4ii 5 JKL5 jkl5 6 MNO6NO006 mno6 7 PQRS7 pqrs7 8 TUV8 tuv8 9 WXYZ9 wxyz9 lt SPACE gt lt SPACE gt A A 32 41 001376 00 Rev 01 06 2013 Spanish Key Uppercase Characters Lowercase Characters 0 0 0 1 1 5 84 1 5 _ 84 2 ABC2 AG abc2 3 DEF3 def3 4 GHI4Ii ghi4i 5 JKL5 jkl5 6 MNO6NOO mno6 7 PQRS7 pqrs7 8 TUV8 tuv8 9 WXYZ9 wxyz9 lt SPACE gt lt SPACE gt A German Key Uppercase Characters Lowercase Characters 0 0 0 1 1 _ amp 1 amp
76. P phone has a missed calls indicator that increments the number of missed calls to the phone This feature is accessible from the IP phone UI only The number of calls that have not been answered increment on the phone s idle screen as lt number gt New Calls As the number of unanswered calls increment the phone numbers associated with the calls are stored in the Callers List The user can access the Callers List and clear the call from the list Once the user accesses the Callers List the lt number gt New Calls on the idle screen is cleared Accessing and Clearing Missed Calls IP Phone UI Use the following procedure to access and clear missed calls from the Callers List Once you display the Callers List the lt number gt New Calls indicator clears 1 Press Callers List key Don the phone 2 Use the Y and keys to scroll through the line items in the Callers List to find the line items that have the amp icon with the receiver ON These are the missed calls to the phone 3 To clear a line item from the Callers List select the line item you want to delete and press the Clear key The line item is deleted from the Callers List 136 41 001376 00 Rev 01 06 2013 Managing Calls Voicemail The Voicemail feature on the 6730i IP phone allows you to use a line configured with a phone number for dialing out to connect to a voicemail server For each assigned Voicemail number there can be a minimum of 0 or
77. Phone 8 Select the country for which you want to apply the tone set Valid values are Australia Brazil Europe France Germany Italy Italy2 Malaysia Mexico Russia Slovakia UK and US Default is US 9 Select Set and then press p gt The ring tone and tone set you select is immediately applied to the IP phone La Aastra Web UI 1 Click on Basic Settings gt Preferences gt Ring Tones Ring Tones Tone Set Global Ring Tone Line 1 Line 2 Line 3 Line 4 Line 5 Line 6 Line 7 Line 8 Line 9 For global configuration 2 In the Ring Tones section select a country from the Tone Set field Global US v Tone 1 Global Global Global Global Global Global Global Global lt lt lt lt lt lt lt SSS Valid values are Australia Brazil Europe France Germany Italy Italy2 Malaysia Mexico Brazil Russia Slovakia UK and US Default is US Note See the Ring Tones Table on page 20 for valid values For per line configuration 3 In the Ring Tone section select a line for which you want to set ring tone 4 Select a value from the LineN field Note See the Ring Tones Table on page 20 for valid values 5 Click Save Settings 22 41 001376 00 Rev 01 06 2013 Customizing Your Phone Contrast Level The Contrast Level option on the IP phone allows you to set the amount of light that illuminates the LCD display
78. Pickup 3 Line he 3 v 4 Paging xi 5 6 7 Speeddial v 9051234567 ln a 8 XML http 10 70 3 7 ml menu menu php source all 2 Select from Key 1 through Key 8 Keys 5 and 6 can be made configurable only by your system administrator 3 In the Type field select Flash 4 Click Save Settings 60 41 001376 00 Rev 01 06 2013 Line Keys and Programmable Keys Automatic Call Distribution ACD Key for Sylantro Servers The 6730i supports Automatic Call Distribution ACD for Sylantro servers The ACD feature allows the Sylantro server to distribute calls from a queue to registered IP phone users agents To use the ACD feature on an IP phone you must first configure an ACD key When you want to subscribe to a queue in order to receive incoming calls you press the ACD key and the IP phone UI prompts you to specify the following informa tion User ID the phone number s used to login into the queue e Password the password used to login to the queue Available unavailable Shows the current status of the IP phone Specifies if the IP phone user is available unavailable to receive a call from the queue Note Your System Administrator must provide you with your User ID and Password to access the applicable phone queue After creating an ACD key you are ready to receive calls from a queue on the server You must press the ACD key and then log in by entering your User ID and Password An Avail
79. Play Call Waiting Tone Stuttered Dial Tone e XML Beep Support e Status Scroll Delay seconds e Switch UI Focus to Ringing Line e Call Hold Reminder During Active Calls e Call Hold Reminder e Call Waiting Tone Period Preferred Line e Preferred Line Timeout seconds e Message Waiting Indicator Line DND Key Mode e Call Forward Key Mode This category also allows you to configure e Incoming Intercom Call Settings Group Paging RTP Settings e Ring Tones global and per line basis Time and Date Settings e Language Settings Account Configuration Allows you to configure Do Not Disturb DND and Call Forwarding CFWD by account You can have multiple accounts on the 6730i 41 001376 00 Rev 01 06 2013 15 Phone Status You can view the status of your phone using the IP Phone UI or the Aastra Web UI Phone Status via IP Phone UI The Phone Status option on the IP phone displays the status of your phone to the LCD display This option allows you to view your phones Network status including your phone s IP and MAC address e Local Area Network LAN port information e PC Port information if PC link exists e Firmware version Error messages from the last reboot or startup e Copyright information Use the following procedure to view the status of your phone using the IP Phone UI Q IP Phone UI 1 Press on the phone to enter the Options List 2 Select Phone Status 3 Select the opt
80. T AU Sydney EST AU Broken Hill CST AU Brisbane EST AU Lindeman EST AU Adelaide CST AU Darwin CST AU Perth WST AW Aruba AST AZ Baku AZT BA Sarajevo EET BB Barbados AST BE Brussels CET BG Sofia EET BM Bermuda AST BO La Paz BOT BR Noronha FNT BR Belem BRT BR Fortaleza BRT BR Recife BRT BR Araguaina BRS BR Maceio BRT BR Sao Paulo BRS BR Cuiaba AMS BR Porto Velho AMT BR Boa Vista AMT BR Manaus AMT BR Eirunepe ACT BR Rio Branco ACT BS Nassau EST BY Minsk EET BZ Belize CST A 1 41 001376 00 Rev 01 06 2013 Appendix A Time Zone Codes Time Zone Name Time Zone Code CA Newfoundland NST CA Atlantic AST CA Eastern EST CA Saskatchewan EST CA Central CST CA Mountain MST CA Pacific PST CA Yukon PST CH Zurich CET CK Rarotonga CKS CL Santiago CLS CL Easter EAS CN Beijing CST CO Bogota COS CR Costa Rica CST CU Havana CST CY Nicosia EES CZ Prague CET DE Berlin CET DK Copenhagen CET DM Dominica AST DO Santo Domingo AST EE Tallinn EET ES Madrid CET ES Canary WET Fl Helsinki EET FJ Fiji NZT FK Stanley FKS FO Faeroe WET FR Paris CET GB London GMT GB Belfast GMT GD Grenada AST GE Tbilisi GET GF Cayenne GFT Gl Gibraltar CET GP Guadeloupe AST GR Athens EET GS South Georgia GST GT Guatemala CST GU Guam CST GY Guyana GYT HK Hong Kong HKS HN Tegucigalpa EST HR Zagreb CET HT Port au Prince EST HU Budapest CET IE Dublin GMT IS Reykjavik GMT IT Rome CET JM Jamaica EST JP Tokyo JST
81. Tone Enabled Stuttered Dial Tone Enabled XML Beep Support Enabled Status Scroll Delay seconds 5 Switch UI Focus To Ringing Line Enabled Call Hold Reminder During Active Calls DJ Enabled Call Hold Reminder Cl Enabled Call Waiting Tone Period 0 Preferred line 1 v Preferred line Timeout seconds 0 Message Waiting Indicator Line All DND Key Mode Phone w Call Forward Key Mode Account w 2 Acall waiting tone is enabled by default If required disable the Play Call Waiting Tone field by unchecking the check box 3 Click Save Settings 140 41 001376 00 Rev 01 06 2013 Additional Features Stuttered Dial Tone You can enable or disable the playing of a stuttered dial tone when there is a message waiting on the IP phone You can configure this feature using the Aastra Web UI Configuring Stuttered Dial Tone La Aastra Web UI Use the following procedures to configure stuttered dial tone on the IP phone Note Stuttered Dial Tone is enabled by default 1 Click on Basic Settings gt Preferences gt General Preferences General Display DTMF Digits C Enabled Play Call Waiting Tone Enabled Stuttered Dial Tone Enabled XML Beep Support Enabled Status Scroll Delay seconds 5 Switch Ul Focus To Ringing Line Enabled Call Hold Reminder During Active Calls DJ Enabled Call Hold Reminder Cl Enabled Call Waiting Tone Period 0 Preferred line 1 v P
82. UV8 tuv8 9 WXYZ9 wxyz9 gt lt SPACE gt lt SPACE gt A 34 41 001376 00 Rev 01 06 2013 Customizing Your Phone Configuring Language Input Using the IP Phone UI You can configure the language you use for inputting on the phone by setting the Input Language option The default input language setting is English You can change this setting using the IP Phone UI or the Aastra Web UI For Example 4 Input Language 7 Language 2 Input Language gt English Y v Next gt Enter w Next gt Enter w Next gt Set Language Option Input Language Option Select an Input Language amp IP Phone UI Use the following procedure to change the input language using the IP Phone UI 1 Press on the phone to enter the Options List 2 Select Preferences 3 Select Language 4 Select Input Language Select the language you want to use when inputting text and characters into the IP Phone UI Valid values are English default e Fran ais French Espa ol Spanish Deutsch German Italiano Italian e Portugu s Portuguese e Pyccku Russian e Nordic Note Available input languages are dependent on the configuration enabled by your System Administrator 5 Press Set when you have selected an input language La Aastra Web UI Use the following procedure to set the input language using the Aastra Web UI 1 Click on Basic Settings
83. Use this option to set the preference of contrast level You can set the contrast level using the IP Phone UI only Setting Contrast Level Q IP Phone UI 1 Press on the phone to enter the Options List Select Preferences Select Contrast Level Use the lt q and p gt navigation keys to increase or decrease the intensity of contrast lighting on the LCD Qm Bb YU N Press Select to save your selection Live Dialpad The Live Dialpad option on the IP phone turns the Live Dial Pad mode ON or OFF With live dial pad ON the 6730i IP phone automatically dials out and turns ON Handsfree mode as soon as a dial pad key or programmable key is pressed With live dial pad OFF if you dial a number while the phone is on hook lifting the receiver or pressing the a initiates a call to that number Availability of feature dependant on your phone system or service provider You can enable disable the live dialpad using the IP Phone UI only Enabling Disabling Live Dialpad IP Phone UI 1 Press on the phone to enter the Options List Select Preferences Select Live Dialpad Use the navigation keys to navigate to ON or OFF Qm W N Press Set to save your selection 41 001376 00 Rev 01 06 2013 23 Customizing Your Phone Set Audio The Set Audio option on the IP Phone allows you to set the audio mode for your IP phone It also allows you to set the volume level of the headset
84. a maximum of 1 Voicemail access phone number The Voicemail list displays a list of phone numbers assigned to the 6730i that have registered voicemail accounts associ ated with them Note The Voicemail list does not display the voicemail access number The phone displays up to 99 voicemail messages for an account even if the number of voicemails exceeds the limit Registered account numbers URIs that exceed the length of the screen either with or without the voicemail icon and the message count are truncated with an ellipse character at the end of the number URI string The end of the Voicemail list displays the number of new voicemail messages if any exist Contact your System Administrator for lines configured for Voicemail Using Voicemail Q IP Phone UI 1 Press the key on the phone that your System Administrator set up to access voicemail After pressing the key the phone dials to access the voicemail server 2 Use the Y and keys to scroll through the line items in the Voicemail list 3 When you have selected a line item press the speaker key p gt Scroll Right key or press a line key to make an outgoing call using the voicemail access phone number associated with the line for which the voicemail account is registered From a selected item in the Voicemail list you can also lift the handset go offhook to make an outgoing call using the voicemail access phone number 41 001376 00 Rev 01 06 2013 137
85. able key displays allowing you to make your phone available to accept these calls When you are on an active call or you miss a call the server automatically changes the phone s status to unavailable The server updates it s database with this new information and no longer distributes calls to the phone The phone remains in this unavailable state until you make yourself available again by pressing the Available key e an ACD timer expires set by your System Administrator You can also choose to manually change the phone status to unavailable by pressing the Unavailable key on the phone Note It is recommended you configure no more than a single ACD key or programmable key per IP phone 41 001376 00 Rev 01 06 2013 61 Line Keys and Programmable Keys Configuring an Automatic Call Distribution ACD Key Use the following procedure to configure ACD on the 6730i IP Phone La Aastra Web UI Note Keys 5 and 6 SAVE and DELETE keys can be made configurable ONLY by your System Administrator 1 Click on Operation gt Programmable Keys Programmable Keys Configuration Key Type Value Line 1 Auto call distribution v Ja v 2 Pickup v 3 Line v 3 gt 4 Paging v 5 A r 7 Speeddial 9051234567 4 v 8 XML http 10 70 3 7 xml menu menu php source all 2 Select from Key 1 through Key 8 Keys 5 and 6 can be made configur
86. able only by your system administrator 3 In the Type field select Auto call distribution 4 Inthe Line field select a line to apply Automatic call distribution Valid values are 1 through 6 Note It is recommended you configure no more than a single ACD programmable key per IP phone 5 Click Save Settings Using the ACD Feature on your IP Phone The ACD feature allows you to login to a phone queue in order to receive distributed calls on your IP phone To login to a phone queue you must pre configure an ACD key on your IP Phone as described in the previous procedure Your Administrator sets up the queue that you access when you press the ACD Key Contact your System Administrator for more information When you press the ACD Key the phone prompts you to enter a User ID and Password to login into the queue Once logged in you can make your phone available or unavailable to take calls by pressing the Available Unavailable Key W The server monitors your IP phone status When you set the IP phone to available the server begins distributing calls to your phone When you set the IP phone to unavailable the server temporarily stops distributing calls to your phone The LED for the ACD Key shows the current status of your phone 62 41 001376 00 Rev 01 06 2013 Line Keys and Programmable Keys ACD LED Table This LED changes when you log into the phone queue and are available to take calls The LED change
87. about available functions using these keys These keypad keys can be used for any of the following on the phone Dial a phone number to make a call see Dialing a Number on page 93 Enter digits or letters in the IP Phone user interface Program a speed dial number see Creating a Speed Dial Key on page 46 Press a speed dial key see Creating a Speed Dial Key on page 46 Press the keys associated with a called Interactive Voice Response IVR system 10 41 001376 00 Rev 01 06 2013 Methods for Customizing Your Phone There are two ways to customize specific options on your phone e Using the Options key on the IP Phone e Using the Aastra Web UI in an Internet browser window from your PC Phone Options via the IP Phone UI You can customize your phone by pressing the Options key and accessing the IP Phone UI These options allow you to customize the following phone settings OptionNumber Option 1 Call Forward 1 All 2 Busy 3 No Answer 4 All Off 5 AllOn The menus that display for Call Forward are dependant on the Call Forward Mode set on the phone Default is Account mode 2 Preferences 1 Tones Ring Tone Tone Set 2 Contrast Level 3 Speed Dial Edit 4 Live Dialpad 5 Set Audio Audio Mode Headset Mic Vol 6 Time and Date Time Format Daylight Savings Date Format Time Zone Time Server 1 Time Server 2 Time Server 3 Set Time Set Date 7 Language Screen Language Inp
88. ace the handset if in use on hook Using the Keypad During Active XML Applications If enabled by your Administrator the 6730i IP Phone can allow you to continue using your keypad keys during active XML applications on your phone This feature is applicable only when your phone is in the connected state By default the phone suppresses dialpad events when an XML object is in focus so your Administrators must enable the keypad to be used during active XML applications Contact your System Administrator for more information 158 41 001376 00 Rev 01 06 2013 Available Features Enabled by Administrators Key Redirection Conference Transfer Redial Intercom Keys and Voicemail Option If enabled by your Administrator the Conference Transfer Redial and Intercom keys as well as the Voicemail option can be redirected to XML scripts This allows the server to provide the phone with Redial Transfer Xfer Conference Conf and Intercom Icom key features and the Voicemail option feature rather then accessing them from the phone side By default the server side keys function the same as the phone side key features Notes 1 Key remapping takes precedence over redirecting 2 Disabling the redial conference or transfer features on the phone also disables the redirection of these keys Contact your System Administrator for more information about this feature Options Key If enabled by your Administrator the Services Menu on the
89. ages e English Czech e Catalan e Valencian e Welsh e German e Danish Spanish e Mexican Spanish e Finnish e French e Canadian French e Italian e Dutch e Dutch Netherlands e Norwegian e Polish e Portuguese e Portuguese Brazilian e Russian Slovak Swedish e Turkish You can also configure the language to use when inputting values in the Aastra Web UI and the IP Phone UI Specifying the Language to Use Once the language pack s are available on your phone from your System Administrator you can specify which language to use on the phone and or the Aastra Web UI Note All languages may not be available for selection The available languages are dependant on the language packs cur rently loaded to the IP phone 30 41 001376 00 Rev 01 06 2013 Customizing Your Phone IP Phone UI Use the following procedure to specify which language to use for the IP Phone UI 1 2 3 4 Press on the phone to enter the Options List Select Preferences Select Language Select Screen Language The language setting displays a check mark indicating this is the current language on the IP Phone Using the Y and keys scroll through the languages Note All languages may not be available for selection The available languages are dependant on the language packs cur rently loaded to the IP phone English is the default language and cannot be changed or removed For
90. al Using a Programmable Key La Aastra Web UI Note Keys 5 and 6 SAVE and DELETE keys can be made configurable ONLY by your System Administrator 1 Click on Operation gt Programmable Keys Programmable Keys Configuration Key Type Value Line 1 Park v 2 Pickup v 3 Line v 3 v 4 Paging v 5 6 7 Speeddial 9051234567 E v 8 XML http 10 70 3 7 xmli menu menu php source all 2 Select from Key 1 through Key 8 Keys 5 and 6 can be made configurable only by your system administrator 3 Inthe Type field select Speed Dial to apply to the key 4 Inthe Value field enter the phone number extension or speed dial prefix to apply to this hard key If you enter a speed dial prefix you must enter the character at the end of the prefix number for example 123456 5 In the Line field select a line for which to apply the speed dial to Valid values are 1 through 6 6 Click Save Settings 50 41 001376 00 Rev 01 06 2013 Line Keys and Programmable Keys Creating Speed Dial Key Using Keypad Speed Dial in the Aastra Web UI La Aastra Web UI 1 Click on Operation gt Keypad Speed Dial Keypad Speed Dial Key 1 2 oOo G N oO 0 Value 9051234567 Line 4771 2 Select from K
91. al damages including but not limited to loss damage or expense directly or indirectly arising from your use of or inability to use this product either separately or in combination with other equipment This paragraph however is not intended to have the effect of excluding restricting or modifying the application of all or any of the provisions of Part 5 4 of Schedule 2 to the Competition and Consumer Act 2010 the ACL the exercise of a right conferred by sucha provision or any liability of Aastra in relation to a failure to comply with a guarantee that applies under Division 1 of Part 3 2 of the ACL to a supply of goods or services This express warranty sets forth the entire liability and obligations of Aastra with respect to breach of this express war ranty and is in lieu of all other express or implied warranties other than those conferred by a law whose application can not be excluded restricted or modified Our goods come with guarantees that cannot be excluded under the Australian Consumer Law You are entitled to a replacement or refund for a major failure and for compensation for any other rea sonably foreseeable loss or damage You are also entitled to have the goods repaired or replaced if the goods fail to be of acceptable quality and the failure does not amount to a major failure Warranty 2 41 001376 00 Rev 01 06 2013 Limited Warranty Australia Only Warranty Repair Services Procedure Should the product fail during the W
