Home

Iwill P4GS INTEL 845G Motherboard

1. 2 Onboard Serial ATA Function Enables and disables the onboard Serial ATA controller and sets the data transfer rate Description An 8 pin jumper uses two jumper caps Default Setting Enabled amp 133MB sec More Information See Chapter 3 for information on con figuring this jumper User s Manual Power Installer P4G section Main installation screen User s Manual 2 Key Features amp Components Software Features This motherboard comes with driver software and bundled utility software on the supplied Power Installer CD ROM disc The Installing OS amp Support Software sec tion in Chapter 5 explains how to install the software required to support this motherboard and profiles the bundled utilities Using the Power Installer Disc You can run the Power Installer CD ROM install inter face under Microsoft Windows 9X NT 4 0 2000 or XP The disc s install interface should load automatically and you then click on the model name of this motherboard EE twill Power installer CD E Awil IWILL MOTHERBOARD Can a aiara U P4G i A a in pit had J i oy PA or Wit Auto Installation A j E i i p EE Manual Installation a hr or FE pp a http www twill net P4G Series Motherboard Iwill Driver Software This motherboard requires that you install driver soft ware to support the onboard hardware You will need to install the following e Intel 845G chipset s
2. Description The Serial ATA feature on the motherboard Supports one Serial ATA device via the Serial ATA drive connectors A drive connects to the motherboard with a Serial ATA cable The P4GS motherboard comes with one Serial ATA cable More Information See the section on Connecting In ternal Peripherals in Chapter 5 for instructions on con necting IDE drives Technical specifications are listed in Chapter 7 SHATA User s Manual ATX Power Connectors An ATX power supply with two power leads is re quired for this board User s Manual 2 Key Features amp Components Other Internal Connectors There are several other connectors on the motherboard ATX Power Connectors Function Connectors for leads from a system AT X power supply Description There are two power connectors on the motherboard for leads from an ATX power supply The power supply leads plug into the connectors The con nector designs prevent incorrect orientation There are two connectors the standard 20 pin ATX connector and the extra ATX12V 4 pin connector which supplies addi tional 12 volt current More Information Please refer to Chapter 4 Installing the Board in a System Housing Chapter 7 lists technical specifications ATX connector as ATXPWR1 ATX12V connector ATXPWR2 CPU amp System Fan Connectors CFAN1 J SFANI SFAN2 Function Power connectors for CPU and system hous ing cooling fans Descr
3. Completing System Configuration Once the motherboard is installed in the system housing you can proceed to connect or install whatever internal devices you will use to complete the system These will at least include an AGP display card and disk drives and connecting the housing power supply leads After that having replaced the system housing cover you can connect external peripherals to complete the process of preparing the system for use These will include at least a video display and a keyboard and probably a point ing device Please see the next chapter for information on completing these final hardware installation steps and installing Operating System and support software G ATX12V connector P4G Series Motherboard will 4 14 User s Manual User s Manual 5 System Configuration In This Chapter Installing or Connecting Internal Peripherals Installing an AGP Card Connecting Internal Devices Connecting External System Peripherals Configuring the CMOS Setup Utility Installing an OS amp Support Software 5 System Configuration This chapter explains what you need to do to assemble a complete system after you have installed the motherboard in a system housing This will include installing or con necting internal devices connecting external system com ponents Once the system is assembled you ll need to check and possibly configure the motherboard s CMOS Setup Utility install an Operating System
4. Not all drives work prop erly with Cable Select mode If you try to use this mode and the drive does not operate properly set the drive to either master or Slave mode as appro priate for its position on the cable IDE Drive Positioning Normally the system s primary hard disk drive should be in the Primary Master position If you will use only the supplied ribbon cable connect a CD ROM drive to the Primary Slave position If you obtain an additional IDE ribbon cable you can install a second hard disk drive in the Primary Slave po sition and install the CD ROM as the Secondary Master This is a good idea if the CD ROM drive uses a slower data transfer mode than the hard disk drive Follow any instructions that come with the drives to con figure and install them IDE devices generally can be set to one of three operation modes e Master e Slave e Cable Select Many drives come set to the Master setting If you will use the drive in a Slave position you must reconfigure it as either Slave or use the Cable Select setting to allow the drives position on the cable to define the mode Connecting a Floppy Disk Drive This motherboard has one Floppy Drive connector for connecting one or two floppy disk drives Most computer systems use one 3 5 inch 1 44MB floppy disk drive The drive connector is for a standard floppy drive ribbon cable To install a floppy disk drive connect the drive to the end of the cable which is t
5. and press the Enter key A confirmation message will appear Press the Enter key again to confirm Phoenix AwardBIOS CMOS Setup Utility Standard CMOS Features H TWILL Smart Setting Advanced BIOS Features Load Fail Safe Defaults Advanced Chipset Features Load Optimized Defaults Integrated Peripherals Set Supervisor Password Power Management word PoP PCl Configura SAUE to CMOS and EXIT N gt W etup PC Health Status saving Esc Quit ME Select Item Fi Save amp Exit Setup Save Data to CMOS The CMOS Setup Utility will close and the system will reboot The system should then start properly and run normally 6 12 User s Manual User s Manual 7 Technical Specifications In This Chapter Technical Specifications 7 Technical Specifications This chapter lists some technical information about this motherboard series Technical Specifications Processor Single Intel Pentium 4 processor for mPGA478 socket System Bus 100MHz or 133MHz 400MHz or 533Mhz FSB Supports Willamette amp Northwood processors Autodetect CPU type external clock and multiplier CPU external clock 1MHz step adjustment in BIOS CPU Power Follows VRM 9 0 spec VRD design Memory PC1600 200MHz or PC2100 266MHz DDR SDRAM Unbuffered DDR SDRAM 2 DIMMs up to 2GB Chipset North Bridge Intel 845G South Bridge CH4 Super I O Winbond Super I O W83637HF Graphics Onboard AGP display with VGA port AGP 4
6. JPANEL1 alelelel lelelelelo lol Motherboard Layout Key Component CPU1 J ATXPWR2 J ATXPWR1 DDR1 DDR2 AGP PCl1 5 J USB3 Connectors IDE1 IDE2 DE3 DE4 SHATA1 FDD1 J CFAN1 J SFAN1 J SFAN2 COM2 GAME1 J P1 Jl J CDINI J AUXI PANELI U23 FI Panel Connectors J AUDI O1 P2 USB1 J umpers J CMOS J DIMMVOLT1 J USBV1 PSKMVI J2 Rear panel 1 0 ports User s Manual 2 Key Features amp Components Function mPGA478 CPU socket Power connectors for ATX power supply DIMM memory sockets for DDR SDRAM modules AGP connector for 1 5V AGP 4X display card 32 bit PCI expansion slots Onboard internal USB 2 0 port DE drive connectors Promise ATA 133 IDE drive connectors Serial ATA drive connector Floppy disk drive connector CPU cooling fan power connector Housing cooling fan connectors COM2 port bracket connector Game MIDI port bracket connector IR port module connector Optional 6 channel audio port bracket connector CD n CD ROM drive audio in connector AUX auxiliary audio in connector Housing front panel feature connector Smart Card Reader connector Fl Panel audio feature connector Memory Stick Secure Digital card reader connector USB 2 0 ports 5 amp 6 connector Clear CMOS jumper DDR voltage jumper USB Standby voltage PS 2 Standby voltage Serial ATA Control amp Transfer Speed See figure on next page P4G Series Motherboard will Rear I O Panel
7. You can use either PS 2 or USB input devices with this motherboard Connecting PS 2 Devices Connect a PS 2 keyboard and mouse to the Keyboard and Mouse PS 2 ports on the rear I O port panel Don t connect or disconnect a device while the system Is turned on Doing so can damage the board Connecting USB Devices You can use a USB keyboard and mouse with this motherboard They plug into two of the USB ports You must enable this function in the BIOS CMOS Setup Utility as noted on the next page The Operating System you use must support USB to use any USB devices You can plug and unplug USB devices when the system is turned on User s Manual lwill CMOS Setup Utility Integrated Peripherals 5 System Configuration Phoenix AwardBIOS CMOS Setup Utility Integrated Peripherals On Chip Primary PCI IDE IDE Primary Master PIO IDE Primary Slave PIO IDE Primary Master UDMA IDE Primary Slave UDMA On Chip Secondary PCI IDE I Secondary Master PIO Secondary Slave PIO Secondary Master UDMA Secondary Slave UDMA Controller Keyboard Support Mouse Support ACT Audio Init Display First Onboard LAM Device IDE HDD Block Mode POWER ON Function KB Power OM Password Enabled Auto Auto Auto Auto Enabled Auto Auto Auto Auto Enabled Disabled Disabled Auto Onboard AGPF Enabled Enabled BUTTON ONLY 1 Enter TieeiMove Enter Select9 PU PD Value FS Pr
8. Previous Values F6 Fail Safe Defaults F7 Optimized Defaults User s Manual 5 11 P4G Series Motherboard will CMOS Setup Utility Program Sections The CMOS Setup Utility is divided into several subsec tions and some top level commands including the fol lowing sections Standard CMOS Features Advanced BIOS Features Advanced Chipset features Integrated Peripherals Power Management Setup PnP PCI Configurations PC Health Status IWILL Smart Setting The main screen also has these command options e Load Fail Safe Defaults e Load Optimized Defaults e Set Supervisor Password e Set User Password e Save amp Exit Setup e Exit Without Saving Please see the following sections for a brief profile of what each section does information on settings you might want to change and things to leave alone To open one of the program sections highlight the item you want and press the Enter key To change a setting highlight an item and use the Value keys indicated to change the setting Alternatively press the Enter key and all options for that item will display and you can choose from those listed 5 12 User s Manual Iwill 5 System Configuration CMOS Setup Utility Main Screen Phoenix AwardBIOS CHOS Setup Utility Standard CMOS Features H IWILL Smart Setting Advanced BIOS Features Load Fail Safe Defaults Advanced Chipset Features Load Optimized Defaults Integrated Peripherals Set Supervisor Password
9. cates the most important topics in the manual In addi tion there is a list of what you should find in the motherboard package and some pointers on things to do before you configure or install the board Chapter 2 Key Features amp Components Details the motherboard s hardware features and impor tant components and indicates their locations Describes the support software that comes with the board on the Power Installer support CD ROM disc Chapter 3 Motherboard Configuration Lists the motherboard s default configuration and con figuration options Chapter 4 Installing The Motherboard Has information on how to prepare and install the motherboard Includes installing a CPU and system memory and housing installation considerations P4G Series Motherboard will Chapter 5 System Configuration Covers connecting system peripherals to the motherboard initial BIOS configuration using the CMOS Setup utility OS options and software installation Chapter 6 Using The Motherboard Explains system operation features that derive from the motherboard Has information on performance optimi zation and troubleshooting Chapter 7 Technical Information Lists the motherboard s technical specifications Manual Features This User s Manual is intended to be useful and informa tive while also making it easy to quickly find specific information or specifications The manual has icons and notes in the sidebar to note important t
10. 3 5 diskette All deta on DaN the diskete wll be destoyved Drive A Go C Ome B ER wl kiip di vevew twill met P4G Series Motherboard Iwill Power Installer Software Utility Click on the item you want to install and follow the install program instruc tions Making a Linux Support Disk You can boot the system from the Power Installer disc The system will boot from a Linux kernel on the disc and you can use the disk creator that loads to create a Linux support disk You can then use it to install any necessary modules according to your Linux distribution s instruc tions for module installation Installing the Utility Software To Install the utility software bundled on the Power In staller disc click on Software Utility in the Drivers and Utilities screen to open the Software Utility window To install the Adobe Acrobat reader or McAfee Anti Vi rus software packages click on the item you want to install and follow the install program s instructions You can install the Smart Card Reader Utility if you have installed a Smart Card reader The Hardware Monitor Utility gives you access to infor mation detected by the Winbond hardware monitor TWILE MOTHERBOARD Software Utility Adobe Acrobat Reader McAfee Anti Virus SCR Utility Option Hardware Monitor Utility Exit http www 1will net User s Manual Iwill 6 Using The Motherboard In This Chapter Using System Features Front P