92. and DELETE keys can be made configurable ONLY by your System Administrator 1 Click on Operation gt Programmable Keys Programmable Keys Configuration Key Type Value Line 1 Phone Lock J Ih 2 Pickup v 3 Line v 3 v 4 Paging al 5 6 Delete 7 Speeddial m sos1234587 o CN 8 XML x http 10 70 3 7Xmlmenu menu php source all 2 Select from Key 1 through Key 8 Keys 5 and 6 can be made configurable only by your system administrator 3 In the Type field select Phone Lock 4 Click Save Settings Note You can lock unlock the phone using the new key you just configured using the Aastra Web Ulat the path Operation gt PhoneLock or using the Phone Lock option on the IP Phone Ul at the path Options gt Phone Lock For more informa tion about using the lock unlock feature see Phone Lock on page 39 41 001376 00 Rev 01 06 2013 87 Line Keys and Programmable Keys Using the Lock Unlock Key on the IP Phone After configuring a key as a lock unlock key refer to the following procedure to use the key on the IP phone lt IP Phone UI Lock the Phone 1 Press the Lock key The phone locks The LED for the key remains lit Unlock the Phone 2 Press the Lock key A password prompt displays 3 Enter your user password and press ENTER The phone unlocks The LED for the key AND the Message Waiting Lamp go OFF The
93. arranty Period and you wish to make a claim under this express warranty please contact the Aastra authorized reseller who sold you this product details as per the invoice and present proof of purchase You will be responsible for shipping charges if any Manufacturer Aastra Telecom Australia Pty Ltd 745 Springvale Road Mulgrave VIC 3170 ABN 16 140 787 195 Phone 61 3 8562 2700 Limitation of Liability for Products not of a kind ordinarily acquired for personal domestic or household use or consumption e g goods services ordinarily supplied for business use 1 1 To the extent permitted by law and subject to clause 1 2 below the liability of Aastra to you for any non compliance witha statutory guarantee or loss or damage arising out of orin connection with the supply of goods or services whether for tort including negligence statute custom law or on any other basis is limited to a inthe case of services i the resupply of the services or ii the payment of the cost of resupply and b inthe case of goods i the replacement of the goods or the supply of equivalent goods or ii the repair of the goods or iii the payment of the cost of replacing the goods or of acquiring equivalent goods or iv the payment of the cost of having the goods repaired 1 2 Clause 1 1 is not intended to have the effect of excluding restricting or modifying a theapplication of all or any of the provisions of Part 5 4 of Schedule 2 to the Comp
94. at records the length of your call If the Live DialPad option is on as soon as you press the first digit on the dial pad the phone automatically selects the next available line go off hook and dial as digits are pressed Using Handsfree Speakerphone The handsfree feature allows you to speak to someone without using the handset or headset Your phone must be in either the Speaker or Speaker Headset audio mode For more information about setting the audio mode on your phone see Set Audio on page 24 IP Phone UI e To dial using handsfree first press O and enter a number at the dial tone To answer a call on your phone using handsfree press O or the line call appearance key If you are in Speaker audio mode lift the handset and press Cy to switch between handsfree and handset Ifyou are in Speaker headset audio mode press O to switch between handsfree and headset e When the handset is on hook press to disconnect the call When handsfree is on the speaker light turns on Note The 6730i supports handsets or headsets using the same jack Both a handset and a headset cannot be connected at the same time 41 001376 00 Rev 01 06 2013 93 Making Calls Using a Headset The 6730i accepts headsets through the modular RJ9 handset jack on the back of the phone Contact your telephone equipment retailer or distributor to purchase a compatible headset Note Customers should read and observe all safety reco
95. ates this caller has called twice The display shows 9054550055 the date and time of the last call from that caller Jun 8 2 41pm 2X Managing Calls You can view scroll and delete line items in the Callers List from the IP phone Ul You can also directly dial from a displayed line item in the Callers List Accessing the Callers List Y IP Phone UI Use the following procedure to access the Callers List 1 Press the Callers List Key C Press Y and to move through the Callers list Press Y to see the most recent call or to see the oldest call on your list 2 To dial the displayed number just press Co or lift the Handset or press any line keys 3 Press the Callers List Key to cancel 41 001376 00 Rev 01 06 2013 117 Managing Calls Editing Entries in the Callers List Important The Caller List does not save changes Editing in the Callers List is generally used if you plan to call the number and need to add a prefix In the Callers List if a dial pad key is pressed when a number and or a name is displayed the cursor automatically adds the digit at the left side of the number to enable the entry of the prefix IP Phone UI 007 John Burns 9054550055 N Jun 8 2 55pm Use the following procedure to edit the Callers List 1 Press the Callers List Key cC 2 Press Y and to find the entry you want to edit Press Y to view the most recent call or to see the oldest call on yo
96. bove example indicates the idle screen for the first line appearance You can use the left and right arrow keys to scroll through the idle screens for all six line appearances on the 6730i This screen is shown whenever your phone is not in use Idle Screen 2 The second display line displays the following temporary messages if the event occurs e No Service e DHCP Failed Restarting New IP Obtained e Network Disconnected Connected Note Since Network Disconnected Connected displays on two lines the date and time does not show if this event displays The second line can also display the following status messages listed in order of display priority e Call forward status DND On Do Not Disturb Number of missed calls When more than one status message displays the Y is shown after the message to indicate you can use the Y and navi gation keys to scroll through the remaining messages John Burns CFWD All v Jun8 2 55pm 2 A Network Connected 41 001376 00 Rev 01 06 2013 5 Getting Started Incomplete Configuration If your phone displays an Incomplete Config message without any extension or user name at the end of the start up sequence instead of an Idle state screen this indicates the phone configuration that was downloaded from the configu ration server is not complete or correct Contact your System Administrator for assistance No Service When the phone is not properly connected to the n
97. call bridging and allows two or more SCA users to be connected in a call with a third party Refer to the following example Phone 1 SCA phone 1 answers When 2 and 3 pickup 1 can hangup Phone A calls the SCA number and all the phones in the SCA environment ring SCA phone 2 joins by or pressing SCA line When Phone 2 phone 1 hangs up 2 is still n ee n SCA Environment Connected Phone 2 can press the line key to put SCA call on hold leaving 3 still connected to 1 Phone 3 SCA phone 3 joins by amp lt 7 pressing SCA line When phone 1 hangs up 3 is still connected Phone 3 can press the line key to put SCA call on hold leaving 2 still connected Note A user can place a call on hold while in an SCA bridged call by pressing the SCA line key tod o 1 Using the example above when a call comes into Phone 1 Phone 2 and Phone 3 can pickup the same call by pressing the SCA line key Phone 2 and 3 display the call they are bridging into on the LCD of the phones Existing SCA parties ina bridge or one to one call hear an audible beep when another party has joined the call Note Your Administrator must enable disable the beep on the server side If a phone is configured for SCA bridging and it attempts to join a call but the account on the server does not have this functionality enabled an error message displays to the LCD on the phone The SCA call bridging feature is disabled by default on all phones Your
98. ce Ending Calls Q IP Phone UI To end a call you first need to connect or reconnect to the call if not already connected for example if your caller is on hold Press 5 or the line call appearance key of the active call to end the call If connected through the handset you can also place the handset back on hook to end the call 41 001376 00 Rev 01 06 2013 107 Managing Calls The 6730i has several features that make it easier to manage calls and to keep track of your caller history as well as your business and personal contacts These features include Directory List e Callers List Call Forwarding e Missed Calls Indicator Voicemail Directory List The Directory List is your personal phone book conveniently stored within your phone You can enter up to 200 entries into the 6730i Directory by adding them manually or by saving the number and name from other lists stored on your phone You can also dial directly from a directory entry Each entry can contain a maximum of 16 letters and numbers On the 6730i you access the Directory by pressing the Directory Key Key 7 Accessing Your Directory lt IP Phone UI Use the following procedure to access your Directory List Use the following illustration as a reference Directory Key 1 Press the Directory Key Key 7 The directory displays
99. ce ccc cece eee cece eee narrar 153 Shared Call Appearance SCA Call Bridging 154 Available Features Enabled by Administrators 156 Outgoing intercom Calls i vicario eii act cena de paa pag fe resale wel Big qaa a was Bibs 156 41 001376 00 Rev 01 06 2013 v Contents Missed Call Summary Subscription 0 0 c cece e eee eee eee ee ence arenero 156 Customizable Callers List Key u ccc ccc enn has aspa ant rar rr 156 Autodial Hotline and Warmline siege ce sin sence Yin ee ea hen Sto Hoare win 1 sto Haan dias Bin Pel aed RE 157 Centralized Conferencing 5 2 0 eviewesdasaewceuds dasa ead eee aro 157 Answer and Ignore Keys for XML Applications 158 Playing a WAV File On YOUFPRONE 00000 ove cicadas ote cd data eek ad ee a en ed 158 Using the Keypad During Active XML Applications 0 0 c cece cece eee cee e nee e ee ee ence acc 158 LOA E uu uuu uay EE LR 159 XML Applications and Off Hook Interaction 159 XML Override for a Locked Phone 0 0 c cee n cece nee eee anar rr 160 RTP Recording and Simultaneous Playing 160 Hold Feature Enhancement for Broadsoft Servers
100. ck Save Settings 146 41 001376 00 Rev 01 06 2013 Additional Features Call Waiting Tone Period You can specify a specific time period in seconds for the call waiting tone to play at regular intervals on an active call using the parameter Call Waiting Tone Period A value of 0 is the default and plays the call waiting tone only once on the active call When the incoming caller hangs up the call waiting tone stops on the existing active call You can enable or disable this feature in the Aastra Web UI Configuring Call Waiting Tone Period Use the following procedure to configure Call Waiting Tone Period La Aastra Web UI 1 Click on Basic Settings gt Preferences gt General Preferences General Display DTMF Digits C Enabled Play Call Waiting Tone Enabled Stuttered Dial Tone M Enabled XML Beep Support M Enabled Status Scroll Delay seconds 5 Switch UI Focus To Ringing Line M Enabled Call Hold Reminder During Active Calls Cl Enabled Call Hold Reminder C Enabled Call Waiting Tone Period 0 I Preferred line 1 sJ Preferred line Timeout seconds 0 Message Waiting Indicator Line All vi DND Key Mode Phone vw Call Forward Key Mode Account w 2 In the Call Waiting Tone Period field enter a time period in seconds that the call waiting tone will be audible on an active call when another call comes in Default is 0 seconds 3 When enabled
101. conference For incoming calls the phone switches back immediately after the call ends transfer For incoming or outgoing calls the current behavior is that the same line used to transfer the call does not change For incoming calls the phone switches back immediately after the call transfers blf The phone switches back immediately after the call ends park The phone switches back immediately after the call ends voicemail The phone switches back immediately after the call ends redial The phone switches back immediately after the call ends dialing For incomplete dialing on a non preferred line the focus does not change if some digits are entered If no digits are entered or digits were cleared the focus changes to preferred line after the time out has passed without activities caller id Ifthe Switch UI Focus To Ringing Line parameter is disabled the User is able to see the Caller ID when the phone switches the focus to the ringing line factory default Factory default and recovery mode clears the preferred line and preferred line timeout parameters and the phone operates in a non preferred line mode Notes 1 If you specify a value of 0 for the preferred line parameter it disables the preferred line focus feature 2 If you specify a value of 0 for the preferred line timeout parameter the phone returns the line to the preferred line immediately 148 41 001376 00 Rev 01 06 2013 Conf
102. ction listed in the previous table 44 41 001376 00 Rev 01 06 2013 Line Keys and Programmable Keys Line Key You can set a programmable key to act as a line call appearance key on the 6730i The key acts as a line that behaves the same as a hard line key L1 and L2 For more information about the behavior of line keys see Multiple Line and Call Appearance Keys on page 42 You use the Aastra Web Ul to set a Line key Configuring a Line Key La Aastra Web Ul Note Keys 5 and 6 SAVE and DELETE keys can be made configurable ONLY by your System Administrator Use the following procedure to set a Line key on your phone 1 Click on Operation gt Programmable Keys Programmable Keys Configuration Key Type Value Line 1 Park v 2 Pickup J 3 Line amp 3 w 4 Paging _ 5 6 7 Speeddial M 9051234567 _ i r 8 XML v http 10 70 3 7 xml menu menu php source all 2 Select from Key 1 through Key 8 Keys 5 and 6 can be made configurable only by your System Administrator 3 Inthe Type field select Line to apply to the key 4 Inthe Line field select a line for which to apply this key Valid values are 3 through 6 5 Click Save Settings 41 001376 00 Rev 01 06 2013 45 Line Keys and Programmable Keys Creating a Speed Dial Key The normal function of the speed dial option allows you to dial a number quickly by pressi
103. cts an Icr request it translates this request and routes the call to the last caller Configuring a Last Call Return Key La Aastra Web UI Note Keys 5 and 6 SAVE and DELETE keys can be made configurable ONLY by your System Administrator 1 Click on Operation gt Programmable Keys Programmable Keys Configuration Key Type Value Line 1 Last Call Return 110 y 2 Pickup y 3 Line v E g 4 Paging a o 5 i 7 Speeddial v 9051234567 IE v 8 XML v http 10 70 3 7 xmlmenu menu php source all 2 Select from Key 1 through Key 8 Keys 5 and 6 can be made configurable only by your system administrator 3 In the Type field select Last Call Return 4 Inthe Line field select the line to apply this feature Valid values are 1 through 6 5 Click Save Settings 74 41 001376 00 Rev 01 06 2013 Call Forward Key Line Keys and Programmable Keys Using the Aastra Web UI you can configure the Call Forward function on a key Use call forwarding when you want a spe cific account on your phone to be forwarded to another number when your phone is in the busy state or the no answer state or both Pressing the Call Forward key on the phone accesses the Call Forward Menus The menus that display are dependant on the Call Forward mode Account default Phone or Custom configured for the phone For more information about call fo
104. de Account w 2 Inthe DND Key Mode field select a Do Not Disturb DND mode to use on the phone Valid values are Account Phone default Custom Default is Phone account Sets DND for a specific account DND key toggles the account in focus on the phone to ON or OFF phone default Sets DND ON for all accounts on the phone DND key toggles all accounts on the phone to ON or OFF custom Sets the phone to display custom screens after pressingthe DND key that list the account s on the phone The user can select a specific account for DND turn DND ON for all accounts or turn DND OFF for all accounts Notes 1 If there is only one account configured on the phone then the mode setting is ignored and the phone behaves as if the mode was set to Phone 2 Using the Aastra Web UI if you change the DND Key Mode to phone all accounts synchronize to the current set ting of Account 1 3 Click Save Settings The changes takes affect immediately without a reboot 41 001376 00 Rev 01 06 2013 121 Managing Calls 4 Click on Basic Settings gt Account Configuration Account Configuration Account DND Call Forward State Label No Rings 1 Stacy Donaldson v All Fl Busy NoAnswer O 1 vw 2 905 1234567 All Fl Busy oO No Answer Fi 1 xi Save Settings 5 For each account enable DND by placing a check mark in the box Disable DND by unchecking the box
105. de CET Index Numerics 6730i A AN 11 20 feature getting started idle screens incomplete configuration message installation and setup keys and key descriptions no service message plugging in the phone requirements A Aastra Web UI Operaton Parameters sissaiiisssissisirrnsawuinaniiiannnsdinranianias 15 phone status about this guide se account configuration account status 19 ACD key allow barge in for intercom audio setting auto answer for intercom autodial hotline and warmline ccc 157 B BLF key 57 BLF list BLF List key 58 BLF Xfer BLF Xfer key BLF Xfer softkeys for 77 79 80 C call destination displaying l u 163 Call Forward key call forwarding softkeys for call hold reminder call hold reminder during active calls call waiting tone call waiting tone period callers list downloading to phone callers list key callers list key customizable calls ending calls handling calls making calls managing calls placing on hold calls receiving calls transferring conference calls conference key conferencing centralized 157 Index 1 nro iaro E A A E T AE joining additional parties joining two active calls local multiple conferences pre dial and live dial mode transfer remaining parties contrastlevel ssssssss
106. des CFWD key LED RED if CFWD All CFWD MWI LED ON if current account in focus has Busy or CFWD No Answer is enabled for CFWD ALL enabled the account in focus CFWD key LED OFF if any CFWD mode is disabled MWI LED OFF if CFWD All is disabled Note If you make changes to the configuration for CFWD via the IP Phone UI you must refresh the Aastra Web UI screen to see the changes 41 001376 00 Rev 01 06 2013 125 Managing Calls Configuring CFWD Using the Aastra Web UI La Aastra Web UI Use the following procedure to configure CFWD using the Aastra Web UI 1 Click on Basic Settings gt Preferences gt General Preferences General Display DTMF Digits Play Call Waiting Tone Stuttered Dial Tone XML Beep Support Status Scroll Delay seconds Switch Ul Focus To Ringing Line Call Hold Reminder During Active Calls Call Hold Reminder Call Waiting Tone Period Preferred line Preferred line Timeout seconds Message Waiting Indicator Line DND Key Mode Call Forward Key Mode C Enabled Enabled M Enabled v Enabled 5 Enabled C Enabled O Enabled 0 f S 0 at Z Phone x Account w 2 Inthe Call Forward Key Mode field select a call forward mode to use on the phone Valid values are Account Phone Custom Default is Account e Account default The account mode allows you to configure CFWD on a per account basis Pressing a configured
107. digits on the IP phone Note Suppress DTMF Playback is enabled by default 1 Click on Basic Settings gt Preferences gt General Preferences General Display DTMF Digits C Enabled Play Call Waiting Tone M Enabled Stuttered Dial Tone M Enabled XML Beep Support M Enabled Status Scroll Delay seconds 5 Switch Ul Focus To Ringing Line M Enabled Call Hold Reminder During Active Calls C Enabled Call Hold Reminder Cl Enabled Call Waiting Tone Period o o Preferred line 1 w Preferred line Timeout seconds 0 Message Waiting Indicator Line All DND Key Mode Phone v Call Forward Key Mode Account 2 Enable the Display DTMF Digits field by checking the check box Disable this field by unchecking the box Default is disabled 3 Click Save Settings 41 001376 00 Rev 01 06 2013 139 Additional Features Play Call Waiting Tone You can enable or disable the playing of a call waiting tone when you are on an active call and a new call comes into the phone You can configure this feature using the Aastra Web UI Configuring Call Waiting Tone La Aastra Web UI Use the following procedures to configure a call waiting tone on the IP phone Note Play Call Waiting Tone is enabled by default 1 Click on Basic Settings gt Preferences gt General Preferences General Display DTMF Digits C Enabled Play Call Waiting
108. e Line SIP Account Status 1 650 proxy com 5060 Registered where Account Number is 1 SIP Account is 650 proxy com on port 5060 Status is Registered Backup registrar is used Yes Backup Registrar Used Yes SIP Error Number Displays on accounts when registration fails with the SIP proxy server Example Line SIP Account Status 4 653 proxy com 5060 401 where Account Number is 4 SIP Account is 653 proxy com on port 5060 Status is 401 Unregistered if SIP registration fails Backup registrar is used No Backup Registrar Used No 41 001376 00 Rev 01 06 2013 19 Customizing Your Phone The following paragraphs describe the options available from either the IP Phone UI the Aastra Web UI or both and pro vide procedures applicable to the option Ring Tones and Tone Sets You can configure ring tones and ring tone sets on the IP phone Ring Tones There are several distinct ring tones a user can select from to set on the IP phones You can enable disable these ring tones on a global or per line basis The following table identifies the valid settings and default values for each type of configuration method Ring Tones Table Configuration Method Valid Values Default Value IP Phone Ul Global Global Setting Tone 1 Tone 1 Tone 2 Tone 3 Tone 4 Tone 5 Silent Aastra Web UI Global Global Setting Tone 1 Tone 1 Tone 2 T