11. Memory Controller Hub e South Bridge 82801DB I O Controller Hub ICH4 The chipset provides host bus memory AGP and I O interfaces Winbond Super 0 Both motherboards also use the Winbond W83637HF Super I O controller chip which has the following func tions e Hardware monitor e Memory Stick Secure Digital interface e Smart Card interface Promise ATA 133 DE The P4G Series motherboards also have a Promise Tech nologies PDC20275 ATA 133 controller chip which has the following functions e Provides two additional IDE channels with support for up to four additional IDE devices e Supports devices at transfer speeds up to ATA 133 e Requires ATA 133 IDE ribbon cables one supplied Serial ATA P4GS The P4GS motherboard also has a Marvell 8031 Serial ATA controller chip which has the following functions e Supports Serial ATA interface devices e Provides one onboard connector for one devices e Uses standard Serial ATA cables one supplied P4G Series Motherboard will CPU Socket Function The system CPU installs in this socket Description The mPGA4 78B CPU socket supports all 478 pin Intel Pentium 4 CPUs that use this socket The mother board comes with a retention mechanism mounting frame on the board to attach the heatsink and cooling fan assembly required by the Pentium 4 CPU More Information See the section in Chapter 4 on In stalling CPUs for information supported CPUs and their ins
12. P4G Series Motherboard 6 Channel Audio This combined connector is for either of the optional audio port brackets which provide additional audio connections for a 5 1 speaker system 6 Channel Audio Option Connector J 1 Function Connector for the optional 6 channel audio port bracket Description The 6 channel audio connector supports any of the three optional 6 channel audio port brackets 6CH 6CHG and SuperAudio The port bracket provides addi tional audio connections for a 5 1 speaker system More Information Please see Connecting Internal Pe ripherals section in Chapter 5 and the System Features section in Chapter 6 J1 1 Connector Pees tw Pin Sub Woofer amp Rear Speakers SuperAudio Port Bracket Rear Speakers Center Bass RCA Out RCA In SP DIF Out pmi EPR pegi ujil SP DIFIn h S Ei i ii m Bi oe oF 6CHG Audio Port Bracket GAME Game Rear Speakers port connector Center Bass Pinl JGAME1 Game Port User s Manual Smartcard Reader The connector cable from a Smartcard Reader mod ule plugs into U23 Memory Stick Reader The connector cable from a Memory Stick Reader module plugs into J P2 User s Manual 2 Key Features amp Components Smartcard Reader Connector U23 Function Connector for a Smartcard reader module Description A housing mounted Smartcard reader mod ule plugs into to this connector More Information See
13. Port 2 to Disabled if you aren t going to use the onboard COM2 port CMOS Setup Utility Integrated Peripherals Phoenix AwardBIOS CHOS Setup Utility Integrated Peripherals On Chip Primary PCI IDE Enabled IDE Primary Master PIO Auto IDE Primary Slave PIO Auto Menu Level F IDE Primary Master UDMA Auto IDE Primary Slave UDMA Auto On Chip Secondary PCI IDE Enabled IDE Secondary Master PIO Auto Secondary Slave PIO Auto Secondary Master UDMA Auto Secondary Slave UDMA Auto Controller Enabled Keyboard Support Disabled Mouse Support Disabled ACT Audio Auto Init Display First Onboard AGP Onboard LAM Device Enabled IDE HDD Block Mode Enabled POWER ON Function BUTTON ONLY KB Power OM Password Enter Tle iMove Enter Select 9 PU PDIUValue Fi ave ESClIExit Fi iGeneral Help F7 F5 Previous Values F6 Fail Safe Defaults at imized Defaults User s Manual 5 17 P4G Series Motherboard wit If you install an IR port module you have to set the UART M ode Select line to the appropriate IR setting Check the module instructions for this information The following four lines will display the defaults for the IR mode you select and should work You can alter the parallel port settings as needed You can disable the Game and MIDI settings if you aren t going to use the Game port header The last several items when at the bottom of the list are SCR Port Address a
14. Ports This figure show the ports on the rear I O panel The ports include from top to bottom PS 2 ports Serial Parallel amp VGA ports Three USB ports LAN port Audio ports The ports have standard color coding as follows PS 2 Keyboard Purple PS 2 Mouse Green USB1 USB2 USB3 Serial Port Teal Parallel Port Burgundy VGA Port Blue USB Ports Black LAN jack None Line In jack Light Blue Line Out jack Lime Mic In jack Pink PS 2 Keyboard Mouse Serial COM1 Parallel VGA display LAN RJ 45 Mic Line Out Line In Key Features amp Components This section explains the function and use of key fea tures and components on the motherboard It also indi cates where to look in the manual for additional infor mation on configuring and using them This motherboard uses an ATX form factor PCB in a design that integrates many features onto the board in cluding several external ports 204 User s Manual User s Manual 2 Key Features amp Components Intel 845G Chipset The P4G Series motherboards use a version of the Intel 845 Chipset the 845G a multi function chipset for higher end performance and mainstream systems The chipset includes a high performance onboard display graphics controller The 845G chipset also supports the use of an AGP display card installed in the AGP slot The chipset components include the following devices mounted on the board e North Bridge 82845G
15. Quit TOE Select Item Fi Save amp Exit Setup Load Optimized Defaults Sections marked by an arrow on the main screen list command instructions at the bottom of the screen Phoenix AwardBIOS CMOS Setup Utility Standard CMOS Features Date mmidd yy gt Thu May 16 2002 Time Chhimm ss gt 7 3 47 32 3 Menu Level a IDE Primary Master IDE Primary Slave Change the day month IDE Secondary Master None year and century IDE Secondary Slave None Derive A 1 44M 3 5 in Drive E Mone Video LEGA UG Halt On All But Keyboard Base Memory 648K Extended Memory b5472K Total Memory 1824K Tlee iMove Enter Select 9 PU PDIUalue Fi Save ESC IExit Fi tGeneral Help FS Previous Values F6 Fail Safe Defaults F7 Optimized Defaults User s Manual 3 7 P4G Series Motherboard will Reconfiguring the Motherboard You can change the default configuration as shipped of this motherboard as needed However since this motherboard has only a few hard configuration options and the CMOS Setup Utility is configuration is mostly either required recommended or automatic there will probably be little reason to do so Hardware Reconfiguration We recommend leaving the jumper settings at the default settings unless you need to perform the Clear CMOS pro cedure It is much more convenient to control the BIOS Flash Protection feature using the CMOS Setup Utility If you want to use a sound card Instea
16. and install the support software supplied on the Power Installer sup port CD ROM disc Installing or Connecting Internal Peripherals To complete the assembly of a working system you will need to at least install and connect whatever disk drives you will use in the system This section covers what you need to know on the motherboard side to do this You will also need to con sult the documentation that comes with your internal sys tem peripherals for additional installation instructions and information This section covers the minimum compo nents you will need to connect to the motherboard to create a functioning system You may plan to add other devices as well P4G Series Motherboard will Installing an AGP Card If you do not use the onboard AGP display feature you can install an AGP display card in the AGP slot The AGP slot on the board supports AGP 4X 1 5 volt display cards Follow the instructions that come with the display card for installing the card hardware in the AGP slot AGP Configuration You can configure the amount of system memory the AGP card will use as auxiliary memory by adjusting the AGP Aperture Size setting in the Advanced Chipset Features section of the CMOS Setup Utility The default aperture setting is 64MB the maximum is 256MB Display Drivers You should install the display card s display driver soft ware according to the instructions that come with the card after you have completed system asse
17. create driver floppy disks from the Power Installer We assume here in the absence of an alternative drive controller that any hard disk or optical drives will be IDE devices connected to the motherboard s IDE channels Connecting IDE Devices to the Main DE Connectors This motherboard supports two standard IDE channels Primary and Secondary Two IDE device connectors onboard IDE1 and IDE2 support IDE devices running in any data transfer mode up to ATA 100 Each IDE connec tor supports two drives a Master and a Slave The drives connect to the motherboard with an IDE ribbon cable IDE cables have three connectors on them one that plugs into a drive connector on the board and the other two that connect to IDE devices The connector at the end of the cable is for the Master drive The connector in the middle of the cable is for the Slave drive There are different types of IDE ribbon cable supporting transfer modes up through ATA 33 ATA 66 or ATA 100 You must use a cable that supports the transfer mode of the fastest device connected to it For example if both an ATA 66 mode and an ATA 100 mode device are connected to the same cable the cable must support ATA 100 mode to achieve maximum performance To Install an IDE drive connect the drive to one of the drive connectors on a suitable ribbon cable Plug the board end of the cable into one of the IDE connectors on the motherboard P4G Series Motherboard will Cable Select
18. has a 9 pin connector It can op erate at soeeds up to 115 200bps You can configure the port speed via the computer s Operating System Do not connect or disconnect a serial cable when the system is turned on More Information See the Integrated Peripherals sec tion of Configuring the CMOS Setup Utility in Chapter 5 for information on adjusting port settings COM1 Serial Port VGA Port Function Connecting a display monitor This external display port uses a 15 pin VGA connector The connector is for the onboard display graphics con troller Do not connect or disconnect a display cable when the system is turned on More Information See the Integrated Peripherals sec tion of Configuring the CMOS Setup Utility in Chapter 5 for more information ofo 15 pin VGA Port P4G Series Motherboard will Note You must Install the sup plied USB 2 0 drivers for use with Windows 2000 or Windows XP or the USB ports will only work in USB 1 1 mode Other operating systems are not supported USB Ports There are three USB ports on the rear panel The J USB3 USB port shares a root hub with the third external USB port LAN RJ 45 Jack Right LED Activity Left LED Link USB Ports Function Connecting USB 2 0 devices to the system Description These are Hi Speed USB 2 0 ports for con necting either USB 1 1 or 2 0 devices The ports are for Type A USB cable connectors You can connect or dis conne
19. socket which is located at the corner where the locking arm attaches to the socket Match the Pin 1 positions on the socket and the processor P4G Series Motherboard 3 Carefully insert the Pentium 4 processor in the socket receptacles taking care not to bend any pins Step 3 Gently press the processor Insert the processor into the socket 4 Lower the locking mechanism s retaining lever and secure it in place to secure the processor in the socket Grasp the processor by the edges and gently oull upwards to Insure it is properly inserted The processor shouldn t move Step 4 Press the retaining lever back Secure the retaining lever down into the horizontal position and make sure it latches in place User s Manual Iwill 4 Installing The Motherboard Installing the Heatsink Once you have installed the CPU you must install a Fan Heatsink The Fan Heatsink clips into to the Reten tion Mechanism attached to the board via its integrated retaining clip assembly Apply Thermal Interface Material Before you install the Fan Heatsink you must apply the Thermal Interface Material TIM that is supplied in an applicator with boxed Intel Pentium 4 processors or an exact equivalent to the top of the installed CPU If the Fan Heatsink already has a patch of TIM on Its under side you don t need to apply any additional TIM to the CPU We assume here that you have TIM in an Intel supplied appli
20. the Connecting Internal Periph erals and Configuring the CM OS Setup Utility sections in Chapter 5 U23 U23 Smartcard Reader connector O0O000 OO0000 Memory Stick Secure Digital Reader Connector J P2 Function Connector for a Memory Stick or Secure Digi tal memory card reader module Description A housing mounted reader module plugs into to this connector More Information See the Connecting Internal Periph erals and Configuring the CM OS Setup Utility sections in Chapter 5 J P2 Memory Stick Secure Digital Reader connector JP2 A lt i P4G Series Motherboard will J AUDIO1 Connector The cable from the audio features on the Smart Panel plugs into this con nector Battery amp Housing The battery is a CR2032 Lithium coin cell FI Panel Audio Connector AUDI O1 Function Connector for the audio features on the Smart Panel Description The audio cable from the FI Panel plugs onto to this connector More Information See the Connecting Internal Periph erals and Configuring the CM OS Setup Utility sections in Chapter 5 elelclols J AUDIO connector JAUDIO1 Battery Housing Function Housing for system support battery Description An external lithium coin cell battery pow ers the real time clock and CMOS memory When the computer is not plugged into a wall socket the battery has an estimated life of three years When the computer is plug