109. e Change key and select a different line or use the phone s keypad to select a number 1 9 or use the Y and A to make your selection Line 1 AY Change lt Cancel p Save 7 Press Save to save the speed dial key to the line specified 48 41 001376 00 Rev 01 06 2013 Line Keys and Programmable Keys Creating a Speed Dial Key Using the Save Key amp IP Phone UI Use the following procedure to create a speed dial key using the Save key Use the following illustration for reference Key 1 Save Key 5 Key 2 Delete Key 6 Key 3 Key 7 Key 4 Key 8 1 Press the Save key The screen displays Save to Save to 2 Select a programmable key you want to save to 3 At the Enter Number prompt use the dial pad key to enter the number Enter Number gt 5553491234 4 Press the Save key to save the speed dial configuration By default the phone automatically assigns the speed dial key to line 1 if available To select a different line press the Change key and select a different line or use the phone s keypad to select a number 1 9 or use the Y and to make your selection Line 1 AY Change lt Cancel p Save 5 Press the Save key to finish Saved Memory key 5553491234 41 001376 00 Rev 01 06 2013 49 Line Keys and Programmable Keys Creating a Speed Di
110. e Line 1 press Save to save the new entry to the Directory List If you want the new entry to use a different line use the Y key to select a different Line and press Save The new entry you added is saved to the Directory List Saved Directory John Burns 110 41 001376 00 Rev 01 06 2013 Managing Calls Edit an Entry in the Directory List Q IP Phone UI Use the following procedure to edit an entry in the Directory List Use the following illustration as a reference M Save Key Directory Key 1 Press the Directory Key 2 Access the entry you want to edit by pressing the first letter of the name on the dial pad or use Y and to scroll through the list to find the name Press 1st letter Use to view 3 To begin editing press ef Press lt again to erase the numbers or letters to the left or use the dial pad to enter additional digits or characters once you have saved the number John Doe 2251 4 toedit L1 If you don t want to change the number or name just press the Directory Key or the GS Key at any time to exit 4 Press the Save Key to finish 41 001376 00 Rev 01 06 2013 111 Managing Calls Delete an Entry from the Directory List You can delete a single entry from the Directory List or you can delete all entries from the Directory List IP Phone UI Use
111. e automati cally answers Contact your System Administrator for more information Microphone Mute Allows you to enable or disable the microphone on the IP phone for Inter com calls made by the originating caller Play Warning Tone Allows you to enable or disable a warning tone to play when the phone receives an incoming intercom call on an active line Allow Barge In Allows you to enable or disable how the phone handles incoming intercom calls while the phone is on an active call Auto Answer Play Warning Tone The auto answer feature on the IP phone allows you to enable or disable automatic answering for an Intercom call If Auto Answer is enabled the phone automatically answers an incoming intercom call If Play Warning Tone is also ena bled the phone plays a tone to alert you before answering the intercom call If Auto Answer is disabled the phone treats the incoming intercom call as a normal call Auto Answer and Play Warning Tone are enabled by default Note Your Administrator can set a time period delay before the phone automatically answers Contact your System Admin istrator for more information Microphone Mute You can mute or unmute the microphone on the IP phone for intercom calls made by the originating caller If you want to mute the intercom call you enable this feature If you want to unmute or hear the intercom call you disable this feature Microphone Mute is enabled by defau
112. email or another number See Call Forward Account Based Configuration on page 124 for more information about call forwarding to other numbers On the 6730i you can set DND on the phone side for a specific account or for all accounts on the phone You can set three modes for DND using the Aastra Web UI at the path Basic Settings gt Preferences gt General gt DND Key Mode Account Phone default and Custom DND performs according to the mode you set You can then configure a DND key for the phone using the Aastra Web UI at the path Operation gt Programmable Keys You can enable and disable DND by toggling the key or by setting DND for a specific account at the path Basic Settings gt Account Configuration Once you enable DND DND displays on the LCD for the applicable account Screenname DND On Jan 1 12 96 Note If there is only one account configured on the phone then the mode setting is ignored and the phone behaves as if the mode was set to Phone The following describes the key behavior for each DND mode Account DND key toggles the account in focus on the IP Phone UI to ON or OFF if DND enabled for that account Phone default DND key toggles all accounts on the phone to ON or OFF e Custom DND key displays custom screens on the IP Phone UI User can select whether to enable disable DND per account enable DND on all accounts or disable DND on all accounts The following table describes the k
113. en the Ignore Answer line displays you can press the Right Arrow key Answer to answer the incoming call without disturbing the current XML application When you answer the call the lt q Ignore Answer line disappears from the LCD Pressing the Left Arrow key Ignore ignores the incoming call without disturbing the current XML application Contact your System Administrator for more information Playing a WAV File On Your Phone If enabled by your Administrator the 6730i IP Phone can play a WAV file A WAV file is an audio file format standard for storing an audio bit stream on a system in raw uncompressed format or compressed format to reduce the file size A WAV file is streamed to the phone using the HTTP protocol The WAV feature supports the following e Streaming of the WAV file to allow it to be locally played e Allows you to abort the audio streaming by pressing the Goodbye Gy key on the phone e Supports the HTTP file download protocol e Supports the aLaw and uLaw codecs e Plays the WAV file only if the phone is idle e WAV audio file starts only when 4 seconds of the audio data or the complete file has been accumulated e Follows the standard phone behavior of speaker head set hand set IP Phone UI Screen During WAV Streaming The 6730i screen displays the following during WAV streaming Streaming 00 10 To abort the WAV streaming press any of the following Goodbye key Drop softkey You can also pl
114. er the product is in your possession Aastra will not accept liability for any damages and or long distance charges which result from unauthorized and or unlawful use Aastra shall not be liable for any incidental or consequential damages including but not limited to loss damage or expense directly or indirectly arising from the customer s use of or inability to use this product either separately or in com bination with other equipment This paragraph however shall not apply to consequential damages for injury to the per son in the case of products used or bought for use primarily for personal family or household purposes This warranty sets forth the entire liability and obligations of Aastra with respect to breach of warranty and the warranties set forth or limited herein are the sole warranties and are in lieu of all other warranties expressed or implied including warranties or fitness for particular purpose and merchantability Warranty Repair Services Should the product fail during the Warranty Period In North America please call 1 800 574 1611 for further information Outside North America contact your sales representative for return instructions You will be responsible for shipping charges if any When you return this product for warranty service you must present proof of purchase After Warranty Service Aastra offers ongoing repair and support for this product This service provides repair or replacement of you
115. ergency services for assistance when required The emergency tele phone number may differ from country to country It is typically a three digit number so that it can be easily remembered and dialed quickly Some countries have a different emergency number for each of the different emergency services You can specify the digits to dial on the IP phone for contacting emergency services Once you specify the emergency number s on the phone you can dial those numbers directly on the dial pad when required and the phone automatically dials to those emergency services Note Contact your local phone service provider for available emergency numbers in your area The following table describes the default emergency numbers on the IP phones Emergency Number Description 911 A United States emergency number 999 A United Kingdom emergency number 112 An international emergency telephone number for GSM mobile phone networks In all European Union countries it is also the emergency telephone number for both mobile and fixed line telephones 110 A police and or fire emergency number in Asia Europe Middle East and South America You can set the emergency dial plan using the Aastra Web UI Define an Emergency Dial Plan Use the following procedure to specify the numbers to use on your phone for dialing emergency services in your area La Aastra Web UI 1 Click on Operation gt Phone Lock Phone Lock Lock or
116. erred line Preferred line Timeout seconds Message Waiting Indicator Line DND Key Mode Call Forward Key Mode C Enabled M Enabled M Enabled M Enabled 5 M Enabled C Enabled O Enabled 0 1 I J 0 All Phone vw Account 2 XML Beep Support is enabled by default If required disable the XML Beep Support field by unchecking the check box 3 Click Save Settings 142 41 001376 00 Rev 01 06 2013 Additional Features Status Scroll Delay Using the Aastra Web UI you can specify a scroll delay option that allows you to set the time delay in seconds between the scrolling of each status message on the phone You can specify this setting in the Status Scroll Delay seconds field at the path Basic Settings gt Preferences gt General The default time is 5 seconds for each message to display before scrolling to the next message You can increase or decrease this time as required Setting and saving the value in the Aastra Web UI applies to the phone immediately Configuring Status Scroll Delay La Aastra Web UI Use the following procedures to specify a status scroll delay on the IP phone 1 Click on Basic Settings gt Preferences gt General Preferences General Display DTMF Digits C Enabled Play Call Waiting Tone FV Enabled Stuttered Dial Tone Enabled XML Beep Support Enabled Status Scroll Delay seconds 5 Switch UI Focus To Ringing L
117. ess DONE the following Apply Changes screen displays Apply Changes 0 Cancel Confirm 14 Press to confirm the change s each time the Apply Changes screen displays All changes are saved to the phone 130 41 001376 00 Rev 01 06 2013 Managing Calls CFWD in Phone Mode 1 Use the RIGHT and LEFT arrow keys to scroll through each account 1 Screenname CFWD All Jan 1 12 96 Screenname2 CFWD All Jan 1 12 96 Screenname3 CFWD All Jan 1 12 96 Inthe above example Screenname Screenname2 and Screenname3 are three accounts configured on the phone All three accounts have CFWD enabled as indicated by the CFWD All message Note In Phone mode when you change the call forward configuration for an account the change applies to all accounts 2 Press the Call Forward key The Call Forward menu displays Use the UP and DOWN arrow keys to scroll through each state type Cfwd Mode Indicates 1 All Y CFWD ALL Done Change enabled Cfwd Mode 2 Bus Indicates Done gt Change no CFWD phone number Gein z H 3 NoAns configured for P A Busy Indicates CFWD NoAns enabled 3 Inthe above example the account has CFWD All and CFWD NoAns enabled as indicated by a check mark Vv The CFWD Busy setting is enabled but no call forward phone number is configured as indicated by a r 4 Select a state using the UP and DOWN arrow keys You can enable di
118. etition and Consumer Act 2010 the ACL or b the exercise of a right conferred by such a provision or c any liability of Aastra in relation to a failure to comply with a guarantee that applies under Division 1 of Part 3 2 of the ACL to a supply of goods or services After Warranty Service Aastra offers ongoing repair and support for this product If you are not otherwise entitled to a remedy for a failure to com ply with a guarantee that cannot be excluded under the Australian Consumer Law this service provides repair or replace ment of your Aastra product at Aastra s option for a fixed charge You are responsible for all shipping charges For further information and shipping instructions contact Aastra Telecom Australia Pty Ltd 745 Springvale Road Mulgrave VIC 3170 ABN 16 140 787 195 Phone 61 3 8562 2700 Note Repairs to this product may be made only by the manufacturer and its authorized agents or by others who are legally authorized Unauthorized repair will void this express warranty 41 001376 00 Rev 01 06 2013 Warranty 3 Appendix A Time Zone Codes The following table identifies the time zone name and time zone code to use on the IP phone Time Zone Name Time Zone Code Table Time Zone Name Time Zone Code AD Andorra CET AE Dubai GST AG Antigua AST Al Anguilla AST ALTirane CET AN Curacao AST AR Buenos Aires ART AS Pago Pago BST AT Vienna CET AU Lord Howe LHS AU Tasmania EST AU Melbourne ES
119. etwork or the account has not been configured by the Network Administrator the No Service or Network Disconnected prompt appears on the display and the telephone status light turns ON The phone also displays the default time and date of 12 00am Jan 1st 2000 Check that the cables are tightly connected to the phone and to the wall jack The phone should automatically detect when the connection is reconnected and display the Network Connected prompt temporarily If changes have been made to your phone settings you may need to restart your phone For more information on restarting your phone see Restarting Your Phone on page 39 For more information about connecting your phone refer to the Aastra 6730i Installation Guide Check with your Sys tem Administrator for assistance 6 41 001376 00 Rev 01 06 2013 IP Phone Keys Key Panel The following sections describe the various 6730i phone key functions on both the symbol and text hardware platforms and how they help you make and manage your calls and caller information Images of the symbol keys and the symbol hardware platform are used throughout this document 41 001376 00 Rev 01 06 2013 6730i Handset Callers List Key High Quality Speakerphone Conference Key
120. ew the rest of the phone number content Pressing the LEFT and RIGHT arrow keys lets you view the different line call appearances While in the Options List these keys allow you to exit or enter the current option When you are editing entries on the display pressing the LEFT arrow key works as a back space instead of a moving cursor the LEFT arrow key erases the digit character at the cursor location including the dot decimal The RIGHT arrow key sets the option Speaker Key Transfers the active call to the speaker allowing handsfree use of the phone Switched between headset and speaker depending on audio mode setting Speaker Options Key Accesses services and options to customize your phone Your System Admin ce istrator may have already customized some of your settings Check with your System Admin Options istrator before changing the administrator only options Callers List Key Accesses the last 200 calls received I Conference Key Begins a conference call with the active call i O o Conf Wana Transfer Key Transfers the active call to another number 8 41 001376 00 Rev 01 06 2013 IP Phone Keys Text Keys Symbol Keys Key Description Line Call Appearance Keys Connect you to a line or call The Aastra 6730i IP phone sup ports 2 line keys each with LED indicator lights Additional lines up to 6 in total can be added to the programmable keys P
121. ey 1 through Key 9 3 In the input box enter the phone number extension or speed dial prefix to apply to this Digit key If you enter a speed dial prefix you must enter the character at the end of the prefix number for example 123456 4 Inthe Line field select a line for which to apply the speed dial to Valid values are 1 through 6 5 Click Save Settings 41 001376 00 Rev 01 06 2013 51 Line Keys and Programmable Keys Saving an Entry from the Redial Callers or Directory Lists to a Speed Dial Key amp IP Phone UI Use the following procedure to save an entry from your Directory List Callers List or Redial List on the IP phone m Save Key Directory List Key 3 Callers List Key C Redial List Key 1 Press the Directory List Callers List or Redial List key From the Directory List Callers List or Redial List scroll through the list to find the name and number that you wish to save to your speed dial 2 Press the Save key The LCD displays Save to 3 Press a selected Programmable Key for speed dial Note Keypad speed dial cannot be saved If the name is displayed with the number both are saved to the speed dial If no name is displayed you can enter the name using the phone s key pad 52 41 001376 00 Rev 01 06 2013 Line Keys and Programmable Keys Editing Speed
122. ey and Message Waiting Indicator MWI LEDs when you enable DND on the IP Phone Key LED Behavior MWILED Behavior for All Modes for All Modes DND key LED RED if current account in MWILED ON if current account in focus has focus has DND ON DND ON DND key LED OFF when current account MWI LED OFF if current account in focus has in focus has DND disabled DND OFF Note If you make changes to the configuration for DND via the IP Phone UI you must refresh the Aastra Web UI screen to see the changes 120 41 001376 00 Rev 01 06 2013 Managing Calls Configuring a DND Key To configure a DND key see the section Do Not Disturb DND Key on page 56 Note If there is no DND key configured or if it is removed DND is disabled on the IP Phone Configuring DND Using the Aastra Web Ul La Aastra Web UI Use the following procedure to configure DND using the Aastra Web Ul 1 Click on Basic Settings gt Preferences gt General Preferences General Display DTMF Digits C Enabled Play Call Waiting Tone M Enabled Stuttered Dial Tone M Enabled XML Beep Support M Enabled Status Scroll Delay seconds 5 Switch Ul Focus To Ringing Line M Enabled Call Hold Reminder During Active Calls C Enabled Call Hold Reminder Cl Enabled Call Waiting Tone Period 0 I Preferred line 1 v Preferred line Timeout seconds 0 Message Waiting Indicator Line All Y DND Key Mode Phone y Call Forward Key Mo
123. fer to the Aastra Models 9000i and 6700i Series SIP IP Phones Administrator Guide 41 001376 00 Rev 01 06 2013 Getting Started The 6730i must be set up and configured prior to its first use This section describes phone behavior and start up screens you may see when the phone is first plugged in or when it is restarted Plugging in and Starting the Phone The 6730i automatically begins the start up sequence as soon as it is connected The phone goes through this process the first time you plug in your phone and every time you restart your phone Note Some start up screens only appear the first time you connect your phone or if your phone has been factory defaulted The phone displays the following startup screens Aastra 6730i Firmware Loaded LLDP Initializing network During the first start up the 6730i phone attempts to contact the Redirection and Configuration Server rcs aastra com for current server information No personal information is transmitted from the phone during this process Contacting Redirector The 6730i phone may also look for configuration servers on your local network press Remote to enter a remote server address or Skip to continue without checking for servers Auto Discovery Remote b Skip 41 001376 00 Rev 01 06 2013 Getting Started If appropriate servers are found they are listed for you to select from by scrolling down to view the complete list Press lt Skip t
124. ference O D 5 A M Key Setting Up a Conference and Adding Multiple Parties for Sylantro and Broadsoft Servers Note You can have an unlimited number of parties in a conference dependent on the limitations of the server When you begin a conference you are the first party in the conference Party 1 Pickup the handset or press the Speakerphone Key A line opens up Call Party 2 by dialing their number or answer an incoming call of a Party Wait for Party 2 to answer When Party 2 answers you can consult with them before adding them to Conference 1 Press the Conf Key EY A new line opens Enter the phone number of Party 3 Wait for Party 3 to answer When Party 3 answers you can consult with them before adding them to the Conference 1 41 001376 00 Rev 01 06 2013 105 Handling Calls 7 Press the Conf Key again to add Party 3 to Conference 1 Party 1 which is yourself Party 2 and Party 3 are all connected to Conference 1 8 Press an available Line Key or answer an incoming call on an available line If calling out call Party 4 9 Wait for Party 4 to answer When Party 4 answers you can consult with them before adding them to the conference 10 Press the Conf Key to add Party 4 to Conference 1 11 Press the Line Key that has Conference 1 12 Press the Conf Key to join all partie
125. g VOU PRONG u u u ua ashuy dad ASA AAA ad 39 41 001376 00 Rev 01 06 2013 ili Contents PRONE LOCK u u NS 39 Defining an Emergency Dial Plan coi a ie ie a A a ed aa e 41 Line Keys and Programmable Keys 42 Multiple Line and Call Appearance Keys 42 Programmable Key isc u a a neau ea a A A A AAA AA 43 BING A AAN 45 Creating a Speed Dial Key lt lt 00000 nie eae opa ad wads Re ae Se wapu ee 46 Editing Speed Dial KEYS ociosa i yE neon Seana tes AAA AA mata E eae 53 Do Not Disturb DND Rey ic u u u sus su pass a E EE E abused honed cise tetas 56 BLF LIStKeV us sas ee ee ee 58 Flash Key o 0 nes when hice AAA dd 60 Automatic Call Distribution ACD Key for Sylantro Servers 61 Directed Call Pickup Group Call Pickup Keys 64 AME Key A A A A A AAA AAA a E 68 Sprecod e Key AA susu a Aas le wisa Eas tle ab Eee wale HE ena 71 Park Pickup Keys sz u u dies A oie eb didn is wie ad A oo ed E OEA T 72 Last Call Return Icr Key for Sylantro Servers 0ccc cee c cece ence n een een eee narrar rr 74 Call Forward Key usa cana ai e a a hu ales Reton waqu a Hees wasqan say Hae RNa was AEE 75 BLF K EN usus s uba paq A ia 76 Speeddial Xfer Key AP kenan NUNON ENE NTN OE ENEN OEE ENEN Ea
126. g up the handset to transfer Party 1 to Party 2 Transferring Two Existing Calls The 6730i allows you to perform a transfer of a call when there are currently two active calls on the phone For example on your phone there are two active calls Call A and Call B Call B is on hold You can perform the following to transfer Call A to Call B 1 2 3 Press Transfer key A new line opens Press or scroll to the Line where Call B is on hold Press Transfer key Call A is transferred to Call B 100 41 001376 00 Rev 01 06 2013 Handling Calls Completing a Transfer to a Contact in Phone Directory Users can complete a blind transfer to a contact in their local directory If a user is in a call and initiates a transfer they can navigate to the Directory screen and press the Transfer key again to trigger a blind transfer There is no change to start a consultative call To Transfer a Call to a Contact in the Phone Directory 1 Connect to Party 1 if not already connected Party 1 is the party you want to transfer 2 Press the Transfer key You should hear a dial tone as a second line opens up 3 Press the Directory key and select a contact 4 To complete a blind transfer press the Transfer key again before the receiving end answers To complete a consultative transfer press Dial to call the contact Remain on the line to speak with Party 2 before pressing the Transfer key again to transfer Party 1 to Party 2 To cancel
127. ggle the state of the CFWD state ON or OFF In the example in Step 4 you press NEXT to change the option to OFF 7 Press the SET key to save the change 8 In the CFWD State screen press the DOWN arrow key to scroll to the CFWD Number screen and press CHANGE 1 Cfwd State On lt Done p Change CFWD Number Screen 2 Cfwd Number Cfwd Number lt Done gt Change NE 9 Entera phone number to apply to the current state in focus When the phone is in the state you specified and a call comes into the phone it forwards the call to the number you specify 10 Press SET to save the change 11 Forthe CFWD No Answer state in the CFWD Number screen press the DOWN arrow key to scroll to the CFWD No Rings screen and press CHANGE 1 Cfwd NoAns Use YA to view 1 Cfwd State On lt Done gt Change 2 Cfwd Number lt Done p Change No Rings 1 Rings Screen 132 41 001376 00 Rev 01 06 2013 Managing Calls 12 Press the NEXT key to select the number of rings to apply to the phone for call forwarding incoming calls Valid values are 1 to 20 Default is 1 13 When the phone receives an incoming call and call forward is configured on the phone the phone rings the number of times you specify in the No Rings screen and then forwards the call 14 Press SET to save the change 15 Press DONE to save CFWD All Number CFWD All State CFWD Busy Number CFWD Busy State CFWD
128. he IP phone you are accessing ASTRA Status System Information Operation User Password Phone Lock Programmable Keys Keypad Speed Dial Directory Reset Basic Settings Preferences Account Configuration This Status window is view only It displays the status of your phone which includes the following e Network Status System Information Network Status Attribute Link State Negotiation Speed Duplex Hardware Information Attribute MAC Address Platform Firmware Information Attribute Firmware Version Firmware Release Code Boot Version Date Time SIP Status Line e Hardware Information Firmware Information e SIP Status 18 LAN Port Up Auto 100Mbps Full Value 00 08 5D 11 BB DC 6730i Revision 0 Value 3 2 2 2101 SIP 2 4 0 80 Sep 6 2012 02 07 03 SIP Account Backup Registrar Used 41 001376 00 Rev 01 06 2013 Phone Status SIP Account Status The IP Phones show the SIP registration status on the IP Phone s Status screen in the Aastra Web UI SIP Status Line SIP Account Status Backup Registrar Used 4 650 proxy com 5060 Registered Yes 2 651 proxy com 5060 Registered Yes 3 652 proxy com 5060 Registered Yes 4 653 proxy com 5060 401 No The following table describes the status conditions that can display for the account Status Condition Description Registered Displays this status on accounts that HAVE been registered with the SIP proxy server Exampl
129. his field uncheck the box 4 The Play Warning Tone field is enabled by default If Auto Answer is enabled the phone plays a warning tone when it receives in incoming intercom call To disable this field uncheck the box 5 The Allow Barge In field is enabled by default If Allow Barge In is enabled the phone puts an active call on hold and answers the incoming Intercom call To disable this field uncheck the box 6 Click Save Settings Using Redial Key for Last Number Redial The IP phone has an enhanced redial user interface that allows a user to quickly redial the last number that was dialed out from the phone You can e Press the REDIAL key twice to redial the last number dialed e Press the REDIAL key once scroll the list of numbers then press the REDIAL key again to dial the number that displays on the screen The last number redial feature for the Redial key is static and is not configurable 152 41 001376 00 Rev 01 06 2013 Additional Features Gro up RTP Paging receives RTP streams You can configure the phone to allow it to receive a Real Time Transport Protocol RTP stream from pre configured multi cast address es without involving SIP signalling This is called Group Paging on the IP phones You can specify up to 5 mul ticast addresses that the phone listens for on the network This feature is configurable using the Aastra Web UI only The 6730i in the local network listens for RTP
130. iguration Key Type Value Line 1 BLF Xfer x 135 4 v 2 Pickup v 3 Line v 3 v 4 Paging v n 6 F Speeddial 9051234567 1 v 8 XML vw http 10 70 3 7xmlmenu menu php source all Select from Key 1 through Key 8 Keys 5 and 6 can be made configurable only by your system administrator In the Type field select BLF Xfer Inthe Value field enter the monitored extension or the extension to transfer calls to for example 35 T In the Line field select the line for which you want to use the key functionality a wu Bb WUN Click Save Settings 41 001376 00 Rev 01 06 2013 77 Line Keys and Programmable Keys Speeddial Xfer Key The Speed Dial key allows a number to be dialed quickly by pressing one key configured for speed dialing The Xfer key allows a call to be transferred to other recipients blindly or consultatively The Speeddial Xfer key combines the Speed Dial and Xfer key s functionality together allowing the user to transfer calls or use Speed Dial with one key Note It is recommended that you enable the Switch UI Focus to Ringing Line parameter when using the Speeddial Xfer fea ture For more information about this parameter see Switch UI Focus to Ringing Line on page 144 Speeddial Xfer Key Requirements and Functionality The Speeddial Xfer key has the following capabilities Speeddial Xfer and Speed Dial When the phone is in the Idle sta
131. iguring Preferred Line and Preferred Line Timeout Using the Aastra Web UI Additional Features La Aastra Web UI Use the following procedure to configure the Preferred Line and Preferred Line Timeout feature using the Aastra Web UI 1 Click on Basic Settings gt Preferences gt General Preferences General Display DTMF Digits Play Call Waiting Tone Stuttered Dial Tone XML Beep Support Status Scroll Delay seconds Switch Ul Focus To Ringing Line Call Hold Reminder During Active Calls Call Hold Reminder Call Waiting Tone Period Preferred line Preferred line Timeout seconds Message Waiting Indicator Line DND Key Mode Call Forward Key Mode Cl Enabled Enabled M Enabled Enabled 5 Enabled C Enabled C Enabled 0 1 v 0 All Phone vw Account w 2 In the Preferred Line field select a preferred line to switch focus to after incoming or outgoing calls end on the phone Default is 1 Valid values are None disables the preferred line focus feature e 1to9 For example if you set the preferred line to 1 when a call incoming or outgoing ends on the phone on any line the phone switches focus back to Line 1 3 In the Preferred Line Timeout field enter the amount of time in seconds that the phone switches back to the preferred line after a call incoming or outgoing ends on the phone or after a du
132. ine Enabled Call Hold Reminder During Active Calls C Enabled Call Hold Reminder Cl Enabled Call Waiting Tone Period 0 Preferred line 1 v Preferred line Timeout seconds 0 Message Waiting Indicator Line All v DND Key Mode Phone w Call Forward Key Mode Account w 2 Enter a value in the Status Scroll Delay seconds field Valid values are 1 to 25 seconds Default is 5 3 Click Save Settings 41 001376 00 Rev 01 06 2013 143 Additional Features Switch UI Focus to Ringing Line You can configure a feature on the 6730i that controls the behavior of the phone when it receives an incoming call when it is already in a connected call When a call comes into the phone and the phone is already on a connected call the phone switches focus to the ringing line to enable the user to see who is calling them You can turn off this functionality so that the phone stays focused on the connected call You can do this using the Switch Focus to Ringing Line parameter in the Aastra Web UI Configuring Switch Focus to Ringing Line Using the Aastra Web UI La Aastra Web UI Use the following procedure to enable or disable the Switch Focus to Ringing Line using the Aastra Web UI 1 Click on Basic Settings gt Preferences gt General Preferences General Display DTMF Digits C Enabled Play Call Waiting Tone Enabled Stuttered Dial Tone Enabled XML
133. ion you want to view IP amp MAC Address LAN Port e PC Port e Firmware Info Error Messages Copyright The option you select displays to the LCD Use the Y and keys to scroll the through the LCD display 16 41 001376 00 Rev 01 06 2013 Phone Status Finding Your Phone s IP Address If you want to access your phone s options using an Internet browser you need to enter the IP address of the phone in the browser to open the Aastra Web UI Use the following procedure to find your phone s IP address amp IP Phone UI Phone Status via the Aastra Web UI 1 Press the key on the phone to enter the Option List 2 Select Phone Status and press the p gt key 3 Phone Status w Next Enter 3 Select IP amp MAC Addresses and press the p gt key 1 IP amp MAC Addresses w Next Enter The IP address of your 6730i IP phone displays in the IP Address field IP Address 10 40 50 112 ye Next Exit Use the following procedure to view the phone status via the Aastra Web Ul La Aastra Web UI 1 Open your web browser enter the phone s IP address or host name into the address field and press lt Enter gt 2 In the Username Password window enter your username and password and click OK Note For a user the default user name is user and the password field is left blank 41 001376 00 Rev 01 06 2013 17 Phone Status The Status window displays for t
134. isable any or all of the following states for an account All Enables CFWD All for an account and forwards all incoming calls for that account to the specified number Busy Enables CFWD Busy for an account and forwards incoming calls to a specified number if DND has been enabled for that account OR if the account is currently engaged in another call e No Answer Enables CFWD NoAns for an account and forwards incoming calls to a specified number if the call has not been answered for the specified number of rings Note If CFWD All AND CFWD Busy AND CFWD NoAns are all enabled and or if the account has DND enabled the CFWD All settings take precedence over CFWD Busy and CFWD NoAns You can also use the following keys if required All Off Disables all CFWD states for the current account in focus AllOn Enables all CFWD states for the current account in focus 4 Press the CHANGE key for the state you selected in step 3 Scroll to the CFWD State screen This displays the current state of the mode you selected In the following example the CFWD All state is ON 1 Cfwd All chad State CFWD State Screen Use Wa to view an Se OP Y 1 Cfwd State Cfwd State On Off lt Done gt Change Y Next P Set 5 Press the CHANGE key in the CFWD State screen Press NEXT to toggle the state of the CFWD mode ON or OFF In the example in Step 4 you press NEXT to change the option to OFF 6 Press SET to save the change
135. isniceassesasostsssssssenzsessenaconssuscostnasinasensessissacosaiascesbissiniseszetstnunsoasinasces D DCP key delete key dial plan emergency dial tones stuttered dialing anumber dialpad live Directory key directory key Directory List downloading tO phone a 115 directory list downloading to PC sorting diverting calls DND key DND enabling disabling documentation E emergency dial plan defining empty key F Flash key inicios 60 G GCP key 64 goodbye key 8 group RTP Paging ssisssassssaessssassscsorsssassesnsssssenesaieassssnnssssasssonsascousesasussuousssezaasasboveeead 153 H headset mode headset using headset speaker mode hold key hold feature enhancement USING II a a 160 idle screens ignore sofkey incomplete configuration Indication of transferred calls installdtioni and SETUP occasion intercom calls incoming call features Intercom key intercom outgoing calls using IP address of the phone IP Gddr ess findifig tarros A 41 001376 00 Rev 01 06 2013 K key Teleco 159 Keypad Keys sssssscssssss cossietscacasssinscansaticianissssstsigeccesahaysscaassyasonsteddboosayespbanssstecssbieetesnas 10 keys ACD key Answer softkey for XML BLF key BLF List key BLF Xfer key Call Forward key callers list conference DCP and GCP keys delete deleting descripti
136. kup the handset or press the speakerphone key A line opens up 2 Call Party 2 by dialing their number or answer an incoming call of a Party 3 Wait for Party 2 to answer When Party 2 answers you can consult with them before adding them to the conference 4 Press the Conf key CG You will not hear a dial tone before the dialing begins 5 Enter the phone number of Party 3 Note Users are able to edit the destination number Backspace softkey is provided and navigation key is functional to move the cursor to the desired location 6 Wait for Party 3 to answer When Party 3 answers you can consult with them before adding them to the conference 7 Press the Conf key E again to add Party 3 to the conference Party 1 which is yourself Party 2 and Party 3 are all connected to a single conference 8 To drop a party from the conference use the navigation key to select the party and press the Drop key Using Local Conferencing in Live Dial Mode 1 When you begin a conference you are the first party in the conference Party 1 Pickup the handset or press the speakerphone key A line opens up 2 Call Party 2 by dialing their number or answer an incoming call of a Party 3 Wait for Party 2 to answer When Party 2 answers you can consult with them before adding them to the conference 41 001376 00 Rev 01 06 2013 103 Handling Calls 4 Press the Conf key 3 You should hear a dial tone before dialing begin
137. l Forwarding 120 Missed Calls IRdICOLON coord dada RR A AR A 136 VOICE sich sack oe ii a 137 Additio al Features conociera tl ma reaeMiaaetere nied eidereae 138 STO COGS iii usya E Gina wha Wesley Mise baw ate A Se eee Late 138 Display DTMF DIgitf aa 139 Play Call Waiting Ton lt a ia 140 Stuttered DION Tone uay sasana akaywepanamakaywakakawakaywasaaaukunkaqkaqaunuayaukakapahasqaqaaswsas 141 XML Beep SUpport son dicii ovine sin vende a eed eihew eens 142 Status Scroll Delay u ua iii ti ii tea tas ia didas 143 Switch Ul Focus to RingingLine uuu kaa ayauya a daba Lene atea 144 Call Hold Reminder During Active Calls 0 cece cece cece cece eee eee e eee e eee n eee ee ene n eee eeeeee 145 Call Hold Reminder on single hold 0 0 0 ccc ce cece eee e eee eee nee eee eee e eee e tees een e eens ee eeee 146 Call Waiting Tone Period u au qasa A da aquqa qh eh aden ca 147 Preferred Line and Preferred Line Timeout 148 Message Waiting Indicator ooocooconcocconcnnccncanonrnnrannn rra rra ran r arranco 150 Incoming Intercom Call Features ecreis u nance aro sadn ane ea ER EREE AAA wisaq Re 151 Using Redial Key for Last Number Redial 00 cece cece cece ene ene e eee e nee n eee e eee eeeeeeeeees 152 Group RTP Paging receives RTP streams 0 ce
138. l line appearance key again you disconnect from the call 98 41 001376 00 Rev 01 06 2013 Handling Calls Transferring Calls Blind Transfer A blind transfer is when you transfer a call directly to another extension without consulting with the person receiving the call To do this simply complete the transfer immediately after you have entered the number The call goes directly to the extension or outside line you transferred to If the party you are transferring the call to does not answer the transferred call rings back to your extension Consultive Transfer You also have the option to consult with the person you are transferring the call to before you complete the transfer To do this remain on the line until the receiving party answers the call After consulting with the receiving party you can either complete the transfer or cancel the transfer to go back to the original call Pre Dial amp Live Dial Mode By default when users are initiating a conference call or transfer they will not hear a dial tone before dialing begins pre dial mode The phone does not automatically dial out the number until the user presses the Transfer key This allows the users to make changes to the dialing number before initiating the call Administrators can configure a live dial mode In live dial mode when the user is completing a conference call or transfer they will hear a dial tone before dialing begins In addition the phone wi
139. lable in order to start receiving calls 41 001376 00 Rev 01 06 2013 63 Line Keys and Programmable Keys 7 To temporarily stop receiving calls press the press Y Unavail If you are on a call or miss a call that has been distributed to your phone your phone status automatically changes to Unavailable Your phone remains in the Unavailable state until one of the following occurs You use the IP Phone UI to manually switch the IP phone state back to Available or e The availability timer for your IP phone expires This only occurs if your Administrator has configured an auto availability timer on your IP phone Contact your System Administrator for more information 8 To logout of the queue press p gt Logout The server no longer distributes phone calls to your IP phone Directed Call Pickup Group Call Pickup Keys Aastra IP phones support the Directed Call Pickup DCP and Group Call Pickup GCP features The DCP GCP feature allows you to intercept or pickup a call on a monitored extension You can configure this feature using the Aastra Web UI to create a DCP or GCP key on the IP phone When you configure a DCP key you specify the extension that you want to monitor Then when the monitored extension receives a call you press the DCP key to pick up the call If the monitored extension receives multiple incoming calls simultaneously the IP Phone UI displays a list of incoming calls You select a call fr
140. lers List It also allows you to save speed dial information to a programmable key You can also use the Save key while using specific XML applications By default the Delete key allows you to remove entries from the Directory List and Callers List Must enter the Directory or Callers list and select an entry then press twice to delete entry Once the Save and Delete keys are made configurable you can change the function of the keys using the Aastra Web UI Important If you change the functions of the Save and Delete keys and then an Administrator locks Keys 5 and 6 the functions are automatically set back to the default settings of Save and Delete 160 41 001376 00 Rev 01 06 2013 Available Features Enabled by Administrators Authentication Support for HTTP HTTPS Download Methods Used with Broadsoft Client Management System CMS If enabled by an Administrator the 6730i has authentication support when using HTTP or HTTPS as download protocols as per RFC 2617 When a phone is connected to a Broadsoft Server using the CMS tool a LOGIN key displays Pressing the LOGIN key displays a login screen with Username and Password Username can be up to 40 characters and Password can be up to 20 characters A System Administrator can optionally configure a Domain Name to be used as the Username e g username domain com A user can navigate the screen using the navigation keys arrow keys on the phone The screen provides a SUBM