21. up the utility s main screen There are two sets of defaults listed Optimized and Fail Safe The Fail Safe Defaults are a minimum configuration set for use by technicians when troubleshooting system problems The Optimized Defaults are what the system normally operates on If a corrupted system configura tion record caused the problem you experienced once you load the Optimized Defaults and reboot the system should function normally The instructions on the next page Illustrate this procedure User s Manual Iwill 6 Using The Motherboard You can easily restore a working system configuration record from the main screen of the CMOS Setup Utility To do so do as follows 1 Select the Load Optimized Defaults item 2 Press the Enter Key A confirmation message will ap pear on the screen Type a Y to accept loading the Op timized Default settings Now make any other settings you need to Phoenix AwardBIOS CMOS Setup Utility Standard CMOS Features H TWILL Smart Setting Advanced BIOS Features Load Fail Safe Defaults Advanced Chipset Features Load Optimized Defaults Integrated Peripherals Set Supervisor Password Power Management word PnP PCI Configural Load Optimized Defaults Y N gt H jetup PO Health Status aving Esc Quit Tire z Select Item Fi Save amp Exit Setup Load Optimized Defaults User s Manual 6 11 P4G Series Motherboard will 3 Select Save amp Exit Setup
22. 05 P4G Series Motherboard will Important Note On the P4GS connecting an S ATA drive disables the ATA 133 controller s DE3 Master channel The DE4 Slave channel is still en abled in this configura tion Performance Optimization This section covers things you can do to increase the performance of a system based on this motherboard The topics covered include system memory disk subsystems and processor upgrades or adjustments System Memory Adding system memory will increase system performance and capability under any of the supported Operating Sys tem This motherboard supports a total of 2GB of unbuf fered DDR DRAM system memory If you have not in stalled the maximum you can consider increasing the amount of installed system memory Additional system memory speeds up system operation and in some cases produces additional stability in the Operating System Disk Subsystems The main IDE controller on this motherboard supports IDE drives using data transfer modes up through ATA 100 If you use IDE drives as the primary disk subsystem selecting drives that support ATA 100 and have a high rotation speed at least 7 200rom will maximize perfor mance If you need even better performance from a disk sub system you can consider using the ATA 133 controller or the Serial ATA controller on the P4GS Both of these and particularly the Serial ATA controller will provide a sub stantial performance enhancement over
23. 2 Key Features amp Components This chapter explains the location and function of this motherboard s key features and components In addition it details the software that comes on the Power Installer support CD ROM disc Please review this chapter if you are installing the motherboard It is also useful for refer ence regarding feature functions after the board is in stalled in a working system P4G Series Motherboard will Rear I O Panel Ports Motherboard Layout The diagram and key on these two pages shows the loca tion of key components on the motherboard Beee JAUDION O JAUX1 Qm JPSKMV1 ATXPWR1 CPU1 mPGA478B OOO JCFAN1 JUSB1 Pelee CE 10 E O PCI1 JCDIN1 PCI2 PCI3 J1 ee AAUNARENENI alelelolelollo PC14 PCI5 v yy ep m O JSFAN1 2 coco IDE4 ooo IDES JUSB3 JUSBV1 elelele JDIMMVOLT1 O ATXPWR2 JCMOS1 JCOM2 U23 oOo OIO oo oo OIO OECIOIOIO 0 0 0 ie a Eel U log JGAME1 FDD E J IDE1 2 T allel J2
24. DE devices 5 14 User s Manual 5 System Configuration Advanced BIOS Features Main Section Functions This section mainly configures boot options including boot devices and their boot order and some power func tions There are also some miscellaneous boot configura tion settings Default amp Autodetected Settings The screen illustration shows the default settings These do not need to be changed You can customize the set tings to suit your purposes if necessary and you know what you re doing Setting Options amp Constraints You can change the boot device assignments and order the boot options and the power on settings as you like If you are using OS 2 set the OS Select For DRAM gt 64MB line to the OS2 setting CMOS Setup Utility Advanced BIOS Features Phoenix AwardBIOS CHOS Setup Utility Advanced BIOS Features Virus Warning CPU Li amp L2 Cache Quick Power On Self Test First Boot Device Second Boot Device Third Boot Device Boot Other Device Swap Floppy Drive Boot Up Floppy Seek Disabled Enabled Enabled Floppy CHDD 6 Onbrd Dev Enabled Menu Level b Allows you to choose the WIRUS warning Feature for IDE Hard Disabled Enabled Boot Up NumLock Status On Gate AZH Option Fast Typematic Rate Setting Disabled Disk boot sector protection If this function is enabled and someone attempt to write data into this area BIOS will show a warning messag
25. IWILL P4G Series Motherboard User s Manual P4G Series Version 1 0 FB23624000 P4G Series Motherboard will II User s Manual will P4G Series Motherboard Federal Communications Commission FCC Statement This equipment has been tested and found to comply with the limits for a Class B digital device pursuant to Part 15 of the FCC Rules These limits are designed to provide reason able protection against harmful interference in a residential installation This equipment generates uses and can radiate radio frequency energy and if not installed and used in accordance with the instructions may cause harmful interference to radio communica tions However there is no guarantee that interference will not occur in a particular installation If this equipment does cause harmful interference to radio or television re ception which can be determined by turning the equipment off and on the user is encour aged to try to correct the interference by one or more of the following measures e Reorient or relocate the receiving antenna e Increase the separation between the equipment and the receiver e Connect the equipment onto an outlet on a circuit different from that to which the receiver 1S connected e Consult the dealer or an experienced radio TV technician for help Shielded interconnect cables and shielded AC power cable must be employed with this equipment to insure compliance with the pertinent RF emission limits governing this
26. JAUX1 oe Eile ae AUX audio in connector QO O JCDIN1 CD In audio in connector User s Manual Other USB Ports Connecting a port bracket to J USB1 provides two ad ditional USB ports J USB3 is a single port for connecting internal de VICeS IR Connector J P1 The IR connector is for both IrDA and ASKIR port modules You must use the CMOS Setup Utility to con figure the board to use the IR feature User s Manual 2 Key Features amp Components Onboard USB Port Connector J USB1 amp Connector J USB3 Function Connector for the additional two USB ports port bracket J USB3 is an onboard internal USB 2 0 port Description Connecting an external 2 port USB port bracket to J USB1 provides two additional Hi Speed USB 2 0 ports that have their own Root Hub J USB3 is a port mounted directly on the board for con necting internal USB 2 0 devices More Information See the Connecting Internal Periph erals section of Chapter 5 J USB1 USB port bracket pin header connector JusB1 els JUSB3 USB3 USB internal port IR Connector J P1 Function Connector for an Infrared IR port module Description The IR connector supports both IrDA and ASKIR infrared port modules Follow the module s in structions to install it More Information Please see the Integrated Peripherals section of Configuring the CMOS Setup Utility in Chap ter 5 for information JP1 IR connector Pl is Pinl fo
27. MPONENTS cccecseceeseeeeeeeeeeeseeeeeeesaess 4 13 Completing System Configuration ccccceeseeeeeeeeeeeseeteseeeestasaetaneneaes 4 13 5 System CONfiQuration anenee EENET 5 1 Installing or Connecting Internal Peripherals ssssccscssessesessesseeseeaes Dl nStLaNno an AGP Cali esnai A EAE 5 2 AGP CONNOUTA CION seremonisi inneir arni naa a EATE E AENEAN 5 2 Say DAVES atastrers ac ntia nie nascenistsate deena E En oe Connecting Internal Devices cccccecessseeeeseeseeeeeeeeteeeeeaeeesaetaeaeeanteens 5 3 Connecting IDE Devices to the Main IDE Connectors ieren ope Connecting a Floppy DISK DriVe ccccesseeseceseueeeeeeeeeeseesseeasenerstasees 5 4 Connecting a Smartcard or MS SD Reader ccccescessseeseeeeseeeeeeeseneees 5 4 Multiple Drive Configurations ccccceeseeeseeeeeeeseeeeeeeeestaseetaseneastanees 5 6 Alternate Drive Controller Boot Device SettingS sureres om Connecting External System Peripherals cscsssssssessecseeeecnesussnsansaeeas 5 8 Connecting a Display Monitor ccccceccecseceeteeeeeeeeeeeeseeeaetesteeeeeaeas 5 8 Connecting a Keyboard amp MOUSC ccccceccecseceeseseeeeeseeeeeeeeeeseeseeneens 5 8 Configuring the CMOS Setup Utility c cccsssssscesceeeeeeeessesausausaneaneans 5 10 The CMOS Setup Utility User Interface ccccececseceeeeeesseseeseeeeeeees 5 10 Running the CMOS Setup Utility cccesscssesecseseeeeeeeesseeaeeeeaseesaes 5 10 CMOS Setup Utility Program
28. OS CMOS Setup Utility Standard CMOS Features H TWILL Smart Setting Advanced BIOS Features Load Fail Safe Defaults Advanced Chipset Features Load Optimized Defaults Integrated Peripherals Set Supervisor Password Power Management word PnP PCI Configural Load Optimized Defaults Y N gt H tup FC Health Status aving Esc Quit MRE Select Item Fi Save amp Exit Setup Load Optimized Defaults Phoenix AwardBIOS CMOS Setup Utility Standard CMOS Features H TWILL Smart Setting Advanced BIOS Features Load Fail Safe Defaults Advanced Chipset Features Load Optimized Defaults Integrated Peripherals Set Supervisor Password Power Management word PoP PCl Configura etup PO Health Status saving Esc Quit T 3 z Select Item Fi Save amp Exit Setup Save Data to CMOS User s Manual 303 P4G Series Motherboard will Hardware Configuration J umpers J DIMMVOLTL J umper J DIMMVOLT1 DDR Memory Voltage This jumper sets the operating voltage supplied to DDR POR VOirage DIMMs installed in the board s DIMM sockets The de Default 2 5V fault setting is the normal voltage The alternate voltage Pin 7 Pinl settings are for use in overclocking If you are not RRRA overclocking the system you don t need to change this JDIMMVOLT1 jumper setting Pin8 Pin 2 J DIMMVOLT1 DDR Memory Voltage Setting Function Open 2 5 Volt Default Short 1 2 2 6 Volt Short 3 4 2 7 Volt Short 5 6 2 8 Volt Short 7 8 2 9 V
29. OS Setup Utility Advanced Chipset Features DRAM Timing Selectable By SPD i 3 CAS Latency Time Active to Precharge Delay 7 Menu Level a DRAM RASH to CASH Delay 3 DRAM RASH Precharge 3 Turbo Mode Disabled Command Pre Clock Auto Memory Frequency For Auto System BIOS Cacheable Enabled Video BIOS Cacheable Disabled Memory Hole At 15M 16M Disabled Delayed Transaction Enabled Delay Prior to Thermal 16 Min AGP Aperture Size ME 64 On Chip UGA Enabled On Chip Frame Buffer Size BME Tle iMove Enter Select PU PDIUalue Fi Save ESClIExit Fi tGeneral Help FS Previous Walues F6 Fail Safe Defaults F7 Optimized Defaults 5 16 User s Manual Iwill 5 System Configuration Integrated Peripherals Main Section Functions Configures the peripheral features integrated onto the motherboard Default amp Autodetected Settings Everything on this screen is an optimized default The IDE transfer mode settings are autodetected The system will work with these defaults The port settings are stan dard PC settings Setting Options amp Constraints You can disable onboard devices and change port set tings If you re going to use a USB keyboard or mouse you have to enable support for them from this screen You can disable the onboard audio and LAN features if you need to TheIDE HDD Block Mode feature should work with newer IDE hard disk drives You may want to set Onboard Serial
30. Power Management Setup Set User Password PoP PCI Configurations Save amp Exit Setup PC Health Status Exit Without Saving Quit IE z Select Item Save amp Exit Setup Esc Fifa Time Date Hard Disk Type User s Manual 5 13 P4G Series Motherboard will Standard CMOS Features Main Section Functions This section has the real time clock settings the IDE and floppy device settings Default amp Autodetected Settings The IDE device settings are autodetected You shouldn t need to change them The floppy and other settings are standard defaults Setting Options amp Constraints You can reset the time and date settings if they are not correct for your location You can manually set the IDE device settings if you need to CMOS Setup Utility Standard CMOS Features Phoenix AwardBIOS CHOS Setup Utility Standard CMOS Features Date lt mmidd yy gt Wed Jun 19 2002 B23 ae Time thh imm ss gt Menu Level H IDE Primary Master IDE Primary lave Change the day month IDE Secondary Master None year and century IDE Secondary Slave None Drive 1 44M 3 5 in l Drive E Mone Video LEGA UGA Halt On All But Keyboard Base Memory 648K Extended Memory 65472K Total Memory 1824K Tlee iMove Enter Select 9 PU PDIUalue Fi Save ESC IExit Fi tGeneral Help F7 O FS Previous Walues F6 Fail Safe Defaults at imized Defaults In operation the screen will display the detected