141. lized conferencing Centralized Conferencing allows you to perform the following Conference two active calls together into a conference call e When on an active conference call invite another party into the call e Create simultaneous conference calls on the same IP phone Sylantro servers only For example a user at extension 2005 could create two conferences and put one conference on hold while conversing with the other party e Line 1 conference together extensions 2005 2010 and 2020 Line 2 conference together extensions 2005 2011 and 2021 e Disconnect from an active conference call while allowing the other callers to remain connected e Add unlimited number of users to a conference dependent on the limitations of the server Join two active calls together into a conference Join incoming or outgoing active calls to any existing conference Reference For more information about using Centralized Conferencing see Centralized Conferencing for Sylantro and Broadsoft Servers on page 104 41 001376 00 Rev 01 06 2013 157 Available Features Enabled by Administrators Answer and Ignore Keys for XML Applications If you are accessing XML applications on your phone and a call comes in your System Administrator can create Answer and Ignore keys that you can use to either answer the incoming call or ignore it An XML application can display here while a call is coming in a Ignore Answer Wh
142. ll either match the number to the dial plan or wait for the set digit timeout In the default pre dial mode users are able to edit the destination number prior to dialing whereas in live dial mode they are not able to however the Dial and Cancel softkeys are provided while the user inputs the number IP Phone UI Transferring Calls in Pre Dial Mode Use the following procedure to transfer a call to another extension in pre dial mode Use the following illustration as a ref erence y I TA Transfer K Key Y 41 001376 00 Rev 01 06 2013 99 Handling Calls Connect to Party 1 if not already connected Party 1 is the party you want to transfer Press the Transfer Key C You will not hear a dial tone before dialing begins Enter the extension number or the outside number to Party 2 This is the Party for which you want to transfer Party 1 To cancel the transfer you can either select Cancel on the display screen press the Goodbye key or hangup the handset Note Users are able to edit the destination number Backspace softkey is provided and navigation key is functional to move the cursor to the desired location Complete either a blind or consultative transfer a To complete a blind transfer press the Transfer key again before the receiving end answers b
143. llation Guide for information The 6730i uses the same port for either a hand set or a headset How do find the IP address of my phone Instructions on where to find the IP address of your phone can be found in this guide in the section Finding Your Phone s IP Address on page 17 Why does my phone display the No Service message The phone displays the No Service message if the SIP settings have not been set up correctly Contact your System Administrator for more information 41 001376 00 Rev 01 06 2013 165 Troubleshooting Solutions How do change my user password You can change the user password from the IP phone UI or the Aastra Web UI lt IP Phone UI 1 2 3 4 5 Press EJ the phone to enter the Options List Select Password and press Enter Enter the current user password and press Done Enter the new user password and press Done Re enter the new user password and press Done A message Password Changed displays on the screen La Aastra Web UI 1 3 4 5 For information on how to access the Aastra Web UI go to the section Using the Aastra Web UI on Click on Operation gt User Password Reset User Password Please enter the current and new passwords Current Password e New Password e eeeoooo Password Confirm Pr Save Settings Inthe Current Password field enter the current user password Note By default
144. lt Allow Barge In You can configure whether or not the IP phone allows an incoming intercom call to interrupt an active call The Allow Barge In parameter controls this feature When you enable the this parameter which is the default value an incoming intercom call takes precedence over any active call by placing the active call on hold and automatically answering the intercom call When you disable this parameter and there is an active call the phone treats an incoming intercom call like a normal call and plays the call warning tone Allow Barge In is enabled by default 41 001376 00 Rev 01 06 2013 151 Additional Features Configuring Incoming Intercom Settings La Aastra Web UI Use the following procedure to configure incoming Intercom settings on the IP phone 1 Click on Basic Settings gt Preferences gt Incoming Intercom Settings Incoming Intercom Settings Auto Answer Enabled Microphone Mute Enabled Play Warning Tone Enabled Allow Barge In Enabled 2 The Auto Answer field is enabled by default The automatic answering feature is turned on for the IP phone for answering Intercom calls To disable this field uncheck the box Note If the Auto Answer field is not checked disabled the phone treats the incoming intercom call as a normal call 3 The Microphone Mute field is enabled by default The microphone is muted on the IP phone for Intercom calls made by the originating caller To disable t
145. microphone You can set Audio on your IP phone using the IP Phone UI only Audio Mode The 6730i allows you to use a handset a headset connected through the handset port or handsfree mode to handle incoming and outgoing calls The audio mode option provides different combinations of these three methods to provide maximum flexibility in handling calls There are four audio mode options you can set Auto Mode Option Description Speaker This is the default setting Calls can be made or received using the handset or hands free speakerphone In handset audio mode pressing the key on the phone switches to hands free speakerphone In Speaker audio mode lift the hand set to switch to the handset Headset Choose this setting if you want to make or receive all calls using a handset or headset connected through the handset port Speaker Headset Incoming calls are sent to the hands free speakerphone first when the CO key is pressed By pressing the key again you can switch back and forth between the hands free speakerphone and the headset At anytime lifting the handset switches back to the handset from either the hands free speakerphone or the headset Headset Speaker Incoming calls are sent to the headset first when the cO keyiis pressed By pressing the key again you can switch back and forth between the headset and the hands free speakerphone At anytime lifting the handset switches back to the handset from either the headset or
146. mmendations contained in headset operating guides when using any headset Advanced Volume Controls for the Headset Mic On the 6730i there are 3 options for the headset microphone volume For more information about the headset micro phone see Headset Mic Volume on page 24 Q IP Phone UI To change the volume 1 Press to enter the Options list Select Preferences and press p gt Use Y to scroll down to Set Audio and press p gt to select Press Y to scroll down to Headset Mic Volume and press p gt to select Use Y to scroll down the list and press p gt to select your desired volume Press gt to save changes and 48 to exit NN QQ wu Bb UN If you do not wish to save changes press el to return to the previous screen Note By default the volume for the headset microphone is set to medium Making and Receiving Calls Using a Headset amp IP Phone UI 1 Ensure that you have selected a headset audio mode by accessing the Options list under option Preferences gt Set Audio gt Audio Mode on the IP Phone 2 Plug the headset into the jack 3 Press the CO key to obtain a dial tone or to answer an incoming call Depending on the audio mode selected from the options menu a dial tone or an incoming call is received on either the headset or the handsfree speaker phone 4 Press the Gy key to end the call 94 41 001376 00 Rev 01 06 2013 Making Calls Redial amp IP Ph
147. nfigurable ONLY by your System Administrator 1 Click on Operation gt Programmable Keys Programmable Keys Configuration Key Type Value Line 1 None v 2 Pickup v 3 Line 3 4 Paging v 5 6 7 Speeddial 9051234567 1 8 XML http 10 70 3 7 xml menu menu php source all 2 Select from Key 1 through Key 8 Keys 5 and 6 can be made configurable only by your system administrator 3 In the Type field select None 4 Click Save Settings The function is deleted from the IP phone memory 92 41 001376 00 Rev 01 06 2013 Making Calls This section describes ways to make calls on your 6730i phone using your handset speakerphone or headset Dialing a Number First take the phone off hook by lifting the handset pressing CO or pressing a line call appearance key At the dial tone enter the number you wish to call Note After dialing the number the phone has a short delay before sending the call To send the call immediately you can press the key immediately after dialing the number The phone sends the call without delay Ifyou are unable to make calls within certain area codes check with your System Administrator for any toll restrictions placed on your extension that may restrict your access to long distance area codes or dialing prefixes When your party picks up a timer appears on your display th
148. ng a key configured for speed dialing You can program the keys on the 6730i to speed dial outside numbers dial directly to another person s line or extension or set up to quickly access features such as Caller ID 69 Voicemail The speed dial function can be set using the IP Phone UI or the Aastra Web UI Note You can use a speed dial key while on an active call by placing the active call on hold first and then pressing the speed dial key You can create speed dial keys using any of the following methods e Using the Aastra Web Ul at the paths Operation gt Programmable Keys Operation gt Keypad Speed Dial By pressing and holding a programmable key or keypad key e Using the IP Phone Ul at the path Options gt Preferences gt Speed Dial Edit Speed Dial Prefix The speed dial feature also allows you to specify a preset string of numbers followed by a that the phone dials auto matically after pressing the speed dial key You can use this feature for numbers that contain long prefixes For example if you had the following speed dial configuration in the Aastra Web UI Key 1 Type speed dial Label Europe Office Value 1234567 Line 2 then after you press key 1 on the phone the prefix number displays on the phone screen The phone proceeds to dial the prefix number automatically and pauses for you to enter the remaining phone number using the keypad on the phone You can save up to 7 speed dial numbers on the 67
149. nly when a call is connected and there is an active RTP stream for example when the call is not on hold Sprecode Indicates the key is configured to automatically activate specific services offered by the server For example if the sprecode value of 82 is configured then by pressing the sprecode key 82 automatically activates a serv ice provided by the server Contact your System Administrator for available services Park Indicates the key is configured to park incoming calls when pressed Pickup Indicates the key is configured to pick up parked calls when pressed Last Call Return Icr Indicates the key is configured for last call return when pressed Call Forward Indicates the key is configured as a Call Forward key When pressed the IP Phone UI displays the Call Forward menus BLF Xfer 41 001376 00 Rev 01 06 2013 Indicates the key is configured as a simplified BLF key and a transfer key You can use this key to perform the BLF function or you can use it as a transfer key to transfer calls 43 Line Keys and Programmable Keys Key Function Description Speeddial Xfer Indicates the key is configured as a simplified speed dial key and a transfer key You can use this key to perform speed dial functions or you can use it as a transfer key to transfer calls Speeddial Conf Indicates the key is configured as a speed dial key and a conference key You can use this key to speed dial fr
150. nname3 Y Done gt Change In the above example Screenname and 3 have DND ON as indicated by a check mark Vv Screenname2 has DND off as indicated by an X Items 4 and 5 allow you to disable or enable DND on all accounts respec tively 3 Use the CHANGE key to enable or disable DND for a specific account 4 Use the Set key to enable disable DND for all accounts After making the change press Done and then Confirm to save the change Pressing Cancel 0 cancels the attempted change Apply Changes 0 Cancel Confirm Call Forward Account Based Configuration Call Forward CFWD on the IP phone allows incoming calls to be forwarded to another destination On the 6730i you can set Call Forward CFWD on the phone side for a specific account or for all accounts on the phone You can set three modes for CFWD using the Aastra Web UI at the path Basic Settings gt Preferences gt General gt Call For ward Key Mode Account default e Phone Custom CFWD performs according to the mode you set You can configure CFWD using the Aastra Web UI at the path Basic Settings gt Account Configuration OR you can configure CFWD using the IP Phone Ul at the path Options gt Call Forward Using the Aastra Web UI at the path Operation gt Programmable Keys you can also configure a CFWD key on the phone to use as a shortcut for accessing the CFWD menu on the phone 124 41 001376 00 Rev 01 06 2013 Managing Calls
151. o continue without selecting a server Choose Server lt server name gt 4Skip Select The 6730i phone then checks settings and looks for new configuration and firmware updates for the phone from a server If a new update is found the phone displays the message Updating Configuration This may take a few moments while the phone downloads the latest updates Updating configuration Checking for new firmware Note New updates to your phone can be automatically scheduled from the server This is set up on the phone system by your System Administrator and should be scheduled during non business hours or slow call periods Important Do not unplug or remove power to the phone while it is checking or installing firmware and configuration information If language packs were loaded to your phone by your System Administrator the following screen displays during startup Downloading language packs When the configuration update is complete the phone displays the following screens Network DSP SIP Done 4 41 001376 00 Rev 01 06 2013 Getting Started Idle Screens Idle Screen 1 When the phone has successfully updated the configuration and connected to the network the phone displays the Idle State screen John Burns 9054550055 Sat Jun 8 2 55pm The Idle State screen lists your name SIP screen name extension or phone number and day date and time The 1 in the upper corner in the a
152. oduct against defects and malfunctions in accordance with Aastra s authorized written functional specification relating to such products during a one 1 year period from the date of original purchase Warranty Period If there is a defect or malfunction Aastra shall at its option and as the exclusive remedy either repair or replace the prod uct at no charge if returned within the Warranty Period If replacement parts are used in making repairs these parts may be refurbished or may contain refurbished materials If it is necessary to replace the product it may be replaced with a refurbished product of the same design and color If it should become necessary to repair or replace a defective or mal functioning product under this warranty the provisions of this warranty shall apply to the repaired or replaced product until the expiration of ninety 90 days from the date of pick up or the date of shipment to you of the repaired or replace ment product or until the end of the original Warranty Period whichever is later Proof of the original purchase date is to be provided with all products returned for warranty repairs Exclusions Aastra does not warrant its products to be compatible with the equipment of any particular telephone company This war ranty does not extend to damage to products resulting from improper installation or operation alteration accident neglect abuse misuse fire or natural causes such as storms or floods aft
153. ok and the call ends This feature is disabled by default and must be enabled by your Administrator The disabled behavior is as follows You are in a call using the handset and the phone displays an XML application The far end terminates the call and a new XML application gets pushed pulled onto the display Since the handset is off hook and in idle mode the offhook idle timer starts When this timer expires the phone applies dial tone and moves to the off hook dialing state which then destroys the XML application that was being displayed Contact your System Administrator for more information about this feature 41 001376 00 Rev 01 06 2013 159 Available Features Enabled by Administrators XML Override for a Locked Phone The 6730i has a feature that allows a locked phone to be overridden when an XML application is sent to the phone This feature also allows you to still use programmable keys applicable to the XML application even though the phone is locked However any keys NOT associated with the XML application cannot be used when the phone is locked Also XML Get Requests override the locked feature on the phone so that any programmable key pressed by the user that initiates a Get Request continues to get sent Only a System Administrator can configure the feature of XML override for a locked phone RTP Recording and Simultaneous Playing The IP Phones now allow for Real Time Transport Protocol RTP recording and simultaneou
154. om within a conference call and add the new call directly to the conference Directory Indicates the key is configured to access the Directory List Key 7 by Default Intercom Indicates the key is configured to be used for intercom calls Services Indicates the key is set to access Services such as Directory List Callers List Voicemail or any other XML appli Key 8 by Default cations set up by your System Administrator Phone Lock Indicates the key is configured as a phone lock key allowing you to press this key to lock unlock the phone Paging Indicates the key is configured as a Paging key When pressed the phone can send Real Time Transport Proto col RTP streams from a pre configured multicast address without involving SIP signalling You can also receive RTP streams from pre configured multicast addresses can specify up to 5 addresses using the Paging Listen Addresses at the path Basic Settings gt Preferences gt Group Paging RTP Settings in the Aastra Web UI For more information about set ting this parameter see Group RTP Paging receives RTP streams on page 153 Programmable keys can also be set up to quickly to access features such as Call Return 69 or Voicemail Note Quick access features like Call Return and Voicemail must first be configured on your PBX in order to work on your phone See your System Administrator for more information The following paragraphs describe how to configure each fun
155. om this list and are connected to the call When you configure a GCP key you specify the ring group for example extensions 2200 2210 that you want to moni tor for incoming calls When an incoming call is received on any of these extensions the Operator presses the GCP key and is connected to the call If multiple incoming calls are received simultaneously the Operator press the GCP key selects an extension from a list and presses the Pickup key to answer the call Notes Your System Administrator must configure the extension range for the Group Call Pickup feature Contact your Sys tem Administrator for more information DCP GCP feature availability is dependant on your call manager Contact your System Administrator for more infor mation 64 41 001376 00 Rev 01 06 2013 Line Keys and Programmable Keys Configuring Directed Call Pickup DCP Key Use the following procedure to configure Directed Call Pickup using the Aastra Web UI La Aastra Web UI Note Keys 5 and 6 SAVE and DELETE keys can be made configurable ONLY by your System Administrator 1 Click on Operation gt Programmable Keys Programmable Keys Configuration Key Type Value Line 1 Directed Call Pickup 2200 1 v 2 Pickup v 3 Line v 3 v 4 Paging v 5 6 7 Speeddial v 9051234567 1 v 8 XML v http 410 70 3 7Xxml menu menu php source all Select from Ke
156. on descriptions of directory Directory key DND key Flash key goodbye hold ssis 8 Ignore key for XML 158 Intercom key Last Call Return key line Line key navigation None key options Paging key 89 Park and Pickup keys Phone Lock key programmable redial services Services key speaker Speeddial key Speeddial Conf key Speeddial Xfer key Sprecode key transfer volume control L language latin 2 character set Overview specifying on IP phone last call return key LCR key Line key line keys lines settings lock unlock the phone locking unlocking the phone M message waiting indicator configuring a 150 microphone mute for intercom I u a 151 41 001376 00 Rev 01 06 2013 microphone volume headset missed call summary subscription missed calls indicator accessing and clearing overview N Navigation KEYS au uu y aun isa aqa iwa kusam conan 8 no service None key O options Aastra Web UI IP Phone UI simplified menu options key P Paging key paging softkeys for Park key ninia iii park pickup using on the IP phone password resetting user s Phone Lock key phone status phone status displaying playing a WAV file preferred