31. SECTIONS cccecseseeeseeeeeeeeeeseseeeeeeeeeees d2 Standard CMOS Features s s ssssrsrsrrsrrnrrsrnrrsrrrnrrsrtrnrrerererrerre 5 14 Advanced BIOS Features ccccccecessesseeseeeeeeeeseeeeeeeeeeeseeeeeetaeeees Duo Advanced Chipset Features cccccsscessseteseeeseeeeteeteeteeteetessesaeeas 5 16 Integrated PeriOherals cccsceccessecsesseeeeeeeeeeeeaeeeeaeeeseetaeeeeaseesans 5 17 Power Management Setup ccceccecceceeeeeeeeeeseeeeseeeeeeseeeeeeeeeeeenes 5 19 PNP PCI CONfIGUratiONS cccceceeseeeeeeeeeeeseeeseeeeetaeeeeaseaseeeantesens 5 20 PC Ped EM Oba Cll a E O EEE 5 21 WILL Smart Setting ccccccecssssecseeeeeeeueeeeseeeeeeaueaeeeastasaetanreeags 5 22 Load Fail Safe DefaultS sssnssssrsrnrrsrerrrrsrrrrerrrrrrsrerrrrsrerrrrers 5 23 User s Manual VII P4G Series Motherboard will Load Optimized DET AUIES ctiniareornenmcnnmcnmrtenntinceeicinncumennbmiiriontmt ants 9 23 Set Supervisor User Password secceceseeeeeeeeeeeeseeeereeeaetaeteeeessess 5 24 SWE EXIT SOUU ainan ranei ER A REEE EEEE ENE AEE 5 24 EXIE WICROUE SIMIN O errnet eE aai 5 24 Installing an OS amp Support Software s sssssssssnsnsusnnnnnnnnnnnnnnnnnnnnnnnnnnn 5 26 Installing an Operating System cccecesseseteeeeeeeeeseeeeeeneeetestetaeenens 5 26 Installing the Support Software s sssssserersrsrsrerererrrrrrrrrrrrrrrrrrrreren 5 26 Installing Windows Drivers c cecssceseeeceeeeceeeueaeeeteeeeees
32. X PCI Slots Five 32 bit PCl 33MHz slots PC 2 1 2 2 Compliant Serial ATA P4GS Only Controller Marvell One onboard SATA connector ATA 133 Controller Promise PDC20275 ATA 133 Two IDE connectors P4G Series Motherboard will Memory Stick Secure Digital Smart Card Readers For either individual units or MS SD for optional FI Panel Memory Stick Reader connector Secure Digital Reader connector Smart Card Reader connector USB 2 0 3 USB 2 0 external ports on rear I O panel 2 USB 2 0 port pin header for external connector or optional FI Panel 1 USB 2 0 onboard connector for internal USB 2 0 device Audio AC 97 Codec 5 1 Channel speaker system support Line n Line Out Mic jacks on rear I O panel Supports Mic Line Out for front panel or optional FI Panel Rear Out and Center Subwoofer Out jacks on rear 1 0 panel 4 pin CD ROM audio in connector 4 pin AUX audio in connector General 1 0 2 IDE connector Enhanced Bus Master to support ATA 33 ATA 66 ATA 100 IDE drives and ATAPI compliant devices 1 Floppy Controller for up to two drives 1 COM2 UART connector 1 25 pin ECP EPP Parallel Port 1 PS 2 Keyboard port 1 PS 2 Mouse port BIOS Award BIOS 4Mb Flash ROM Flash write protection for BIOS Write Protection for memory SPD EEPROMs Supports ACPI S1 S3 Auto configuration of IDE hard disk type Multiple boot options Power Supply ATX ATX12V 7 2 User s Manual User s Manual 7 Technical Sp
33. al peripherals and that the peripherals are properly connected to the motherboard Check the M aster Slave positions on all IDE cables If you in Stalled a device that uses ATA 100 mode make sure it is connected to the motherboard with an ATA 100 cable to ensure maximum performance e Check that all expansion cards are correctly installed and fully inserted in the expansion slots Pay par ticular attention to the AGP display card if one is installed e Make sure the processor and its fan heatsink cool ing assembly are properly installed e Check all the hardware settings on the motherboard and make sure they are correct When you re done reassemble the system and try again If the problem persists after you have checked all of the above there may be a hardware conflict or bug See the next section for additional information Hardware Configuration Problems It is possible for system hardware components to conflict with each other While all the components and subsystems on the motherboard are designed and tested to work to gether expansion cards and peripheral devices can be a problem Assuming you have gone through the general trouble shooting procedures and the system still will not start if you have just added new hardware to your system there may be a hardware conflict or bug or a problem with a device driver Try removing the new hardware and see if the system will start If it does consult with the device manufact
34. anel Controls amp Indicators Additional System Features Installing amp Configuring An IR Port Performance Optimization Troubleshooting 6 Using the Motherboard This chapter covers several topics related to using this motherboard once it is installed in a working system These include external system features that connect to the motherboard things you can do to optimize the per formance of a system based on this board and some troubleshooting tips you can review in the event any prob lems arise Using System Features This section explains the system controls and indicators that connect to the motherboard It also explains how the other system level features on the board work Front Panel System Controls amp Indicators The front panel of the system housing will have some or all of the front panel features that connect to the motherboard These enable the User to determine some information on the systems operational status and pro vide some system controls System Controls The front panel connector on the motherboard supports several system controls that mount on the front panel of the system housing User s Manual 6 1 P4G Series Motherboard will Power Button Function Turns the system On and Off Use This button is configured by the CMOS Setup Utility by the Soft Off Mode by PWR BTTN line in the Power Management section Depending on the setting the power button will function in one of two modes ins
35. ary slightly and prevent incorrect in sertion User s Manual 4 Installing The Motherboard Installing Memory Modules Installing DIMM modules is simple The modules insert in the sockets and are held in place by the socket retain ing arms The edge connectors on the modules are of different widths and there are key notches in each mod ule These ensure that you can not insert a module incor rectly Before you install any modules you should choose a configuration You should then prepare the required num ber and type of DDR modules To install either type of module follow this procedure 1 Align the module to the socket so that the edge connectors on the module match the socket sections 2 Hold the module perpendicular to the motherboard and press the edge connector into the socket 3 Press the module fully into the socket so that the socket retaining arms swing up and engage the re tention notches at each end of the module Following the configuration you have chosen repeat this procedure if necessary so that all modules are installed Once the modules are installed system memory installa tion is complete Module retaining notches Socket retaining arms P4G Series Motherboard will Module Installation All modules insert in the DIMM sockets in the same way 1 Align the module to the socket 2 The socket retaining arms should rotate up and engage the module s re taining notches as you pr
36. at should correspond to EE mounting standoffs on the ie system housing s mother i E 1 Cl lo board mounting plate JGAME diss IIL IE ENE ATXPWR2 od TE FE FDD1 al lololo JAUDION1 AGP DDR1 DDR2 i pce O Juse EEE avout JCDIN1 Q l J1 PITTI i JCMOS1 o TooToo PC14 IDE1 2 ATAATA AATNI TTT SHATA1 ee O fl 2 s0000000000000000000 IDE4 JSFAN1 2 0 JPANEL1 860 S60 scoocccccc0c000000000 IDE3 SIO IeT SISIFT Ie Mounting holes 5 Attach the board to the housing by inserting mount ing screws in all the holes and tightening them snugly 4 12 User s Manual Front Panel Connector Leads from the front panel features connect to this header ATX Power Connectors The main power connec tor from the system power supply plugs into the 20 pin J ATXPWR2 connector on the board The ATX12V power lead plugs into the ATXPWR1 4 pin connector User s Manual 4 Installing The Motherboard Connecting Front Panel Components After the motherboard is installed in the system housing you should connect whatever front panel components the housing has to the Front Panel feature connector on the motherboard The figure below indicates the pin assignments of the connector for your reference JPANEL 1 Plelcelelesleeile Front Panel feature connector pin assignments Reset IDELED ACPI Power On Lo e Speaker System LED
37. aults Features Load Optimized Defaults Integrated Peripherals Set Supervisor Password Power Management word PnP PCI Configural Load Optimized Defaults Y N gt H tup PC Health Status Esc Quit Fi Save amp Exit aving Tie Select Item etup Load Optimized Defaults User s Manual P4G Series Motherboard will Set Supervisor User Password These two items set passwords for system access Setting a Password You can install a Supervisor or User Password The pass word prevents access to the CMOS Setup Utility Super visor or the entire system User To install a password follow these steps 1 Highlight either Set Password item in the main menu and press Enter 2 The password dialog box will appear 3 If you are entering a new password carefully type in the password You cannot use more than eight characters or numbers Passwords are case sensi tive Press Enter after you have typed in the pass word If you are deleting a password that Is already installed just press Enter when the password dialog box appears 4 The system will ask you to confirm the new pass word by asking you to type it in a second time Care fully type the password again and press Enter or just press Enter if you are deleting a password that iS already installed 5 If you have used the correct format the password will be recorded If you decide not to set a password after bringing up the password ent
38. card e AGP 4X 266M Hz data transfer maximum 1064M B second data throughput The slot only supports 1 5V devices Do not use a 3 3V AGP card with this motherboard More Information See the section Connecting amp In stalling Internal Peripherals in Chapter 4 Technical speci fications are listed in Chapter 7 Also see the Advanced Chipset Features section of Configuring the CM OS Setup Utility in Chapter 5 for information on setting the AGP memory aperture size AGP slot is for an AGP 4X card User s Manual PCI Expansion Slots All slots are Bus Master Capable and PCI 2 2 com pliant User s Manual 2 Key Features amp Components PCI Expansion Slots Function The PCI expansion slots are for installing sys tem expansion or add on cards to add additional sys tem hardware Description This motherboard has five Bus Master ca pable PCI expansion slots The slots are 32 bit 33MHz slots and are PCI 2 2 compliant The slots provide a fast high bandwidth pathway between the motherboard and expansion cards More Information See the section Connecting amp In stalling Internal Peripherals in Chapter 4 Technical speci fications are listed in Chapter 7 PCI PCI2 PCI3 PCI4 PCI5 PCI slots are numbered on the board P4G Series Motherboard will IDE Drive Connectors The channels are labeled on the board Drive Connectors There are three drive con
39. cator To apply TIM to the CPU do as fol lows 1 Apply all of the TIM in the applicator to the center of the CPU s top plate Step 1 Apply TIM if needed 2 Do not spread the TIM around When you place the Heatsink on top of the CPU the material will dis perse evenly Align and place on top of the CPU User s Manual 4 5 P4G Series Motherboard will Step 1 Clip Fan Heatsink assem bly into the Retention Mechanism Step 2 Hold the assembly steady and press one of the re taining clip locking arms into the locked position Next install the processor Fan Heatsink assembly as de tailed below Install the Fan Heatsink To install the processor Fan Heatsink assembly do as follows 1 Place the Fan Heatsink on top of the Pentium 4 CPU so that it s retaining clip frame snaps into the re cesses in the Retaining Mechanism The Fan Heatsink will only fit into the mechanism frame in the correct orientation 2 Hold the Fan Heatsink steady and press one of the clip assembly s locking levers down into the locked position a D i A 7 x User s Manual Iwill 4 Installing The Motherboard 3 Repeat the process for the second clip Keep hold ing the Fan Heatsink steady so that you don t dam age the TIM The locking levers should now hold the heatsink securely in the Retention Mechanism Step 3 Hold the assembly steady and press the other retain ing clip s
40. ct USB cables when the system is turned on More Information See the Integrated Peripherals sec tion of Configuring the CMOS Setup Utility in Chapter 5 for information on adjusting port settings USB ports 1 2 3 LAN Port Function Connecting a CAT 5 LAN cable to the system Description This is an RJ 45 connector for standard Cat 5 LAN cabling with RJ 45 jacks The connector is for the onboard RealTek 8100 LAN controller You can connect or disconnect a LAN cable when the system Is turned on More Information See the System Features section of Chapter 6 for information LED modes LI an RJ 45 LAN jack User s Manual External Audio J acks The onboard audio sup ports stereo speakers au dio input and a micro phone User s Manual 2 Key Features amp Components Audio acks amp Connectors Function Jacks for connecting external audio devices to the onboard audio subsystem Description There are three audio jacks e Line In Audio input connector for an external audio source e Line Out For two stereo speakers or the Front Left and Right speakers in a 5 1 speaker system e Mic Microphone connector for a computer microphone More Information See the Integrated Peripherals sec tion of Configuring the CMOS Setup Utility in Chapter 5 for information on audio settings Line In Light Blue Line Out Lime Mic Pink External audio jacks P4G Series Motherb
41. d Hardware Problems A hardware problem may occur either after you install additional hardware or because some existing hardware has failed or has a disconnected or loose connection This section has some pointers on things you can check before seeking assistance General Hardware Troubleshooting If the motherboard does not operate properly when you first try to use it in the system it is likely that it is either configured incorrectly there are problems with external connections It is also possible the board or some other system component is defective Always check the most obvious possibilities first First check the external components e Make sure the system the monitor and any other external peripherals are plugged in and turned on Confirm that the system and the power LEDs on any external peripherals are on e Check that the monitor keyboard and mouse are properly connected Next check the CMOS Setup Utility e Run the CMOS Setup Utility and load the Optimized Defaults Reset any other custom settings Remem ber to Save amp Exit Setup to restart the computer User s Manual User s Manual 6 Using The Motherboard If there is still a problem check the internal components Turn off and unplug the system before you remove the system housing cover e Press all installed DIMMs into the module sockets to make sure they re fully inserted e Make sure you used the correct cables to connect the intern
42. d of the onboard audio you should Disable the onboard audio You can also Disable the onboard LAN on the P4G if the need arises though you don t need to do this to add another LAN card to the system Firmware Reconfiguration You can initially specify or customize the CMOS Setup Utility settings when you first configure the system as covered in Chapter 5 to meet your requirements Other than doing this there should be no need to reconfigure the CMOS Setup Utility unless the system configuration changes or the configuration record stored in CMOS memory becomes corrupted and unusable which is not common If you need to completely recreate the system configuration record follow the Clear CMOS procedure described in this chapter User s Manual Iwill 4 Installing The Motherboard In This Chapter Pre Installation Preparation Installing CPUs Installing System Memory Installing the Motherboard in a System Housing Motherboard Installation Procedure Completing System Configuration 4 Installing the Motherboard This chapter covers preparing the motherboard for in stallation installing the board in a system housing or chassis and installing or connecting other internal sys tem components There are a number of important topics in this chapter and we strongly urge that you review it before attempt ing to install the motherboard Pre installation Preparation Before you install the motherboard you will need to do t
43. device Changes or modifications not expressly approved by the system s manufacturer could void the user s authority to operate the equipment Declaration of Conformity This device complies with part 15 of the FCC rules Operation is subject to the following conditions e This device may not cause harmful interference and This device must accept any interference received including interference that may cause undesired operation User s Manual IH P4G Series Motherboard will Disclaimer The information in this document is subject to change without notice The manufacturer makes no representations or warranties with respect to the contents hereof and specifically disclaims any implied warranties of merchantability or fitness for any particular purpose Furthermore the manufacturer reserves the right to revise this publication and to make changes from time to time in the content hereof without obligation of the manufacturer to notify any person of such revision or changes Trademark Recognition Microsoft and Windows are registered trademarks of Microsoft Corp Intel and Pentium 4 are registered trademarks of Intel Corporation Other product names used in this manual are the properties of their respective owners and are acknowledged Copyright Portions Intel Corporation This publication including all photographs illustrations and software is protected under international copyright laws with all rights reserved Neither t
44. e disables the ATA 133 controller s DE3 Master channel The DE4 Slave channel is still en abled in this configura tion Multiple Drive Configurations The P4G Series motherboards include additional disk drive subsystems you may want to make use of Both P4G Series boards have a Promise Technologies AT 133 IDE controller and device interfaces The P4GS includes both ATA 133 and a Serial ATA controller with one onboard Serial ATA drive connector These additional controllers allow you to add additional disk drives to the system over and above the four drives supported by the standard onboard IDE controller On the ATA 133 boards you can connect an additional four ATA 133 IDE or slower IDE devices as needed The P4GS also provides a Serial ATA connector to which you can connect one device This means that the boards with ATA 133 support eight IDE devices and the P4GS supports nine devices includ ing a Serial ATA drive If you are going to configure your system with a large number of devices make sure that the wattage of the system power supply is sufficient to support all the devices you want to install ATA 133 amp Serial ATA Drivers Both the ATA 133 and Serial ATA features require drivers to operate The Power Installer support CD ROM disc in cludes Windows drivers for these features Make sure you install the appropriate driver if you will use either of them See the relevant Installation Guide on the Power Installer
45. e on screen and alarm beep x Typematic Rate Chars Sec gt 6 Typematic Delay Hsec 258 Security Option Setup APIC Mode Disabled x MPS Uersion Control For O 1 4 0S Select For DRAM gt 64ME Non 082 Report No FDD For WIN 95 Ho PU PDSUalue FIA Save F6 Fail Safe Defaults TleeiMove Enter elect F5 Previous Values Fi General Help ES C Exit F7 Optimized Defaults Boot Devices The Onbrd Dev item in the First Second and Third Boot Device options sets an alternate drive controller ATA 133 on the P4G or S ATA or ATA 133 on the P4GS as the boot device On the P4GS connecting an S ATA drive disables the ATA 133 controller s DE3 Master channel connector preventing booting from it and setting the S ATA drive as the Onboard Device to boot from User s Manual P4G Series Motherboard will Advanced Chipset Features Main Section Functions Configures the chipset BIOS caching and the AGP Aper ture size Default amp Autodetected Settings Everything on this screen is an optimized default or is autodetected Setting Options amp Constraints We don t suggest changing anything in this section above the Memory Hole AT 15M 16M line You can change the thermal warning timeout and the AGP Aperture if needed The default AGP setting will work You can disable the Onboard VGA display from here and set the size of the frame buffer CMOS Setup Utility Advanced Chipset Features Phoenix AwardBIOS CM
46. e section on Connecting In ternal Peripherals in Chapter 4 for instructions on con necting a floppy disk drive Technical specifications are listed in Chapter 7 FDD1 P4G Series Motherboard Important Note On the P4GS connecting an S ATA drive disables the ATA 133 controller s DE3 Master channel The DE4 Slave channel is still en abled in this configura tion IDE Drive Connectors The channels are labeled on the board IDE Drive Connector The connector is labeled on the board Promise ATA 133 IDE Drive Connectors Function The two IDE connectors marked IDE3 and IDE4 are for connecting ATA 133 IDE drives to the motherboard Description The Promise ATA 133 IDE controller on the motherboard supports IDE devices running in all modes up through ATA 133 There are two ATA 133 IDE drive connectors Each connector supports two drives a Mas ter and a Slave which connect to the motherboard with an ATA 133 ribbon cable The supplied ATA 133 cable supports all IDE transfer modes through ATA 133 More Information See the section on Connecting In ternal Peripherals in Chapter 5 for instructions on con necting IDE drives Technical specifications are listed in Chapter 7 ooocooooo0oo0o000000000000 IDE4 ooooooooooooo0oo0oo0oo0oo0o0o0O0 Serial ATA Drive Connectors P4GS Function The S ATA connector marked SATA is for connecting a Serial ATA drive to the motherboard
47. ease see Chapter 4 Serial ATA installation P4GS Please see Chapter 4 ATA 133 installation Please see Chapter 4 e AGP card installation Please see Chapter 5 e Required BIOS configuration Please see Chapter 5 e Support software installation Please see Chapter 5 P4G Series Motherboard will Packing List The motherboard package includes the following items P4G Series motherboard Rear I O panel shield ATA 66 100 IDE connector cable Connects IDE devices running in any mode up to ATA 100 to one of the onboard IDE connectors ATA 133 IDE connector cable Connects ATA 133 IDE devices to one of the onboard ATA 133 IDE connectors Serial ATA connector cable P4GS only Connects a Serial ATA device to one of the onboard Serial ATA connectors Floppy Disk Drive connector cable Connects floppy disk drives to the onboard floppy disk connector 3 Jumper Caps Extra caps In case original caps are lost Power Installer support CD ROM disc Includes support software drivers and bundled soft ware utilities User s Manual Pre Use Checklist Before you install and use the motherboard please do the following Check Package Contents Please compare the package contents to the Packing List on the previous page and confirm that all items are present and undamaged Missing or Damaged Accessories If anything is missing please contact your vendor Motherboard Damage If the motherboard has been visibly damaged
48. ecifications System Management Winbond hardware monitor Analog Device fan controller for Monitoring Alerting 3 pin CPU Fan header Two 3 pin Chassis Fan headers CPU temperature sensor Voltage monitoring Vcore 1 5V 2 5V 3 3V 5V 12V Battery 5VSTB Form Factor ATX 4 Layer PCB Other Supports AC power failure ACPI 1 1 PC2001 PCI 2 2 APM 1 2 SMBIOS 2 3 BIOS boot Spec 1 01 WfM 2 0 DMI 2 0 Approvals FCC class B CE mark 89 336 ECC EMV and acc To EU Connector Pinouts CPU amp System Fan Headers Pin Assignment 1 Ground 2 12V 3 Sense Front USB Headers Pin Assignment Pin Assignment 1 45V fused 2 5V fused 3 USB Data 4 USB Data 5 USB Data 6 USB Data 7 Ground 8 Ground 9 KEY 10 NA P4G Series Motherboard CD ROM Audio In Header Pin 1 2 3 4 Assignment Left Channel Input Ground Ground Right Channel Input Front Audio Header Pin Assignment Pin Assignment 1 Micin 2 Ground 3 Mic Power 4 Audio Power 5 RI Line Out 6 RT Line Out 7 Reserved 8 Key 9 LFT Line Out 10 LFT Line Out Auxillary Audio Header Pin No Assignment 1 Left channel AUX_IN 2 Ground 3 Ground A Right channel AUX_IN IR Header Pin No Assignment l Voltage 5V 2 Key 3 IR RX 4 GND 5 IR_TX User s Manual
49. eeeeees 3 6 Using the CMOS Setup Utility cecceccecesceseeseeeeeeeeeeeeasenseesaeeaes 3 6 Reconfiguring the Motherboard s sssssssasnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn 3 8 Hardware Reconfiguration ccscesceseeeceeseeeeteeeeeeneteeeeeeeeaetastentersess 3 8 Firmware Reconfiguration c cccecseeeeceeeeeeseeeeeeseeteeeeeeseaeeetaeeeretaseess 3 8 4 Installing the Motherboard cccscccssccccseceesecessesuseesneeesnenss 4 1 Pre installation Preparation cccsccscsscsccecseeseceeseeeeeueseeneanesesussuesesneaees 4 1 NOA CPO eE E AEA 4 2 Processor Selection ccceccesceee eee eeseeeeeeeeee een eeeeeneeneeeeeeeeeeeenetnernes 4 2 VI User s Manual wil P4G Series Motherboard Instana The PIOCCSSON erierienerrieennis oae E ei 4 3 Installing the Heatsink ccccccscsecseseeeeeseeeeeeeeteeeeeaueeeeeteeeeeestaneegs 4 5 Installing System Memory sssssssrersrrrrrrnrrrrrrrrrnrnrnrnrnrrrernrnrrrerererererne 4 8 Memory SPECIFICATIONS ceccecseceeceeeeeeeeteeeesseeeeeaeeneeeeteeeeeteeseseeens 4 8 Memory Configuration Options sssssasesenrsananasasananrorararararanansrernnnn 4 8 Installing Memory MOdUI S cccesseeeseeseeeeseeeeseeseeteseeeestaseetaetnens 4 9 System Memory Recognition cccccesceeceeeeeeeeseeeeeeeeeeesetaeeeeestattess 4 10 Installing the Motherboard in a System HOUSING seeren 4 11 Motherboard Installation Procedure c ccccesseccseeeeeseeseeseeseesaesaes 4 11 Connecting Front Panel CO
50. er sections have more General Help which lists the commands and their functions is available at any time by pressing the F1 key Running the CMOS Setup Utility The CMOS Setup Utility does not require an operating system to run You run the utility by typing the Del or Delete key when the computer is starting to boot up The utility s main screen will then appear User s Manual will 5 System Configuration CMOS Setup Utility Interface commands Phoenix AwardBIOS CHOS Setup Utility standard CMOS Features Advanced BIOS Features Advanced Chipset Features Integrated Peripherals Power Management Setup PoP PCI Configurations PC Health Status Save amp Exit Setup H TWILL Smart Setting Load Fail Safe Defaults Load Optimized Defaults Set Supervisor Password set User Password Save amp Exit Setup Exit Without Saving TL 2 Select Item Time Date Hard Disk Type Phoenix AwardBIOS CHOS Setup Utility Standard CMOS Features Date mmidd yyo Time thhimm ss gt IDE Primary Master IDE Primary lave IDE Secondary Master IDE Secondary Slave Drive A Drive E UWideo Halt On Base Memory Extended Memory Total Memory os a7 S amp S S amp S j i Menu Level H Change the day month None year and century Mone 1 44M 3 5 in Mone LEGA UG All But Keyboard 648K 65472K 1024K tl e Move Enter Select r PU PD Ualue Fi Save E G Exit Fi General Help FS