157. one 3 Tone 4 Tone 5 Silent Lines 1 to 6 Per Line Setting Per Line Setting Global Global Tone 1 Tone 2 Tone 3 Tone 4 Tone 5 Silent 20 41 001376 00 Rev 01 06 2013 Customizing Your Phone Ring Tone Sets In addition to ring tones you can configure ring tone sets on a global basis on the IP phone Ring tone sets consist of tones customized for a specific country The ring tone sets you can configure on the IP phones are e Australia e Brazil e Europe generic tones e France e Germany e Italy e Italy2 e Malaysia e Mexico Russia Slovakia UK e US Default also used in Canada When you configure the country s tone set the country specific tone is heard on the phone for the following e dialtone secondary dial tone ring tone busy tone congestion tones call waiting tone e ring cadence pattern You configure global ring tones and tone sets using the Aastra Web UI and the IP Phone UI Configuring Ring Tones and Tone Sets Ey IP Phone UI Use the following procedures to configure ring tones and tone sets on the IP phone Global configuration only 1 Press Cajon the phone to enter the Options List Select Preferences Select Tones Select Ring Tone Select the type of ring tone Tone 1 through Tone 5 or Silent Select Set and then press Y Y A wu P VUN Select Tone Set 41 001376 00 Rev 01 06 2013 21 Customizing Your
158. one UI Press C to dial the most recent number you dialed from the phone If you are off hook and press E the last number you called is called back If you are on hook and press cC a Redial Directory list appears on screen The redial list is available during active calls It stores up to the last 100 numbers you called allowing you to scroll through and select the number you wish to redial Note Your System Administrator can set your Redial key to speed dial a specific number Contact your System Administrator for more information Accessing the Redial List IP Phone UI 1 If you are off hook and press the telephone automatically dials the last number you called y p LE p y 2 Ifyou are not on the phone press wm to display the most recently dialed number and use Y and to scroll through the list to view the other numbers 3 Press Y to see the second most recently dialed number or to see the oldest call on your list 4 To dial the displayed number press or lift the Handset or press any line keys play 5 Press GS orthe key to cancel Note The redial list is available during active calls It also stores up to the last 100 numbers you called allowing you to scroll through and select the number you wish to redial 41 001376 00 Rev 01 06 2013 95 Making Calls Deleting from the Redial List amp IP Phone UI 1 Press ED 2 Press Y and to find the item
159. ons 68 41 001376 00 Rev 01 06 2013 Line Keys and Programmable Keys Configuring an XML Key La Aastra Web UI Note Keys 5 and 6 SAVE and DELETE keys can be made configurable ONLY by your System Administrator 1 Click on Operation gt Programmable Keys Programmable Keys Configuration Key Type Value Line 1 Park v 2 Pickup v 3 Line v 3 Paging v 5 6 7 Speeddial x 9051234567 1 v 8 XML v http 10 70 3 7 ml menu menu php source all Services XML Application URI http 216 94 98 90 ml menu mymenu php source XML Application Title XML Menu BLF List URI 2 Select from Key 1 through Key 8 Keys 5 and 6 can be made configurable only by your system administrator 3 In the Type field select XML to apply to the key 4 Inthe Value field enter a URI s to apply to this key Note Contact your System Administrator for the appropriate value to enter in the Value field If you specify multiple URIs in the Value field a list of XML applications appears for selection after pressing the XML key 5 Inthe XML Application URI field enter the XML application URI provided by your System Administrator 6 Inthe XML Application Title field enter the XML application title that you want to display as the title for the key on your phone 7 Click Save Settings 41 001376 00 Rev 01
160. or hang up the handset 5 When you are finished speaking hang up the phone by placing the handset back on hook or by pressing Cc or the line call appearance key for the active call When you hang up the remote phone also hangs up Reference For more information about incoming intercom calls see Incoming Intercom Call Features on page 151 For more infor mation about outgoing intercom calls see Available Features Enabled by Administrators on page 156 84 41 001376 00 Rev 01 06 2013 Line Keys and Programmable Keys Services Key By default the 6730i has a Services key configured on Key 8 However using the Aastra Web UI you can assign the Services key to another available key if required Key 1 through Key 8 Keys 5 and 6 can be made configurable only by your system administrator Services Key The 6730i allows you to configure a Services key that when pressed on the phone displays the Services menu The Serv ices Menu can also be accessed via the IP Phone Ul at the location Options gt Services The Services key can access any XML applications setup by your System Administrator Contract your System Administrator for more information To configure a Services key you must configure a key with the function Services Use the following procedure to configure a key as a Services key using the Aastra Web UI
161. or more information 156 41 001376 00 Rev 01 06 2013 Available Features Enabled by Administrators Autodial Hotline and Warmline Your System Administrator can configure an autodial feature on your phone If autodial is enabled the phone automati cally dials a preconfigured number whenever it is off hook Depending on the configuration specified by your Administra tor the Autodial functions as either a hotline or as a warmline as follows e Hotline The IP phone immediately dials a preconfigured number when you lift the handset e Warmline The IP phone waits for a specified amount of time after you lift the handset before dialing a preconfigured number If you do not dial a number within the time allotted then the IP phone begins to dial the number The Autodial feature is available on a global or per line basis Contact your System Administrator for more information Notes 1 Any speed dial numbers that you configure on your IP phone are not affected by autodial settings 2 If Autodial is configured on your phone any lines that function as hotlines do not accept conference calls transferred calls and or intercom calls Centralized Conferencing The 6730i supports centralized conferencing for Sylantro and Broadsoft servers This feature provides centralized confer encing on the SIP server versus localized on the phone Your System Administrator must enable this feature on your phone before you can use centra
162. orresponding option to select an option 3 Change a selected option if applicable 4 Press the Set or Done key to save the change 5 Press the key the lt q key or the GS key at any time to exit without saving changes Reference For more information about customizing your phone using the available options from the IP Phone UI see the section Customizing Your Phone on page 20 For more information about Administrator options contact your System Administrator 12 41 001376 00 Rev 01 06 2013 Methods for Customizing Your Phone Phone Options via the Aastra Web UI In addition to the IP Phone UI options you can customize additional options on the IP Phone using the Aastra Web UI In order to access your phone using the Aastra Web UI you need to know your phone s IP address To find your phone s IP address see Finding Your Phones IP Address on page 17 Using the Aastra Web UI La Aastra Web UI 1 Open your web browser enter the phone s IP address or host name into the address field and press lt Enter gt The following logon screen displays Connect to 10 30 102 177 The server 10 30 102 177 at Aastra 6730i requires a username and password Warning This server is requesting that your username and password be sent in an insecure manner basic authentication without a secure connection User name user Password Remember my password Loc cancel 2 At the prom
163. process also displays the speed dial edit screen The edit screen allows you to change the Speed Dial Number and Line setting 2 If you press a key that is NOT setup as a speed dial key the phone displays an Invalid Key message However if you press and hold an empty keypad key or programmable key that is set to NONE it initiates the Add a Speed Dial Key process allowing you to setup a new speed dial key For more information see Press and Hold to Create a Speed Dial applicable to programmable keys and keypad keys on page 47 5 Edit the speed dial information as applicable and press SAVE Notes 1 You can cancel out of the speed dial editing process at any time without saving by pressing the key 2 You can also use the up arrow key to cancel when in Extension editing or the 3 left arrow key to cancel if in Line editing Pressing either of these keys displays the idle screen On the 6730i you can remove the Speed Dial Key by erasing the speed dial number digits leaving the speed dial value blank and then press SAVE or the right arrow key Use the left arrow key to delete the digits 41 001376 00 Rev 01 06 2013 53 Line Keys and Programmable Keys Editing a Speed Dial on a Programmable Key La Aastra Web UI 1 Click on Operation gt Programmable Keys Programmable Keys Configuration Key Type Value Line 1 Park v 2 Pickup 3 Line v 3 v
164. pt enter your username and password and click OK Note For a user the default user name is user and the password field is left blank 41 001376 00 Rev 01 06 2013 13 Methods for Customizing Your Phone The Status window displays for the IP phone you are accessing You can logout of the Aastra Web UI at any time by clicking Log Off 14 Status System Information Operation User Password Phone Lock Programmable Keys Keypad Speed Dial Directory Reset Basic Settings Preferences Account Configuration System Information Network Status Attribute Link State Negotiation Speed Duplex Hardware Information Attribute MAC Address Platform Firmware Information Attribute Firmware Version Firmware Release Code Boot Version Date Time SIP Status Line LAN Port Up Auto 100Mbps Full Value 00 08 5D 11 BB DC 6730i Revision 0 Value 3 2 2 2101 SIP 2 4 0 80 Sep 6 2012 02 07 03 SIP Account Status Backup Registrar Used 41 001376 00 Rev 01 06 2013 Methods for Customizing Your Phone The following categories display in the side menu of the Aastra Web UI Status Operation Basic Settings Headings Descriptions Status The Status section displays the network status and the MAC address of the IP phone It also displays hardware and firmware informa tion about the IP phone and information about the SIP account s currently configured on the phone The information in the S
165. r Custom mode you can enter different phone numbers for each account Notes 1 If you selected Account mode in step 2 you can enable disable each account or all accounts as applicable You can enter different phone number for each enabled state If you selected Custom mode you can enable disable each account or all accounts as applicable You can enter dif ferent phone numbers for each enabled state If you selected Phone mode all accounts are set to the same CFWD configuration All Busy and or No Answer as Account 1 on the phone In the Aastra Web UI only Account 1 is enabled All other accounts are grayed out but use the same configuration as Account 1 Using the Aastra Web UI if you make changes to Account 1 the changes apply to all accounts on the phone Using the IP Phone UI if you make changes to any other account other then Account 1 the changes also apply to all accounts on the phone When enabling a CFWD state you must specify a phone number for the phone to CFWD to The number you specify applies to all accounts of the same mode 2 Number and name of accounts that display to this screen are dependant on the number and name of accounts con figured on the phone In the screen in step 4 Screenname is configured on Line 1 Screenname2 is configured on Line 2 and Screenname3 is configured on Line 3 The name for the account is specified by your System Administrator Con tact your System Administrator fo
166. r Aastra prod uct at Aastra s option for a fixed charge You are responsible for all shipping charges For further information and shipping instructions In North America contact our service information number 1 800 574 1611 Outside North America contact your sales representative Note Repairs to this product may be made only by the manufacturer and its authorized agents or by others who are legally authorized This restriction applies during and after the Warranty Period Unauthorized repair will void the warranty 41 001376 00 Rev 01 06 2013 Warranty 1 Limited Warranty Australia Only The benefits under the Aastra Limited Warranty below are in addition to other rights and remedies to which you may be entitled under a law in relation to the products In addition to all rights and remedies to which you may be entitled under the Competition and Consumer Act 2010 Com monwealth and any other relevant legislation Aastra warrants this product against defects and malfunctions in accord ance with Aastra s authorized written functional specification relating to such products during a one 1 year period from the date of original purchase Warranty Period If there is a defect or malfunction Aastra shall at its option and as the exclusive remedy under this limited warranty either repair or replace the product at no charge if returned within the Warranty Period Repair Notice To the extent that the product contain
167. r more information 41 001376 00 Rev 01 06 2013 127 Managing Calls 9 For the No Answer state in the No Rings field enter the number of times that the account rings before forwarding the call to the specified number Valid values are 1 through 20 Default is 1 When using the Account mode or Custom mode you can enter a different number of rings for each account If you use the Aastra Web UI to change the Call Forward Key Mode to Phone all accounts synchronize to Account 1 10 Optional You can configure a Call Forward key on your phone to access the Call Forward menus if desired You can also access the Call Forward menu from the IP Phone UI at the path Options gt Call Forward To create a Call Forward key see Call Forward Key on page 75 11 Click Save Settings The changes takes affect immediately without a reboot Using CFWD via the IP Phone UI Once CFWD is enabled on your phone you can access and change the configuration using the IP Phone UI or the Aastra Web UI You can access the CFWD menus by pressing a pre configured Call Forward key or by selecting Options gt Call Forward from the IP Phone UI The following procedure assumes you have already configured a CFWD key AND assumes there are three accounts con figured on the phone Notes 1 If there is no CFWD key configured on the phone or it is removed you can still enable CFWD via the IP Phone Ul at the path Options gt Call Forward
168. rable only by your system administrator 3 In the Type field select Paging 4 In the Value field enter a multicast IP address and a port number for the Paging key When you press this key the phone initiates an outgoing multicast RTP session to the specified address using the specified port For example 239 0 1 15 10000 Note The Value field allows for one multicast address entry only 5 To receive RTP steams for Group Paging you must also configure the Paging Listen Addresses parameter at the path Basic Settings gt Preferences gt Group Paging RTP Settings For more information about setting this parameter see Group RTP Paging receives RTP streams on page 153 6 Click Save Settings 41 001376 00 Rev 01 06 2013 89 Line Keys and Programmable Keys Using the Paging Key The following procedure describes the use of the Paging key on the IP Phone The procedure assumes you have already configured the Paging key using the Aastra Web UI amp IP Phone UI Notes 1 Recipient of a Paging call can set a global Do Not Disturb DND to ignore any incoming pages 2 For incoming Paging the phone uses the Intercom configuration settings The incoming Page is dependant on the Allow Barge In parameter setting and the Idling On Call state 1 On the IP Phone press the key you configured for Paging The phone opens a multicast RTP session and an outgoing OR incoming phone screen display
169. ration of inactivity on an active line Default is O Valid values are O to 999 4 Click Save Settings 41 001376 00 Rev 01 06 2013 149 Additional Features Message Waiting Indicator You can configure the Message Waiting Indicator MWI to illuminate for a specific line or for all lines For example if you configure the MWI LED on line 3 only the LED illuminates if a voice mail is pending on line 3 If you configure the MWI LED for all lines the LED illuminates if a voice mail is pending on any line on the phone lines 1 through 6 You configure the MWI indicator using the Aastra Web UI Configuring Message Waiting Indicator La Aastra Web UI Use the following procedure to configure the message waiting indicator on a specific line or on all lines on the IP phone Note Message Waiting Indicator Line parameter is set to ALL lines by default 1 Click on Basic Settings gt Preferences gt General Preferences General Display DTMF Digits Play Call Waiting Tone Stuttered Dial Tone XML Beep Support Status Scroll Delay seconds Switch Ul Focus To Ringing Line Call Hold Reminder During Active Calls Call Hold Reminder Call Waiting Tone Period Preferred line Preferred line Timeout seconds Message Waiting Indicator Line DND Key Mode Call Forward Key Mode C Enabled V Enabled M Enabled M Enabled 5 M Enabled C Enabled C Enabled 1 E 0 An Y
170. referred line Timeout seconds 0 Message Waiting Indicator Line All DND Key Mode Phone w Call Forward Key Mode Account v 2 Stuttered dial tone is enabled by default If required disable the Stuttered Dial Tone field by unchecking the check box 3 Click Save Settings 41 001376 00 Rev 01 06 2013 141 Additional Features XML Beep Support Using the Aastra Web UI you can enable or disable a beep to be audible when the phone receives an XML application using the XML Beep Support field at the path Basic Settings gt Preferences gt General If you disable this feature then no beep is heard when the XML application arrives to the phone If your System Administrator has set a value for this feature in a custom XML application or in the configuration files the value you set in the Aastra Web UI overrides the Administrator s setting Setting and saving the value in the Aastra Web Ul applies to the phone immediately Configuring XML Beep Support La Aastra Web UI Use the following procedures to configure an XML beep on the IP phone Note XML Beep Support is enabled by default 1 Click on Basic Settings gt Preferences gt General Preferences General Display DTMF Digits Play Call Waiting Tone Stuttered Dial Tone XML Beep Support Status Scroll Delay seconds Switch Ul Focus To Ringing Line Call Hold Reminder During Active Calls Call Hold Reminder Call Waiting Tone Period Pref
171. represents The line call appearance light indicates the status of that line or call When the phone is taken off hook the phone automat ically selects a line for you Fine Cali appeoarance Light Line Call Appearance Status Behavior Off Idle line or no call activity Light flashes quickly Ringing Light is solid Connected Light flashes slowly Hold When you have more than one call you can use the left and right navigation keys el and p gt to scroll left and right to the different call information Icons lt q and p gt appear if there is call information either left right or both sides of the cur rent information you are viewing The display shows which line the call information is referring to L1 L2 L3 etc the Caller ID information name and number if available the call status Connected Ring Hold etc and the timer specific to that call 42 41 001376 00 Rev 01 06 2013 Line Keys and Programmable Keys Programmable Keys There are eight function keys on the 6730i phone all 8 of which are programmable located on both sides of the paper label Note Programmable Keys after Admin Reconfigures Save Key Services Programmable Keys The SAVE and DELETE keys are programmable ONLY after an Administrator has re configured these keys For more information about the SAVE and DELETE keys see Configurable Save and Delete Keys on page 160 You can u
172. rmat you want to use on your phone Valid values are e 12h 12 hour format default e 24h 24 hour format Note The time and time format you configure display on the phone s idle screen 28 41 001376 00 Rev 01 06 2013 Customizing Your Phone 3 In the Date Format field select the date format you want to use on your phone Default is WWW MMM DD Valid values are WWW MMM DD default e DD MMM YY YYYY MM DD e DD MM YYYY DD MM YY e DD MM YY MM DD YY e MMM DD e DD MMM YYYY e WWW DD MMM e DD MMM e DD MM YYYY Note The date and date format you configure display on the phone s idle screen 4 Inthe NTP Time Servers field enable by checking the checkbox or disable by unchecking the box default is enabled 5 In the Time Server 1 Time Server 2 and Time Server 3 fields enter IP addresses or qualified domain names for the primary secondary and tertiary time servers Note Time Servers can only be entered if NTP Time Servers is enabled 6 Click Save Settings 41 001376 00 Rev 01 06 2013 29 Customizing Your Phone Language The IP phones support several different languages You can have the IP Phone Ul and the Aastra Web UI display in a spe cific language as required When you set the language to use all of the display screens menus services options config uration parameters etc display in that language The IP phones support the following langu
173. rogrammable Keys 8 Top Keys all 8 keys are programmable Keys 5 and 6 are designated as the SAVE and DELETE keys respectively These keys must be made configurable by the System Administrator before they can be changed The following are the default functions for the programmable keys on the 6730i IP phone 1 None 2 None 3 None 4 None 5 SAVE Allows you to save numbers preconfigured and or names to the Directory Using this key you enter the number name and line or speed dial key to record in the Directory List 6 DELETE Allows you to delete entries preconfigured from the Directory List and Callers List Must enter the Directory or Callers list and select an entry then press twice to delete entry 7 DIRECTORY Displays up to 200 names preconfigured and phone numbers stored in alphabetical order 8 SERVICES Accesses enhanced features preconfigured and services through the Serv ices menu Note For more information about configuring the SAVE and DELETE keys see Configurable Save and Delete Keys on page 160 For more information about programming keys to perform specific functions see Line Keys and Programmable Keys on page 42 41 001376 00 Rev 01 06 2013 IP Phone Keys Keypad Keys The 6730i has a keypad with digits from 0 through 9 a key and a key Keys 2 through 9 contain the letters of the alphabet The 6730i phone keypad includes the following
174. rwarding and call forwarding modes see Call Forward Account Based Configuration on page 124 Configuring a Call Forward La Aastra Web UI Note Keys 5 and 6 SAVE and DELETE keys can be made configurable ONLY by your System Administrator 1 Click on Operation gt Programmable Keys Programmable Keys Configuration Key Type Value Line 1 Call Forward v 2 Pickup v Line el D m 4 Paging v 5 6 7 Speeddial y 9051234567 1 v 8 XML v http 10 70 3 7 xml menu menu php source all 2 Select from Key 1 through Key 8 Keys 5 and 6 can be made configurable only by your system administrator 3 In the Type field select Call Forward 4 Click Save Settings 41 001376 00 Rev 01 06 2013 75 Line Keys and Programmable Keys BLF Xfer The BLF key allows one or more extensions to be monitored and once there is any state change with those extensions the key shows the status of the monitored lines The Xfer key allows a call to be transferred to other recipients blindly or consultatively The BLF Xfer key combines the BLF and Xfer key s functionality together allowing the user to transfer calls or use BLF with one key Note It is recommended that you enable the Switch UI Focus to Ringing Line parameter when using the BLF Xfer feature For more information about this parameter see Switch Ul Focus to Ringing Line
175. ry List page 111 Delete an Entry from the Directory List page 112 e Save an Entry to the Directory List page 113 Add a New Entry to the Directory List Q IP Phone UI Use the following procedures to add a new entry to the Directory List Use the following illustration as a reference Save Key Delete Key Directory Key Note Use the lt Key when required for backspacing You can exit the entry process any time by pressing the GS Key 1 Press the Directory Key Key 7 2 Press Save Key 5 The Enter Number prompt displays 41 001376 00 Rev 01 06 2013 109 Managing Calls 3 Enter a phone number using the numbers on the keypad and press Save To backspace and erase a mistake press lt or press the Delete Key Key 6 The Press 1st letter to enter name prompt displays 4 Enter a name to associate with the phone number you just entered and press Save Use the keypad to select the letters Continue to press the number key to access the next letter for that key for example press 2 three times to access C Press p gt to move to the next space or wait a moment and the cursor automatically advances To insert a space between letters press p gt To backspace and erase a mistake press ef or press the Delete Key The Line prompt displays The default is Line 1 5 If you
176. s 5 Enter the phone number of Party 3 Note Users are not able to edit the destination number as the phone will either match the inputted number to a dial plan or wait for the set digit timeout 6 Wait for Party 3 to answer When Party 3 answers you can consult with them before adding them to the conference 7 Press the Conf key E again to add Party 3 to the conference Party 1 which is yourself Party 2 and Party 3 are all connected to a single conference 8 To drop a party from the conference use the navigation key to select the party and press the Drop key Note You can use Y and to scroll through and see the numbers and names if available of the parties in the conference call When a name is displayed pressing p gt drops the displayed party from the call Joining Two Active Calls in a Single Conference amp IP Phone UI 1 Begin with active calls on two different lines for example Line 1 and Line 2 have active calls Press the Line key for which you want to conference the two calls together for example Line 1 Press the Conf key Cc Press the Line key that has the second active call for example Line 2 Qm Bb W N Press the Conf key Es The two active calls link into a conference call on Line 1 Note You can use Y and A to scroll through and see the numbers and names if available of the parties in the conference call When a name is displayed pressing B gt drops the displa
177. s Parties 1 through 4 on Conference 1 13 To add more parties repeat steps 8 through 12 If any party in the conference hangs up including the party that began the conference all other parties in the confer ence are still connected Setting Up Multiple Conferences for Sylantro Server only Note The 6730i is limited to 6 conferences a single conference each on lines 1 through 6 1 Start Conference 1 using the procedures in the previous section Setting Up a Conference and Adding Multiple Parties for Sylantro and Broadsoft Servers 2 When you are finished adding all required parties to Conference 1 press an available Line Key to start Conference 2 You are Party 1 on Conference 2 Call Party 2 When Party 2 answers press the Conf Key E Press an available Line Key Call Party 3 for Conference 2 a uu b Gu When Party 3 answers press the Conf Key tojoin Parties 1 whichis yourself Party 2 and Party 3 on Conference 2 You now have two active conferences on two different lines Note When you are connected to multiple conference calls and you put a conference on hold the conference may be on hold for a limited period of time before it is disconnected Contact your System Administrator for more information If any party in a conference hangs up including the party that began the conference all other parties in the conference are still connected Joining Additional Parties to Active Conferences
178. s again when you are busy with an active call The table below shows the status of the LED as they may appear on your IP phone Phone Model Status Logged In and Available Status Unavailable Logged Out 6730i Solid Red LED Blinking red LED No LED Using the ACD Key Use the following procedure to log into a phone queue from your IP phone Ey IP Phone UI 1 Check with your Administrator to verify the queue linked to your ACD Key 2 Press the ACD Key on your IP phone The LCD displays the label of the ACD queue you are accessing The User ID prompt displays ACD lt Queue Label gt User ID W Next p Login 3 Using the keypad enter your User ID phone number provided by your System Administrator and press the Y Key The Password prompt displays ACD lt Queue Label gt Password W Next p Login 4 Using your keypad enter your Password provided by your System Administrator and press the Y Key 5 Press p gt Login to login to the queue You are logged into the queue and the following screen displays ACD lt Queue Label gt W Avail p Logout 6 To allow your phone to be available in the queue press Y Avail The following screen displays ACD lt Queue Label gt W Unavail p Logout If your IP phone status is set to Available then the server begins to distribute phone calls from this queue to your IP phone You must manually change the state to Avai
179. s as follows Paging Vv Drop 2 Press the Drop key to end the multicast RTP session and return to the idle screen Note If you enable global DND on the phone the incoming multicast RTP session is dropped 90 41 001376 00 Rev 01 06 2013 Line Keys and Programmable Keys None Key You can set a key to force a blank entry on the IP phone display for a specific key You do this by setting the key to none If a particular key is not defined it is ignored Setting a None Key La Aastra Web UI Use the following procedure to configure a None key on the 6730i IP Phone Note Keys 5 and 6 SAVE and DELETE keys can be made configurable ONLY by your System Administrator 1 Click on Operation gt Programmable Keys Programmable Keys Configuration Key Type Value Line 1 None v 2 Pickup v 3 Line 3 v 4 Paging v 5 6 7 Speeddial 9051234567 1 Y 8 XML vw http 10 70 3 7aml menu menu php source all 2 Select from Key 1 through Key 8 Keys 5 and 6 can be made configurable only by your system administrator 3 In the Type field select None 4 Click Save Settings 41 001376 00 Rev 01 06 2013 91 Line Keys and Programmable Keys Deleting a Key La Aastra Web UI Use the following procedure to delete a key function using the Aastra Web UI Note Keys 5 and 6 SAVE and DELETE keys can be made co
180. s as running and the Line and main LEDs flash amp IP Phone UI To place acall on hold 1 Connect to the call if not already connected 2 Press the Hold key The line call appearance light begins to flash slowly and after a short time the phone beeps softly to remind you that you still have a call on hold The screen displays Call Held with the line number the call is held at the phone Note If you are connected to another call the phone does not beep to remind you that you still have a call on hold When on Hold To let your caller know that they are still on hold music plays softly if this has been set up for your system The call line appearance light for the line you are on flashes to indicate that you are still connected John 1051 La 01 17 Automatic Hold When juggling between calls you do not have to press the hold key to go from one call to the next The phone automat ically puts your current call on hold as soon as you press a new line call appearance key If you have more than one call on hold you can reconnect to a held call by pressing the line call appearance key where that call is being held Press E to disconnect the call Retrieving a Held Call If you have more than 1 call on hold you can scroll through the held call information by pressing E and p gt navigation keys To reconnect to a call press the line call appearance key where that call is being held If you press the cal
181. s describe locking the phone setting an emergency dial plan and resetting the user password 41 001376 00 Rev 01 06 2013 39 Customizing Your Phone Locking Unlocking a Phone Use the following procedures to lock an IP phone and prevent it from being used or configured IP Phone UI Lock the Phone 1 Press on the phone to enter the Options List 2 Select Phone Lock and press Enter 3 At the Lock the phone prompt press Yes The message Phone is locked displays Unlock the Phone 4 Press on the phone to enter the Options List 5 At the prompt Password enter your user password and press Enter The phone unlocks La Aastra Web UI 1 Click on Operation gt Phone Lock Phone Lock Lock or unlock the phone Emergency Dial Plan 911199911121110 Lock the phone Reset User Password Save Settings Lock the Phone 2 Inthe Lock the Phone field click Lock The phone locks dynamically and displays the following message Phone is locked Unlock the Phone 3 Click on Operation gt Phone Lock 4 Inthe Unlock the Phone field click Unlock The phone unlocks dynamically and displays the following message Phone is unlocked 40 41 001376 00 Rev 01 06 2013 Customizing Your Phone Defining an Emergency Dial Plan Public telephone networks in countries around the world have a single emergency telephone number emergency serv ices number that allows a caller to contact local em
182. s disabled as indicated by an X Screenname3 has one or more CFWD states configured but a specific state has no call forward phone number configured as indicated by a Items 4 and 5 allow you to disable or enable CFWD on all accounts respectively 2 Select an account to configure Press the Change key The CFWD Mode screen displays Use the Up and Down arrow keys to scroll through each state screen Cfwd Mode Indicates CFWD All enabled Indicates no CFWD phone number Cra Mode i 3 NoAns rd for Pa ee Indicates cd Mate CFWD NoAns anne enabled Cfwd Mode 5 AllOn Done In the above example the account has CFWD All and CFWD NoAns enabled as indicated by a check mark 1 The CFWD Busy setting is enabled for the account but has no call forward phone number configured as indicated by a 3 Select a state for the account s in focus using the Up and Down arrow keys You can enable disable any or all of the following states for a specific account or for all accounts with individual configurations All Enables CFWD All for an account and forwards all incoming calls for that account to the specified number The phone number can be different between accounts e Busy Enables CFWD Busy for an account and forwards incoming calls to a specified number if DND has been enabled for that account OR if that account is currently engaged in another call The phone number can be different between accounts No An
183. s esd Revie daw wns TS AA AS ayawaska AAA aa ida 1 Requirements A das tb eee ee awl 2 Installation and Set D Q e ce ad aa iaa 2 Getting S o UE o a ieee 3 Plugging in and Starting the Phone 3 IAE SETOCOS ici di ri a A ee 5 Incomplete Configuration res u u u u anin iaa a E i A E aE E ERA A 6 Ta E E E E E EE EE 6 IP Phone Keys uu un u a u a e ON 7 KEY PANEL 0 A A wie es atinaa wie et Seow dew yaaa AAA 7 Key Description isis ceding Vader Kadota nae EEEE EE ET EE eae daa EEE 8 Keypad KEYS ici is a a E 10 Methods for Customizing Your Phone 11 Phone Options via the IP Phone Ul 11 Phone Options via the Aastra Web Ul 13 Phone Stats uu u u uuu rro Saqta waqa gaa ey 16 Phone Status via IP Phone Ul u trir prepa ain ai e dd ia 16 Phone Status via the Aastra Web Ul u u ison teu A da 17 Customizing Your Phone o ooooooccoccccccccccoo coccion nnn rra 20 Ring Tones and Tone Sets oia iii A e A aa PRTG Pa eg STAG Pa AA AA 20 Contrast Levl as 23 Live DIOIpad oo priini i uer Teana ai EE di ii Ai 23 S tA di oi a a E E A ibas 24 TICA EO a Iii 25 Us r PGssWord nearse aa a ia 37 Resetting a User PassWord u uuu uu saus di 38 Restartin
184. s playing of an audio file via XML commands created by your Administrator The RTP and multicast RTP commands allow the phone to send receive an RTP stream to from given multicast unicast addresses without involving SIP signalling Notes 1 When an RTP stream is being sent with RTP recording and simultaneous playing mix the IP Phone LCD displays an icon with an m on top to indicate that a mixed RTP stream is being sent 2 When RTP stream is being received with RTP recording and simultaneous playing mix you can use the volume con trols on the IP phone to adjust the volume increase or decrease to your specifications Contact your System Administrator for more information about this feature Hold Feature Enhancement for Broadsoft Servers The Hold feature allows you to put an active call on hold then retrieve the call later This enhancement is intended for IP phones operating with servers that support RFC3264 for example Broadsoft If a server does not support RFC3264 then the IP phones do not use RFC3264 functionality Configurable Save and Delete Keys There are six function keys on the 6730i phone located to the left of the paper label Your System Administrator can make the Save and Delete keys Keys 5 and 6 programmable keys with the same functions that are available for the other pro grammable keys By default the Save key allows you to save entries to the Directory and perform a Save To from the Cal
185. s user generated data you should be aware that repair of the goods may result in loss of the data Goods presented for repair may be replaced by refurbished goods of the same type rather than being repaired Refurbished parts may be used to repair the goods If it is necessary to replace the product under this limited warranty it may be replaced with a refurbished product of the same design and color If it should become necessary to repair or replace a defective or malfunctioning product under this warranty the provi sions of this warranty shall apply to the repaired or replaced product until the expiration of ninety 90 days from the date of pick up or the date of shipment to you of the repaired or replacement product or until the end of the original Warranty Period whichever is later Proof of the original purchase date is to be provided with all products returned for warranty repairs Exclusions Aastra does not warrant its products to be compatible with the equipment of any particular telephone company This warranty does not extend to damage to products resulting from improper installation or operation alteration accident neglect abuse misuse fire or natural causes such as storms or floods after the product is in your possession Aastra will not accept liability for any damages and or long distance charges which result from unauthorized and or unlawful use To the extent permitted by law Aastra shall not be liable for any incident
186. sable a specific account on the phone with any or all of the following states However the config uration you set will apply to all accounts on the phone All Enables CFWD All on the phone and forwards all incoming calls to the specified number Busy Enables CFWD Busy on the phone and forwards incoming calls to a specified number if DND has been enabled OR if the phone is currently engaged in another call No Answer Enables CFWD NoAns on the phone and forwards incoming calls to a specified number if the call has not been answered for the specified number of rings Note If CFWD All AND CFWD Busy AND CFWD NoAns are all enabled and or if the account has DND enabled the CFWD All settings take precedence over CFWD Busy and CFWD NoAns You can also use the following keys if required All Off Disables all CFWD states for the phone All On Enables all CFWD states for the phone Note In Phone mode the initial configuration you set for an account applies to all the accounts on the phone 41 001376 00 Rev 01 06 2013 131 Managing Calls 5 Press the CHANGE key for the mode you selected in Step 2 Scroll to the CFWD State screen This screen displays the current state of the mode you selected In the following example the CFWD All state is ON Cfwd State 1 Cfwd All On Use Wa to view Y Next CFWD State Cfwd State Screen off 6 Press the CHANGE key in the CFWD State screen Press NEXT to to
187. se that new password to log into the Aastra Web UI using the Aastra Web UI use that new password when changing the user password via the IP Phone UI Note Valid values when creating or changing a password are 0 to 4294967295 integers only symbols and alpha characters are not allowed Default password is an empty string field is blank Setting a User Password Ey IP Phone UI 1 Press on the phone to enter the Options List Select Password and press Enter At the Current Password prompt enter the current user password and press Done At the New Password prompt enter the new user password and press Done Qm Bb W N At the Enter Again prompt re enter the new user password and press Done A message Password Changed displays on the screen La Aastra Web UI 1 Click on Operation gt User Password Reset User Password Please enter the current and new passwords Current Password Pen New Password eeeee Password Confirm eccccece Save Settings 2 In the Current Password field enter the current user password Note By default the user name is user all lowercase and the password field is left blank 3 In the New Password field enter the new user password 4 Inthe Password Confirm field enter the new user password again 5 Click Save Settings 41 001376 00 Rev 01 06 2013 37 Customizing Your Phone Resetting a User Password If you forget your
188. se the Aastra Web UI only to configure key functions The following table lists the functions you can set on the programmable keys and provides a description for each function Key Function Description None Indicates no setting for the key Line Indicates the key is configured for line use Speed Dial Indicates the key is configured for speed dial use You can also configure a prefix for a speed dial number Do Not Disturb Indicates the key is configured for do not disturb on the phone Busy Lamp Field BLF Indicates the key is configured for Busy Lamp Field BLF use User can dial out on a BLF configured key BLF List Indicates the key is configured for BLF list use User can dial out on a BLF List configured key Auto Call Distribution ACD For Sylantro Servers Indicates the key is configured to allow the Sylantro server to distribute calls from a queue to registered IP phone users agents Directed Call Pickup DCP Feature dependant on your call manager Indicates the key is configured to allow you to intercept or pickup a call on a monitored extension s Group Call Pickup GCP XML Indicates the key is configured to accept an XML application for accessing customized XML services You can also specify an XML key URL for this option Flash Indicates the key is set to generate a flash event when it is pressed on the 6730i The IP phone generates flash events o
189. st has a 6730i running Broadsoft firmware that subscribes to a list of extensions from the BroadWorks Appli cation Server On the 6730i running Broadsoft firmware the key LEDs illuminate either flashing solid or turn off depend ing on the state of those extensions Note The Broadworks BLF feature is not the same as the Broadworks Shared Call Appearance SCA feature and does not per mit call control over the monitored extension 58 41 001376 00 Rev 01 06 2013 Line Keys and Programmable Keys Configuring a BLF List Key La Aastra Web UI The BLF List function can be configured on the 6730i using the Aastra Web UI only If you set a key to use BLF List you must also enter a BLF List URI at Operation gt Programmable Keys gt Services The BLF List URI is the name of the BLF list defined on the BroadSoft BroadWorks Busy Lamp field page for your particular user For example sip 9 192 168 104 13 The value of the BLF List URI parameter must match the list name configured Otherwise no values display on the 6730i screen and the feature is disabled Note Keys 5 and 6 SAVE and DELETE keys can be made configurable ONLY by your System Administrator 1 Click on Operation gt Programmable Keys Programmable Keys Configuration Key Type Value Line 1 BLFiList r y 2 Pickup v 3 Line y 3 v 4 Paging a 5 6 7 Speeddial xj 9051234567 1 v 8 XML w http 10