51. ess it into the socket 3 The retaining arms must engage for the module to be properly installed System Memory Recognition The BIOS will automatically recognize the installed memory and configure the CMOS Setup Utility No other action is required to complete system memory installa tion User s Manual Required Tool e Philips head screw driver Crosshead User s Manual 4 Installing The Motherboard Installing the Motherboard in a System Housing This section explains the basic requirements for install ing this motherboard in a system housing or chassis Since housing designs vary widely you will need to con sult the housing documentation for specific information This motherboard can be installed in any housing that supports the ATX form factor To install the motherboard in a system housing you will need to do the following e Install the rear I O panel shield that comes with the motherboard e Attach the board to the housing e Connect leads from the housing s front panel You can then connect other internal system components as described later in this chapter Motherboard Installation Procedure This section assumes you are installing the board in a suitable housing We also assume you have prepared the board for installation as previously described in this manual If the housing you are using normally stands vertically place the open housing on it s side before you start install
52. evel H CPU Clock Ratio i2 a Onboard PromiseATA Enabled Tle ifove Enter Select 9 PU PDIUValue Fi Save ESC IExit Fi tGeneral Help FS Previous Walues F6 Fail Safe Defaults F7 Optimized Defaults 5 22 User s Manual Iwi Standard CHOS Fe Advanced BIOS Fe Advanced Chipset 5 System Configuration Load Fail Safe Defaults This loads a set of minimum configuration defaults It is used to allow the system to start and then troubleshoot hardware problems You shouldn t need to use this It s mainly for technicians Phoenix AwardBIOS CMOS Setup Utility atures H TWILL Smart Setting atures Load Fail Safe Defaults Features Load Optimized Defaults Integrated Peripherals Set Supervisor Password Power Management word PnP PCI Configural Load Fail Safe Defaults Y N gt H tup PC Health Status Esc Quit Fi Save amp Exit aving Tie z Select Item etup Load Fail Safe Defaults Standard CHOS Fe Advanced BIOS Fe Advanced Chipset Load Optimized Defaults This loads the Optimized Defaults Do this if the configu ration record has been corrupted or mistakenly config ured or after the Clear CMOS procedure has been per formed See Chapter 3 for more information on this pro cedure To load the defaults select this item press the Enter key type a Y and press Enter again Phoenix AwardBIOS CMOS Setup Utility atures H TWILL Smart Setting atures Load Fail Safe Def
53. evious Walues F6 Fail Safe Defaults Fi S Save A ae YT Menu Level H E CG Exit Fi General Help 7 Optimized Defaults Enable USB Keyboard Support if you will use a USB keyboard Enable USB Mouse Support if you will use a USB pointing device User s Manual P4G Series Motherboard will Configuring the CMOS Setup Utility The motherboard Award BIOS includes the CMOS Setup Utility that creates a system configuration record that is stored in CMOS memory on the board and is required by the system to operate properly Most of the configuration settings are either predefined by the BIOS Optimized Default settings which are stored with the BIOS or are automatically detected and config ured without requiring User action There are a few set tings that you may need to change depending on your system configuration This section gives a brief profiles of the several sections of the CMOS Setup Utility and indicates settings you might need to change and those which you should not The CMOS Setup Utility User Interface The CMOS Setup Utility user interface is simple and largely self evident The utility can only be operated from the keyboard and all commands are keyboard commands The utility does not support mouse use The commands are straightforward and those available for the program section you are in are listed at the bottom of the screen The main screen has few commands oth
54. for more information ATA 133 Cabling The P4G Series motherboards come with one ATA 133 cable This type of cable is required for use with the ATA 133 connectors The ATA 133 is similar to the supplied ATA 100 IDE ribbon cable Both support two devices If you will connect more than two ATA 133 devices to the board make sure you purchase an additional ribbon cable that is specifically for ATA 133 Serial ATA Cabling The P4GS motherboard comes with one Serial ATA cable You use it to connect a Serial ATA device to the Serial ATA connector The cable just plugs onto the onboard connector The connector is designed so that it isn t pos sible to plug the cable on the wrong way User s Manual Alternate Controllers Any alternate drive con trollers must be set to En abled in the WILL Smart Setting section of the CMOS Setup Utility in or der to use the boot order feature described here 5 System Configuration Alternate Drive Controller Boot Device Settings You can set an ATA 133 or Serial ATA disk drive as the system s boot device The Onbrd Dev or Onboard De vice listed in Boot Device items in the CM OS Setup Utility s Advanced BIOS Features section sets one of these as the device the system should attempt to boot from If you have the P4G the Onboard Device is the Promise ATA 133 Primary Master On the P4GS if you connect a Serial ATA device the ATA 133 IDE3 Master channel con nector is disabled and t
55. ged in the standby current from the power supply extends the life of the battery More Information See the Standard CM OS Features sec tion of Configuring the CMOS Setup Utility in Chapter 5 to adjust the real time clock settings System support battery User s Manual Front Panel Connector Leads from the front panel features connect to this header User s Manual 2 Key Features amp Components Front Panel Connector J PANEL1 Function Multifunction pin header connector for sys tem housing front panel features Description This connector supports the following front panel features e Reset Switch Reset in diagram e IDE device activity LED IDE LED in diagram e System ACPI Suspend LED ACPI in diagram e System Power Switch Power On in diagram e System Activity LED System LED in diagram e Housing mounted speaker Speaker in diagram More Information See Chapter 4 Installing the Board In A System Housing and Chapter 6 System Features JPANEL 1 cleo elelceel la Front Panel feature connector pin assignments Reset IDELED ACPI Power On Lo Ld Speaker System LED P4G Series Motherboard will PS 2 Ports Do not plug or unplug de vices when the system is turned on Parallel port The default mode is ECP configured as EPP 1 9 DMA 3 1284 compliant External 1 0 Ports There are several external Input Output ports on the rear edge of the motherboard and connect
56. he Drive A position Plug the other end of the cable into the floppy disk drive connec tor on the motherboard Connecting a Smartcard or MS SD Reader This motherboard has connectors for a Smartcard reader U23 and a Memory Stick or Secure Digital memory card reader JP2 You can either connect individual modules to them or you can connect the appropriate cable from the optional FI Panel to J P2 To connect any of these devices follow the instructions that come with them You will need to connect a module cable to the appropriate connector and enable the fea ture in the Integrated Peripherals section of the CMOS Setup Utility The default port settings listed should work User s Manual T h will Onboard IDE Connectors Each channel connector supports one DE channel with two drives a Master and a Slave The Master drive connects to the con nector on the end of the ribbon cable The Slave drive connects to the con nector in the middle of the ribbon cable Note The ribbon cable used must support the transfer mode of the fastest device connected to it to avoid degraded performance The two ATA 133 channels require ATA 133 cables Floppy Drive Connector The floppy drive connec tor supports two floppy disk drives The first drive Drive A connects to the connector on the end of the floppy drive connec tor cable A second drive Drive B would connect to the middle connector on the cable a
57. he Serial ATA device becomes the bootable Onboard Device Phoenix AwardBIOS CHOS Setup Utility Virus Warning CPU Li amp L2 Cache Advanced BIOS Features Enabled Quick Power On Self Test Enabled Menu Level H First Boot Device Floppy ect Your Boot Second Boot Device ice Priority Boot Up Floppy Boot Up HumLock Gate AZH Option Typematic Rate Se Typematic Rate C Typematic Delay Security Option APIC Mode MPS Uersion Contr Of Select For DRA a ee r 4 ae TliMove ENTER Accept ESC Abort Report No FDD For WIN 95 Ho Tle iMove Enter Select 9 PU PDIUValue Fi Save ESClIExit Fi iGeneral Help F7 F5 Previous Values User s Manual F6 Fail Safe Defaults at imized Defaults P4G Series Motherboard will Connecting External System Peripherals To complete the assembly of functioning system you will need at minimum to connect the following external sys tem components to the system housing e Video Display Monitor e Keyboard e Mouse or other Pointing Device Connecting a Display Monitor You can connect any display monitor supported by the AGP display card you installed in the system This may include either a CRT or LCD monitor depending on the card s specifications Connect the display monitor cable to the appropriate dis play connector on the AGP card according to the instruc tions that come with the card and monitor Connecting a Keyboard amp Mouse
58. he following e Install a 478 pin Intel Pentium 4 CPU e Install DDR DIMM system memory modules Both of these require specific procedures that you must follow precisely to insure that the components are suc cessfully installed and work properly Please review the instructions in this section in detail and follow them care fully The procedures are not complex User s Manual 4 1 P4G Series Motherboard will Installing A CPU This motherboard uses the 478 pin Intel Pentium 4 pro cessor To install an Intel Pentium 4 CPU on the motherboard it is very important to precisely and en tirely follow the procedure for installing both the CPU and its cooling assembly Failure to do so can result in either improper operation or damage to the CPU and possibly the motherboard To install an Intel Pentium 4 processor on this motherboard you will need to do the following e Install a Pentium 4 processor in the mPGA478 socket e Install the Heatsink Retention Mechanism Please follow the procedure detailed below to Install the Pentium 4 processor on the board Intel boxed Pentium 4 processors come with full installation instructions If you have these please also read and follow those instruc tions carefully Processor Selection This motherboard supports all 478 pin Pentium 4 pro cessors and the BIOS automatically detects the required settings and configures the CMOS Setup Utility accord ingly Phoenix AwardBIOS CMOS Setup Uti
59. he system housing cover Plug in and turn on the computer 9 Run the CMOS Setup Utility and pen the Integrated Peripherals section Set the UART Mode Select to the required mode IrDA or ASKIR and configure the port settings below it if necessary Save the set tings and reboot OO User s Manual Tr h v l 6 Using The Motherboard CMOS Setup Utility Integrated Peripherals UART Mode Select IR mode selection Phoenix AwardBIOS CHOS Setup Utility Integrated Peripherals Onboard Serial Port 2 2F8 1RQ3 1 Normal UART Mode Select RxD TxD Active LHi Lo Menu Level b IR Transmission Delay Enabled UR2 Duplex Mode Use IR Pins UART Mode Select Onboard Parallel Parallel Port Mod EPP Mode Select ECP Mode Use DMA Mormal PUROM After PWR F Game Port Address Midi Port Address Midi Port IRQ MS75D Port Mode MS SD Port IRQ Tle iMove Enter Select 9 PU PDIUalue Fi Save ESClIExit Fi General Help F7 0 FS Previous Values F6 Fail Safe Defaults at imized Defaults The supported Microsoft Operating Systems should au tomatically detect and configure the port module after you restart the system Consult the OS documentation or online Help for more information if necessary You may also need to install support software that came with the IR port module in order to use it Consult the installation instructions that came with the module for additional instructions User s Manual 6