190. swer Enables CFWD NoAns for an account and forwards incoming calls to a specified number if the call has not been answered for a specified number of rings The phone number can be different between accounts Note If CFWD All AND CFWD Busy AND CFWD NoAns are all enabled and or if the account has DND enabled the CFWD All settings take precedence over CFWD Busy and CFWD NoAns You can also use the following keys if required All Off Disables all CFWD states for the current account in focus or all accounts All On Enables all CFWD states for the current account in focus or all accounts 134 41 001376 00 Rev 01 06 2013 Managing Calls 4 Press the Change key for the mode you selected in step 2 Scroll to the CFWD State screen This displays the current state of the mode you selected In the following example the CFWD All state is ON Cfwd State On Y Next v CFWD State 1 Cfwd State Cfwd State Screen On off lt Done p Change Y Next 5 Press the Change key in the CFWD State screen Press Next to toggle the state of the CFWD state ON or OFF In the example in Step 4 you press Next to change the option to Off 6 Press the Set key to save the change 7 In the CFWD State screen press the Down arrow key to scroll to the CFWD Number screen and press Change CFWD Number 2 Cfwd Number Cfwd Number Screen _ p gt 4 Done p Change k Cancel 8 Enter a phone number to apply
191. t under Set Audio gt Audio Mode determines if the call goes to handsfree or headset operation For more information see Set Audio on page 24 If the phone is already connected to a call pressing the line call appearance key for the new incoming call automatically places the connected call on hold and answers the new call To reconnect to a party press the line call appearance key for that call If you cannot answer the call the caller goes to voicemail has been configured for your extension Note The CGS key can be used to cancel the call pickup procedure Sending an Incoming Call to Voicemail You can send an incoming call directly to voicemail without answering the call To do this press without picking up the handset If you re already on the phone your incoming call should go directly to voicemail Your phone screen dis plays a voicemail icon 4 along with the number of waiting messages if you have unheard messages example x4 41 001376 00 Rev 01 06 2013 97 Handling Calls When you are connected to a call you can use the hard keys or programmable keys on the phone to place a call on hold transfer a call or conference Placing a Call on Hold You can place an active call on hold by pressing the Hold key When you place a call on hold only your phone can retrieve the call When a call is on hold the icon displays on hook as follows Call held 01 25 For on hold calls the timer display
192. tatus window is read only Operation User Password Allows you to change user password For more information about changing User Password see User Password on page 37 Phone Lock Allows you to assign an emergency dial plan to the phone lock the phone to prevent any changes to the phone and to prevent use of the phone and reset the user password Programmable Keys There are 8 function keys that you can configure to perform the functions identified in the following list Your Administrator must unlock the SAVE and DELETE keys in order for these keys to be configurable For more information about the SAVE and DELETE keys see Configurable Save and Delete Keys on page 160 e None e Pickup e Line Last Call Return Icr Speed Dial e Call Forward Do Not Disturb DND e BLF Xfer e Busy Lamp Field BLF Speeddial Xfer e BLF List Speeddial Conf e Auto Call Distribution ACD Directory e Directed Call Pickup e Icom Intercom e Extensible Markup Lan Services guage XML e Flash e Phone Lock e Sprecode Paging e Park Keypad Speed Dial Allows you to assign a speed dial number to a specific digit on the phone s keypad for speed dialing purposes Directory Allows you to copy the Callers List and Directory List from your IP phone to your PC Reset Allows you to restart the IP phone when required Basic Settings Preferences Allows you to enable disable the following e Display DTMF Digits e
193. te pressing the Speeddial Xfer key causes the phone to go offhook and dial the predefined extension Speeddial Xfer and Blind Transfer When the phone is connected to a call pressing the Speeddial Xfer key blind transfers the call to the predefined tar get If transferring a call fails a message Transfer Failed displays and you can reconnect the call get the call back by pressing the line key again Speeddial Xfer and Call Forward When the phone is in the Ringing state pressing the Speeddial Xfer key forwards the call to the predefined exten sion 78 41 001376 00 Rev 01 06 2013 Line Keys and Programmable Keys Configuring a Speeddial Xfer Key La Aastra Web UI Note Keys 5 and 6 SAVE and DELETE keys can be made configurable ONLY by your System Administrator 1 Click on Operation gt Programmable Keys Programmable Keys Configuration Key Type Value Line 1 Speeddial xfer 5551212 2 v 2 Pickup v 3 Line v 3 v 4 Paging v 5 6 7 Speeddial vw 9051234567 1 v 8 XML vw http 10 70 3 7 xml menu menu php source all Select from Key 1 through Key 8 Keys 5 and 6 can be made configurable only by your system administrator Inthe Type field select Speeddial Xfer In the Value field enter the speed dial extension or the extension to transfer calls to for example 5551212
194. the Seller and its Suppliers or dis seminate or otherwise disclose the Software to third parties All Software furnished hereunder whether or not part of firmware including all copies thereof are and shall remain the property of Seller and its Suppliers and are subject to the terms and conditions of this agreement All rights reserved Customer s use of this software shall be deemed to reflect Customer s agreement to abide by the terms and conditions contained herein Removal or modification of trademarks copyright notices logos etc or the use of Software on any Equipment other than that for which it is intended or any other material breach of this Agreement shall automatically terminate this license If this Agreement is terminated for breach Customer shall immediately discontinue use and destroy or return to Seller all licensed software and other confidential or proprietary information of Seller In no event shall Seller or its suppliers or licensors be liable for any damages whatsoever including without limitation damages for loss of business profits business interruption loss of business information other pecuniary loss or consequential dam ages arising out of the use of or inability to use the software even if Seller has been advised of the possibility of such damages ii 41 001376 00 Rev 01 06 2013 Contents Software License Agreement ci r r ii Welcome iia Ni 1 About This Guide os 1 PRONG FOGEUTES L u u u na
195. the hands free speakerphone Headset Mic Volume The Headset Mic Volume option allows you to set the volume level for the headset microphone 24 41 001376 00 Rev 01 06 2013 Setting Audio Mode and Headset Mic Volume Customizing Your Phone amp IP Phone UI 1 2 3 4 5 Press on the phone to enter the Options List Select Preferences Select Set Audio Select Audio Mode Select the audio mode you want to use on your phone Valid values are Speaker e Headset Speaker Headset e Headset Speaker Press Set to save your selection Select Headset Mic Volume Select the Low Medium or High volume level Press Set to save your selection Time and Date On the IP phones you can configure the following Time and date Time and date format Time zone Daylight savings time Time Servers Note Only the Time and Date Formats and Time Servers can be set using the Aastra Web Ul 41 001376 00 Rev 01 06 2013 25 Customizing Your Phone Configuring Time and Date Use the following procedures to configure the time and date settings on the IP phone IP Phone UI Set Time and Time Format 1 Press on the phone to enter the Options List 2 Select Preferences 3 Select Time and Date 4 Select Set Time 5 Using the keys on the keypad enter a time to set on the IP phone Use the lt 4andp navigation keys to move backward or forward when entering
196. the line for which to apply the Group Call Pickup configuration Valid value are 1 through 6 amp IP Phone UI Note Before using the DCP GCP feature on your phone you must first configure the DCP or GCP Key You must identify the extension s or phone number s you want to monitor when configuring the key See the previous procedures to con figure a DCP or GCP Key 66 41 001376 00 Rev 01 06 2013 Line Keys and Programmable Keys Using Directed Call Pickup DCP 1 When the monitored extension receives a call press the DCP Key to pick up the call Ifthe monitored extension receives multiple incoming calls simultaneously the phone displays a list of incoming calls 2 Use the and Y keys to scroll through the list to select an extension 3 Press Y Pickup Key for the extension you select The call is answered Using Group Call Pickup GCP 1 If any of the monitored group of extensions receives a call press the GCP Key The call is answered If the monitored group of extensions receives multiple incoming calls simultaneously the phone displays a list of incoming calls 2 Use the and Y keys to scroll through the list to select an extension 3 Press Y Pickup Key for the extension you select The call is answered DCP on line Select an extension gt 1 2201 Press the Pickup Y Pickup Key to answer the call 41 001376 00 Rev 01 06 2013 67 Line Keys and Programmable Keys XML Key
197. the number of entries in your list If the Directory list is empty Directory Empty Use Save to add is displayed Directory empty Use Save to add 2 You can access entries by pressing Y and to scroll through the list 108 41 001376 00 Rev 01 06 2013 Managing Calls 3 To search for an entry by name press the dial pad number corresponding to the first letter of the name for example press 7 for the letter P Continue to press the dial pad number to access other letters on the same key for example press 7 three times for Ron If there are multiple entries under the same letter you can use Y and to scroll through the list or continue to press the next letters of the name to find a better match 4 To dial the displayed number press E o just lift the handset or press any Line Key 5 Press the Directory Key to cancel Sorting Entries and Quick Search Feature You can also sort multiple numbers according to preference and perform a quick search feature that allows you to enter the first letter that corresponds to a name in the Directory to find specific line items The phone displays the first name with this letter Note The quick search feature in the Directory List works only when the Directory is first accessed Managing the Directory List From the Directory List in the IP Phone Ul you can perform the following Add a New Entry to the Directory List page 109 Edit an Entry in the Directo
198. the time Use the key to set either AM or PM fo Press Set to save the time setting 7 Select Time Format 8 Using the navigation keys set the Time Format to either a 12 hour format or a 24 hour format Valid values are 12 Hour and 24 Hour Default is 12 Hour 9 Press Set to save the Time Format you selected Set Date and Date Format Select Preferences Select Time and Date Select Set Date bh W N Using the keys on the keypad enter a date to set on the IP phone Use the lt and gt navigation keys to move backward or forward when entering the date ul Press Set to save the date setting 6 Select Date Format 7 Select a date format from the list of options Default is WWW MMM DD Valid values are WWW MMM DD default e DD MMM YY e YYYY MM DD e DD MM YYYY e DD MM YY e DD MM YY e MM DD YY e MMM DD e DD MMM YYYY WWW DD MMM e DD MMM DD MM YYYY 8 Press Set to save the Date Format setting Set Time Zone 1 Select Preferences 2 Select Time and Date 26 41 001376 00 Rev 01 06 2013 Customizing Your Phone 3 Select Time Zone 4 Press to display a list of Time Zone options A list of Time Zones display for different areas of the world 5 Select a Time Zone that applies to your area by using the navigation keys The default Time Zone is US Eastern Note For a list of the Time Zone values available on the IP Phone see Appendix A Time Zone Codes
199. to the current setting of Account 1 DND in Account Mode 1 With the account in focus on the IP Phone UI press the DND key to toggle DND ON or OFF for the account 2 Use the RIGHT and LEFT arrow keys to scroll through each account DND On Jan 1 12 96 1 Screenname i Screenname2 Jan 1 12 96 3 Screenname3 DND On Jan 1 12 96 In the above example Screenname1 Screenname2 and Screenname3 are three accounts configured on the phone Only Screenname1 and 3 have DND ON Screenname 2 has DND OFF DND in Phone Mode Default 1 Press the DND key to toggle DND ON or OFF for all accounts on the phone Toggling to ON enables DND on all accounts on the phone Toggling to OFF disables DND on all accounts on the phone 2 Use the RIGHT and LEFT arrow keys to scroll through each account 1 Screenname1 2 Screenname2 DND On DND On Jan 1 12 96 Jan 1 12 96 3 Screenname3 DND On Jan 1 12 96 In the above example toggling Screenname1 to DND ON enabled DND for Screenname2 and 3 also 41 001376 00 Rev 01 06 2013 123 Managing Calls DND in Custom Mode 1 Pressthe DND key onthe phone The screen displays alist ofthe accounts on the phone and allows you to enable disable a specific account or all accounts 2 Use the UP and DOWN arrow keys to scroll through the accounts DND 1 Screennamel Y Done gt Change DND 2 Screenname2 X lt Done gt Change DND 5 All On Done DND 3 Scree
200. trator Guide is intended for the System Administrator and can be downloaded from http www aastra com Phone Features e 3 line LCD screen 8 programmable top keys Press and hold speed dial key configuration feature Supports up to 6 call lines with LEDs Full duplex speakerphone for handsfree calls e Headset mode support via handset jack e AC power adapter included e Enhanced busy lamp fields Set paging Availability of feature dependant on your phone system or service provider 41 001376 00 Rev 01 06 2013 1 Welcome Requirements The 6730i IP Phone requires the following environment SIP based IP PBX system or network installed and running with a SIP account created for the 6730i IP phone Access to a Trivial File Transfer Protocol TFTP File Transfer Protocol FTP Hypertext Transfer Protocol HTTP server or HyperText Transfer Protocol over Secure Sockets Layer SSL HTTPS Ethernet Fast Ethernet LAN 10 100 Mbps Gigabit Ethernet LAN 1000 Mbps recommended Category 5 5e straight through cabling category 6 straight through cabling required for optimum Gigabit Ethernet performance Power source Installation and Setup If your System Administrator has not already setup your 6730i phone please refer to the Aastra 6730i Installation Guide for basic installation and physical setup of the 6730i For more advanced administration and configuration information System Administrators should re
201. ur list 3 Press any key on the dial pad to begin editing 4 To move the cursor one digit to the right press p gt To erase one digit to the left of the cursor press dl 5 To dial the displayed number press cC or just lift the handset or press any line keys Deleting Entries From the Callers List You can delete individual items from the Callers List or you can delete allitems in the Callers List lt IP Phone UI Use the following procedure to delete an individual item from the Callers List Press the Callers List Key E mi 2 Press Y and to find the item you want to delete 3 Press the Delete Key 4 Press the Delete Key again at the prompt to erase the item Q IP Phone UI Use the following procedure to delete all items from the Callers List 1 Press the Callers List Key E 2 Press the Delete Key 3 Press the Delete Key again at the prompt to erase all items 118 41 001376 00 Rev 01 06 2013 Managing Calls Downloading the Callers List to Your PC You can download the Callers List to your PC for viewing using the Aastra Web UI When you download the Callers List the phone stores the callerlist csv file to your computer in comma separated value CSV format You can use any spreadsheet application to open the file for viewing The following is an example of a Callers List in a spreadsheet application This file displays the name phone number and the line that the call came in on
202. ur phone if you have been asked to do so by your System Administrator or should you experience any unexpected behavior Ey IP Phone UI 1 Press the key on the phone to enter the Options List 2 Select Restart Phone 3 Press to confirm the restart of the phone If you do not wish to restart your phone press the lt q key to cancel Note Your phone is out of service temporarily during the restart and downloading process La Aastra Web UI 1 Click on Operation gt Reset Reset Phone Restart Phone 2 Click Restart 3 Click OK at the confirmation prompt Phone Lock You can lock your phone to prevent the phone from being used or configured You can lock the phone using any of the fol lowing e At the path Options gt Phone Lock on the IP Phone UI At the path Operations gt Phone Lock on the Aastra Web UI Ata configured key on the phone For more information about configuring a Lock Unlock key on your phone see Phone Lock Key on page 87 In the Aastra Web UI the Operation gt Phone Lock path also allows you to perform the following Reset a user password Clicking on the Reset key in the Reset User Password field displays a screen that allows you to enter and save a new user password Setan emergency dial plan An emergency dial plan can be 911 999 112 110 or all of the above The default emer gency dial plan is 911 999 112 110 The following procedure
203. ut Language 3 Phone Status 1 IP amp MAC Addresses 2 LAN Port 3 PC Port 4 Firmware Info 5 Error Messages 6 Copyright 4 Password 5 Administrator Menu Password Protected 6 Restart Phone 7 Phone Lock 41 001376 00 Rev 01 06 2013 11 Methods for Customizing Your Phone Note The Administrator Menu options are Administrator level functions only and are not accessible by the user These options should only be set up and changed by your System Administrator Simplified Options Menu Your System Administrator may configure a simplified options menu for your phone The following table indicates the options that may appear on your phone if the simplified options menu is applied OptionNumber Option 1 Call Forward 1 All 2 Busy 3 No Ans 4 All Off 5 All On The menus that display for Call Forward are dependent on the Call Forward Mode set on the phone Default is Account mode 2 Preferences 1 Tones Ring Tone Tone Set 2 Contrast Level 3 Set Audio Audio Mode Headset Mic Vol 3 Phone Status IP amp MAC Addresses LAN Port PC Port Firmware Info Error Messages Restart Phone Factory Default Erase Local Cfg Copyright WANA UBWHN 4 Phone Lock Using the IP Phone UI lt IP Phone UI 1 Press the Options key on the phone to enter the Options List 2 Press Enter the gt key or press the digit number of the c
204. y 1 through Key 8 Keys 5 and 6 can be made configurable only by your system administrator Inthe Type field select Directed Call Pickup In the Value field specify the extension you want to intercept when you press this key For example 2200 Inthe Line field select the line for which to apply the Directed Call Pickup configuration Valid values are 1 through6 a wu Bb WUN Click Save Settings 41 001376 00 Rev 01 06 2013 65 Line Keys and Programmable Keys Configuring Group Call Pickup GCP Key Use the following procedure to configure Group Call Pickup using the Aastra Web UI La Aastra Web UI Note A ring group must be configured on the server in order for a GCP key to function 1 Click on Operation gt Programmable Keys Programmable Keys Configuration Key 1 on w N o N O Type Value Line Directed Call Pickup groupcalipickup ID Pickup v 2 Line u M la Paging v JE Speeddial x 9051234567 1 XML a http 10 70 3 7xml menu menu php source all a uu bb YU N Click Save Settings Inthe Type field select Directed Call Pickup In the Value field enter groupcallpickup Select a key for which to configure Group Call Pickup Using Directed Call Pickup Group Call Pickup Use the following procedure for the DCP GCP feature on your phone In the Line field select
205. yed party from the call Centralized Conferencing for Sylantro and Broadsoft Servers The 6730i allows you to create multiple conferences with unlimited participants depending on your server limitations when your Administrator enables Centralized Conferencing If your Administrator does not enable Centralized Conferencing then the 6730i uses Local Conferencing by default Your Administrator can configure Centralized Conferencing globally on all lines or on specific lines Although for the glo bal setting to work you must configure the lines with the applicable phone number When you use the Conference key to initiate a centralized conference call the following screen displays 1 a conference 00 21 104 41 001376 00 Rev 01 06 2013 Handling Calls Reference For more information on Centralized Conferencing see Centralized Conferencing on page 157 or contact your System Administrator Using Centralized Conferencing IP Phone UI Note When Centralized Conferencing is enabled on your phone local conferencing or three way conferencing works as indicated in the previous section Using Local Conferencing in Pre Dial Mode Joining two active calls in a conference also works as indicated in the previous section Joining Two Active Calls in a Single Conference Use the following procedure to create a conference call using centralized conferencing Use the following illustration as a re

Download Pdf Manuals

Related Search

Related Contents

Samsung BD-P1000 Manual de Usuario  Fuzzy Similarity of Facial Expressions of Embodied Agents    Scheda Tecnica  Peavey Nitro I User's Manual  `逸皇掘"` 安全に関するご注意  

Copyright © All rights reserved. Failed to retrieve file