60. his manual nor any of the material contained herein may be reproduced without the express written consent of the copyright holders August 2002 IV User s Manual Iwill P4G Series Motherboard Contents Ly UP OGUCCION cesar cicneceescusuncnsceuserevaunvsenntes EEEE NEEE 1 1 Manual SUTUN ananira n NEEN E 1 1 Manual FOACUICS siiissiitaanc annem AEA 1 2 If The Motherboard Is Already Installed cccscesssssesseeseeeeeeeeseaeeess 1 2 If You Need To Install This Motherboard cccccceesseeseseeeeeeeeeeseneaeeess 1 2 CEICECAL TOPICS siviivaiieai iter NEE ANNEE EEA 1 3 PACKING LISE aip E S 1 4 Pre USE CHECK NSE nairsisepidu t anran E ENEE 1 4 Hardware ODEON S osionsi ranis eE S 1 5 2 Key Features amp Components sssssssssnsnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn 2 1 Motnerpoard Layout sssini E S 2 2 Key Features amp Components ssssssssnsnsnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn 2 4 MASONI ET srra E i EEE E 2 5 WIKEN SU OC O enra E E madi can at 2 5 ProM E ATS DE meran g E TN 2 5 Soe ea Cs i iE TG ES EAE 2 5 PU SOCK CL saan EA ES E E E E EE 2 6 System Memory SOCK CCS ctincrcidnnneasciancan niki meine etianementttaicaneeaett vas 2 1 TS GP VOU enga aE E E EEA A E 2 8 PE EDAN OS eann E EEEa ENTE EE A E 2 9 DIVE CONDECLOTS ssacecunednsaceanvaamcoqnmneiadassanaidencniae ceuanmenseneretambaeens 2 10 DE DIVE CO CO acerca rctaencancs A E 2 10 FICO DY Disk Dive CONN CCl Olea entcaxesdravsantninentanacentn
61. i Virus This is anti virus software from one of the leading vendors Smart Card Reader Utility Software utility for accessing smart cards inserted in a smart card reader connected to the motherboard e Hardware Monitor Utility Hardware Doctor is a Winbond utility that allows you monitor the system hardware and obtain infor mation about voltage levels internal housing and CPU temperatures and CPU and system memory specifications Power Installer P4G section a ae Utility installation screen AVLE IWILL MOTHERBOARD Software Utility Adobe Acrobat Reader McAfee Anti Virus SCR Utility Option Hardware Monitor Utility Exit http www 1will net User s Manual 2 27 P4G Series Motherboard will 2 28 User s Manual Iwill 3 Motherboard Configuration In This Chapter The Default Configuration Hardware Configuration umper Settings Firmware Configuration The BIOS CMOS Setup Utility Reconfiguring the Motherboard Hardware Reconfiguration Firmware Reconfiguration 3 Motherboard Configuration This chapter details the motherboard s default configu ration and configuration options Please review the con tents of this chapter to find out information on the de fault configuration or alternative configuration options to change the default configuration The motherboard will operate properly in the default configuration Please make certain that any configura tion changes you make will not adversely affec
62. iauanaamecpinincess 2 11 Promise ATA 133 IDE Drive CONNECtOIS cccecceceeseeeseeseetaseneestaeees 2 12 Serial ATA Drive Connectors P4GS ccccccscesseeeeeeseeeeeeeeeseeeeeeaneess 2 12 tner Internal COMM CCT OS a isinacetcnemerentacendaauenaniautndeatnntaiesuneadinciartes 2 13 ATA VOWS CONMECUIONS crancmtreiaateniieidienminiawcinaieemaandeuiakeenes 2 13 CPU amp System Fan Connectors J CFAN1 J SFANI J SFAN2 neas 2 13 CD Iin amp AUX Audio Connectors J ODINI amp J AUXI cens 2 14 Onboard USB Port Connector J USB1 amp Connector J USB3 aeee 2 15 LR CONNOTEA E E E EA 2 15 6 Channel Audio Option Connector J 1 ssssssssssrsrsrererrrererrrrrrerrrer 2 16 Smartcard Reader Connector U23 sssusssrsrrrernrnrnsrerrrrrererrrrsrerers 7d Memory Stick Secure Digital Reader Connector J P2 acere 2 1 7 FI Panel Audio Connector J AUDI OT ou cccccscccccseseeuseseueesaeeneasenees 2 18 User s Manual V P4G Series Motherboard will Battery HOUSING serosa ta rerin ir EEUE TEENA EEEE EEE TAE 2 18 Front Panel Connector J PANELI sssisierrrrririrrrrrririrrrrrrrrr 2 19 External I O POTS isso nn 2 20 P2 PON na a A E EAE 2 20 Parallel POIT cconnnnicaternteianeucecnenpncsinmtatutrtneadunalesuenrnmanvrcuncereanetiions 220 SEIT al COM PON Goienan E E E E 221 VOR 0 i ee ee TEE 2 21 Ua 0 n EEE E ee T E eee E A E ee 2 22 LAN PO oore n EEEE EEEE TE EERE E EEE E 2 22 Audio Jacks amp Connectors sssssssesurnrrrrrrrnrnrnrninrnr
63. ill Installing amp Configuring An IR Port There is a pin header connector for an Infrared commu nications port module on the motherboard An IR port enable wireless communication between the system and another device with IR capability Common examples of such devices are a PDA or notebook computer Installing an IR port module requires disabling the COM2 serial port on the rear I O panel and reconfiguring it for IR use in the CMOS Setup Utility Installing an IR port module requires an expansion slot opening unless the system housing has a built in IR port with a cable to connect to the motherboard Follow the instructions that come that come with the port module you want to install The basic installation proce dure is as follows if the module installs in an expansion slot opening 1 Turn off and unplug the system If necessary 2 Remove the system housing cover 3 Locate the JP1 IR pin header connector on the motherboard 4 Remove the expansion slot cover in the system hous ing that corresponds to an open PCI slot There may be a slot cover retaining screw to remove and put aside for later use 5 Insert the port module in the open expansion slot cover and align the module s mounting bracket with the screw hole for the retaining screw If there is one Insert the screw and tighten it to secure the port module in place 6 Plug the module s connector cable on to the IR con nector on the motherboard 7 Replace t
64. ing the board Please follow this procedure to install this motherboard 1 Review any instructions that came with the system housing and prepare the necessary mounting hard ware that came with it 2 Identify the mounting holes on the board and con firm that the housing has standoffs that match them 3 Install the rear I O panel shield that came with the motherboard in the housing s I O panel opening This should match the ports on the board P4G Series Motherboard will 4 Insert the board in the housing and align the mount ing holes to the standoffs on the housing s motherboard mounting plate Make sure all of the rear I O ports are properly aligned with the open ings in the I O panel shield Mounting Holes ma JPSKMV1 O 3 There are 8 mounting 7 ag R 4 ATXPWR1 a BEE E i holes on the motherboard ag NE T comu th
65. iption There is one CPU cooling fan connector and two system housing cooling fan connectors on the motherboard All the connectors are 3 pin headers Both the CPU and system fan connectors support fan speed monitoring P4G Series Motherboard Cooling Fan Connectors The cooling fan power connectors are 3 pin con nectors Audio In Connectors The J CDI N1 CD In connec tor is for CD ROM or other optical drives Use the J AUX1 AUX connector for an additional drive A temperature monitor detects the CPU and internal sys tem temperatures which are displayed in the PC Health section of the CMOS Setup Utility You can set a system shutdown temperature in that section that will automati cally shut down the computer to protect the CPU if it reaches one of the three temperature options listed More Information Please see the PC Health Status sec tion of Configuring the CMOS Setup Utility in Chapter 5 for information CPU Fan power connector System Fan power connectors CD Iin amp AUX Audio Connectors J CDI N1 amp J AUX1 Function Connectors for audio in cables from internal peripherals Description The two audio in connectors on the motherboard are for audio cables from optical drives such as a CD ROM or DVD ROM drive The connectors pro vide an audio input connection between a device and the integrated audio subsystem More Information Please see the Connecting internal peripherals section in Chapter 5
66. lity IWILL Smart Setting CPU Clock i QQHHz Menu Level H CPU Clock Ratio L 8 Onboard PromiseATA Enabled Tle ifMove Enter Select 9 PU PDIUalue Fi ave ESC IExit Fi tGeneral Help FS Previous Walues F6 Fail Safe Defaults F7 Optimized Defaults 42 User s Manual Step 1 Raise the retaining lever Step 2 Align the Pin 1 corners User s Manual 4 Installing The Motherboard Installing The Processor Installing a Pentium 4 processor in the mPGA478 Socket is the simplest part of the procedure It is very important however to carefully handle the processor by the side edges and always fully observe precautions against elec trostatic discharge We assume here that you are install ing an Intel Pentium 4 boxed processor that comes with a heatsink and Thermal Interface M aterial applicator The illustrations show these If you are installing a non boxed processor the procedure is the same but the accessory items may have a different appearance Please follow the installation procedure as illustrated on the next two pages The illustrations are generic and do not specifically represent this motherboard The processor installation procedure is as follows 1 Raise the locking lever of the processor locking mechanism to a perpendicular position Raise the socket lever to the vertical position 2 Align the processor to the socket by matching the Pin 1 corner of the socket to the Pin 1 corner on the
67. locking arm into the locked position Connect Fan Heatsink Power Lead Plug the fan power lead onto the CPU Fan power connec tor near the CPU socket The entire CPU installation is then complete Step 4 Plug the Fan power lead onto the CPU fan power connector User s Manual 4e7 P4G Series Motherboard will DIMM Sockets System memory sockets are for e PC1600 200MHz e PC2100 266MHz unbuffered DDR SDRAM modules Installing System Memory This section details the procedure for installing system memory on the motherboard Correct memory configu ration is critical for proper system operation Please re view this section carefully and follow the configuration guidelines precisely Memory Specifications The motherboard has two DIMM module sockets and uses unbuffered DDR SDRAM DIMM modules for system memory The system memory specifications are e Unbuffered DDR SDRAM DIMM modules e 200MHz PC1600 or 266M Hz PC2100 DDR SDRAM e Maximum 2GB total system memory Memory Configuration Options This motherboard has flexible memory configuration options These include e Supports 64MB 128MB 256MB amp 512MB modules e Any capacity DIMM may be used in either socket as long as total memory does not exceed 2GB e Modules should be the same speed for best system performance User s Manual Module Installation Modules will only insert in one orientation The width of the two edge connec tor sections v
68. lthough sys tems now commonly only have one floppy disk drive 5 System Configuration Q JPSKMV1 Q 3 _ sqodh 2 f ATXPWR1 JCFAN1 er H iE HE Jcom2 u23 JP1 g on JGAME1 _ i AE A EE i H ENE ATXPWVR2 F E ER FDD1 TEE JAUDION AGP DDR1 R2 Sia eT Q iS a se _O h Pon mmr suse EEE oimuvofi JCDIN1 a jush PCI2 JUSBV1 mma E 4 DEERE EERE EEE EERE EERE EEE Oe Q PCI3 l J1 LL E JCMOS1 plelelolelells PC14 Q IDE1 2 TAIUUULAUIIGTTNITININUINNTEINATINOLANTININATINGTOINALNANTOT Kil E AIA S l PCI5 i oe U r fT rit ity Dolo p m J2 z egeegg2922932992222 IDE4 Q JSFAN1 2 Q JPANEL1 DE1 DE2 Floppy Primary Secondary connecti Channel Channel User s Manual P4G Series Motherboard will Important Note On the P4GS connecting an S ATA driv
69. mbly and have installed an OS and the support software for this motherboard AGP Aperture Setting You can set the AGP aper ture size in the Advanced Chipset Features section of the CMOS Setup Utility Phoenix AwardBIOS CMOS Setup Utility Advanced Chipset Features DRAM Timing Selectable By SPD CAS Latency Time 3 Active to Precharge Delay 7 Menu Level a DRAM RASH to CASH Delay 3 DRAM RASH Prechar Turbo Mode AGP Aperture Size ME Command Pre Clock Memory Frequency System BIOS Cache Video BIOS Cache Memory Hole At 15 Delayed Transacti Delay Prior to Th AGP Aperture Size On Chip UGA On Chip Frame Buf TliMove ENTER Accept ESC Abort Tle iMove Enter Select 9 PU PDIUalue Fi ave ESClIExit Fi tGeneral Help FS Previous Walues F6 Fail Safe Defaults F7 Optimized Defaults 5 2 User s Manual ATA 133 Cables ATA 133 devices require a Specific type of ribbon cable that supports this mode Don t us the sup plied ATA 100 cable to connect IDE devices to one of the ATA 133 con nectors User s Manual 5 System Configuration Connecting Internal Devices To assemble a complete system capable of completing the installation of this motherboard you will need to in stall and connect the following internal devices e Hard Disk Drive e CD ROM or other optical drive e Floppy disk drive The floppy disk drive is not strictly necessary but Is a standard system component and is needed if you will
70. nd MS SD Port Address These en able and configure a Smartcard reader and Memory Stick and Secure Digital memory card reader respectively The default port addresses should work You must set MS SD Port Address to Enabled to use the optional FI Panel CMOS Setup Utility Integrated Peripherals lower section Ti i Move Phoenix AwardBIOS CMOS Setup Utility Onboard Serial Port 2 UART Mode Select RxD TxD Active IR Transmission Delay UR2 Duplex Mode Use IR Pins Onboard Parallel Port Parallel Port Mode EPP Mode Select ECP Mode Use DMA PURON After PWR Fail Game Port Address Midi Port Address Midi Port IRQ SCR Port Address SCR Port IRQ MSSD Port Address MSSD Port Mode MSSD Port IRQ Enter Select FS Previous Walues Integrated Peripherals 2F8 1RGQS LHormal LHi Lol Enabled Half IR Rx2T x2 3768 1 RQ I Menu Level H ere le Disabled Disabled 5 Disabled Disabled MS Socket 5 al PU PDSUalue FIA Save F6 Fail Safe Defaults ESC Exit F7 0 Fi General Help ot imized Defaults User s Manual Iwill 5 System Configuration Power Management Setup Main Section Functions Configures power management settings Most of these are overridden by ACPI power management in Windows Default amp Autodetected Settings Everything on this screen is an optimized default Setting Options amp Constraints You can select the Minimum or Maximum co
71. nectors on the motherboard for connecting IDE and floppy disk drives IDE Drive Connectors Function The two IDE connectors marked Primary and Secondary are for connecting IDE drives to the motherboard Description The IDE controller on the motherboard sup ports IDE devices running in all modes up through ATA 100 There are two IDE drive connectors IDE1 is the Primary channel and IDE2 is the Secondary Each con nector supports two drives a Master and a Slave which connect to the motherboard with a ribbon cable The ribbon cable supplied for these channels supports trans fer modes through ATA 100 More Information See the section on Connecting In ternal Peripherals in Chapter 5 for instructions on con necting IDE drives Technical specifications are listed in Chapter 7 Primary DE1 Secondary DE2 IDE1 2 User s Manual Floppy Drive Connector User s Manual 2 Key Features amp Components Floppy Disk Drive Connector Function The floppy disk drive connector marked Floppy is for connecting one floppy disk drive to the motherboard Description The floppy disk drive connector supports connecting one floppy disk drive to the motherboard The Floppy drive connector uses a standard FDD rib bon cable The floppy disk drive connected to the end of the cable will function as Drive A A second drive can be added as Drive B if required More Information See th
72. nfigurations rather than the User Defined defaults You can customize all settings in User Defined mode If your OS supports power management configure it there The Soft Off by PWR BTTN line controls the function of the system housing power button The default sets it to turn the system on and off when you press the button The alternate setting delay 4 Sec requires you to press the power button for more than four seconds before the system will turn off You can also set a date and time for the system to turn on or wake up using the Resume by Alarm settings CMOS Setup Utility Power Management Setup Phoenix AwardBIOS CHOS Setup Utility Power Management Setup Run UWGABIOS if 53 Resume Auto Power Management User Define Menu Level a Uideo OFF Method U H SYHC Elank Video OFF In Suspend Yes Suspend Type Stop Grant MODEM Use IRQ 31 Suspend Mode Disabled HDD Power Down Disabled Soft OffF by PWR BITN LInstant Off PWRON After PWR Fail OFF Wake Up by PCI card Disabled Power On by Ring Disabled Resume by Alarm Disabled Datetof Month Alarm 4 Timethh imm ss gt Alarm H Reload Global Timer Events Primary IDE Disabled ie Tle iMove Enter Select 9 PU PDSUalue Fi Save ESClIExit Fi iGeneral Help F7 O FS Previous Walues F6 Fail Safe Defaults at imized Defaults User s Manual 5 19 P4G Series Motherboard will PnP PC Configurations Section Function Co
73. nfigures Plug and Play and other PCI bus settings Default amp Autodetected Settings The default is for the BIOS to control these functions Setting Options amp Constraints If you havea problem after you install an expansion card set Reset Configuration Data to Enabled to rewrite the ESCD Don t change the resource settings they re set to be handled automatically by the BIOS While you can set them manually there shouldn t be any need to do so The PCI VGA Palette Snoop item is for PCI display cards that have a problem displaying a screen image properly at startup You should not normally need to use this fea ture since the AGP slot is the primary display CMOS Setup Utility PnP PCI Configurations Phoenix AwardBIOS CMOS Setup Utility PoP PCI Configurations Reset Configuration Data Disabled Resources Controlled Hy Auto ESCI Menu Level F x IRQ Resources Fress Enter Default is Disabled PCI UGA Palette Snoop Disabled Select Enabled to reset Extended System Configuration Data ESCD gt when you exit Setup if you have installed a new add on and the system reconfiguration has caused such a serious conflict that the O cannot boot Tle iMove Enter Select 9 PU PDIUalue Fi Save ESC IExit Fi tGeneral Help FS Previous Walues F6 Fail Safe Defaults F7 Optimized Defaults 5 20 User s Manual lwill 5 System Configuration PC Health Status Section Function Displays detected sys
74. nnel speak ers A connector from a cable for both speakers plugs into this jack Also used for Stereo speakers e Rear For the Rear Left amp Right Channel speakers A miniplug cable for both speakers plugs into this jack e Center Subwoofer For the Center Channel speaker and the Subwoofer A miniplug cable for both speak ers plugs into this jack The 5 1 speaker systems designed for computers usually have an amplifier built into the Subwoofer housing and come with cables to connect these audio jacks to the Subwoofer Additional cables then connect the five speak ers to the subwoofer s amplifier e SP DIF this is a connector for a special optical digi tal audio cable The SP DIF cable carries the entire audio signal out to a sound system that includes an amplifier with a connec tion for this type of cable and a built in decoder to differ entiate the audio signal and divide it into it s various components and send them to the correct speaker in the 5 1 system The P4E motherboards also have an onboard connector for IWILL s optional audio port brackets which can also provide RCA audio connectors for a 5 1 system P4G Series Motherboard will Troubleshooting This section details some things you can do to evaluate problems that could possibly occur in the course of us ing this motherboard The topics covered include pos sible hardware problems and problems with the CMOS Setup Utility s system configuration recor
75. oard J CMOS1 Clear CMOS Default Normal a JCMOS1 J DIMMVOLT1 DDR Voltage Default 2 5V Pin7 Pini JDIMMVOLT1 Ping Pin 2 J USBV1 USB Voltage Default 5V JUSBV1 EEO Pin 1 J PSKMV1 PS 2 Voltage Default 5V Pin 1 kyo JPSKMV1 J2 Default Enabled amp 133MB Sec Pin 2 Pin 8 Pin 1 J2 Pin 7 2 24 J umpers There are five jumper switches on this motherboard Jumpers function like switches to establish a hardware configuration setting J CMOS1 Clear CMOS Function Clears the CMOS Setup Utility configuration record stored in the real time clock s CMOS memory Description A 3 pin jumper Default Setting Normal More Information See Chapter 3 for configuration in formation and the Troubleshooting section in Chapter 6 J DIMMVOLT1 DDR Voltage Function Sets the voltage supplied to the DIMM DDR memory sockets Description An 8 pin jumper Default Setting 2 5V More Information See Chapter 3 for configuration in formation and System Features in Chapter 6 USBV1 USB Standby Voltage Function Sets the voltage status for the USB ports Description A 3 pin jumper Default Setting 5V More Information See Chapter 3 for information on con figuring this jumper J PSKMV1 PS 2 Standby Voltage Function Sets the voltage status for the PS 2 ports Description A 3 pin jumper Default Setting 5V More Information See Chapter 3 for information on con figuring this jumper
76. ocation Turn off and unplug the system Remove the system housing cover see documentation if necessary Set J CMOSI1 to the Clear CMOS position by placing the jumper cap over pins 2 and 3 for one minute Return the jumper cap to the Normal position Replace the system housing cover plug in the sys tem and turn It on 5 Run the CMOS Setup utility and load the Optimized Defaults You can then enter any custom settings you require 6 Save the settings as you exit the program and restart the computer The system should now operate normally ee NO Ae wW J CMOS1 Clear CMOS Memory Setting Short 1 2 Short 2 3 g Function Normal operation Default Clear CMOS memory see instructions User s Manual Iwill 3 Motherboard Configuration BIOS CMOS Setup Utility Main Screen The main screen of the CMOS Setup Utility has a Load Opti mized Defaults item that loads the default operation set tings After you perform the Clear CMOS procedure load the defaults as follows 1 Select Load Optimized Defaults and press the Enter key 2 A message will appear asking you to confirm 3 Type a Y to confirm and press the Enter key again 4 Make other settings you require 5 Select Save amp Exit Setup and press the Enter key The system will restart and use the new settings See the section on Configuring the CMOS Setup Utility in Chapter 5 for information on how to use this program Phoenix AwardBI
77. olt J umper J USBV1 USB Standby Voltage This jumper controls the voltage to the USB ports The J USBV1 USB Voltage default setting is for standard 5V operation The alter Default 5V nate setting configures the USB ports to also operate with a standby voltage of 5V This allows the system to wake JUSBV1 BEI up from an S3 Suspend state in response to activity from Pin 1 any USB port If you anticipate using this Suspend mode you should set this jumper to the alternate setting J USBV1 USB Standby Voltage Setting Function Short 1 2 EO USB Voltage 5 Volt Default Short 2 3 00E USB Standby Voltage 5 Volt 3 4 User s Manual 3 Motherboard Configuration J PSKMV1 PS 2 Voltage Default 5V Pin 1 Gwe JPSKMV1 J umper J PSKMV1 PS 2 Standby Voltage This jumper controls the voltage to the PS 2 keyboard and mouse ports The default setting is for standard 5V operation The alternate setting configures the PS 2 ports to also operate with a standby voltage of 5V This allows the system to wake up from an S3 Suspend state in re sponse to activity from a PS 2 port If you anticipate us ing this Suspend mode you should set this jumper to the alternate setting J PSKMV1 PS 2 Standby Voltage Function Setting Short 1 2 EO Short 2 3 Oxy J2 Serial ATA PS 2 PS 2 Default Enabled 133MB Pin 2 Pin 8 Pin 1 J2 Pin 7 Voltage 5 Volt Default Standby Voltage 5 Volt J umper J 2 Serial ATA Bridge O
78. on Teas ie F a4 i i i y aa bl a ii s ay a U Ea 1 PANT i i User s Manual P4G Series Motherboard Iwill The Driver and Utilities screen will appear when you click on Manual Installation Click on Driver Installa tion and the Driver Installation screen will appear Power Installer Elwnrowrmnate Drivers and Utilities hav Click on Driver Installation Ponu to access the driver install programs Driver Installation User s Manual Software Utility Make Driver Exit http www iwill net EE Driver installation X TWILE MOTHERBOARD Note There is also a Serial ATA item in the P4GS version Driver Installation Intel INF Driver Intel AA Driver Audio Driver Graphic Driver Lan Driver Installation Guide ATA133 Installation suide FI Panel Driver Option Exit http www twill net Driver and Intel IAA Driver in sequence by clicking on them and following the install program instructions Install the audio driver for Windows by clicking on the Audio Driver item to run it and install the driver This item also installs audio software for use with the onboard Realtek audio subsystem 5 28 User s Manual USB 2 0 Support The supplied USB 2 0 driver is for use with Win dows 2000 and Windows XP The driver does not Support other versions of Windows Make Driver Utility You can use this utility to make driver disks for the Onboard Realtek audio s
79. opics indicate warnings or further explain and illustrate key points We suggest that most users review the manual to become familiar with the motherboard Expert users may want to review topics selectively as needed If The Motherboard Is Already Installed You may receive the motherboard installed in a working system If this is the case you should still probably re view the sections on configuring and using the board especially if an Operating System is not installed yet If You Need To Install This Motherboard We recommend that only experienced users and techni cians Install this motherboard If you don t feel confident about installing this product we suggest having a quali fied computer technician install and configure the sys tem This service is usually provided at a reasonable fee by better computer stores and service companies User s Manual User s Manual 1 Introduction Critical Topics Many users do not read through the entire User s M anual While this may not be necessary for experienced users or if the motherboard is already installed there are some topics which are particularly important and deserve your specific attention Some topics cover information critical to the proper installation and use of the motherboard For this motherboard please review the sections on the following topics e CPU installation amp upgrading Please see Chapter 4 e System memory installation amp upgrading Pl
80. ors for more on the board Please refer to the Rear I O Panel Ports illustra tion for the port locations The ports are color coded for easy Identification PS 2 Ports Function Connecting PS 2 devices to the system Description The PS 2 ports are for a system keyboard and mouse or other pointing device Do not connect or disconnect PS 2 devices when the system is turned on More Information See the Advanced Boot Options sec tion of Configuring the CMOS Setup Utility in Chapter 5 for information on adjusting related settings PS 2 Mouse PS 2 Keyboard Parallel Port Function Connecting a device with a parallel interface to the system Description The parallel port is generally used to con nect a printer to the system The port supports common parallel port modes and allows bidirectional communi cation Use an IEEE 1284 compliant cable with the de fault ECP mode configuration More Information See the Integrated Peripherals sec tion of Configuring the CMOS Setup Utility in Chapter 5 for information on adjusting port settings Parallel port User s Manual Serial Ports Default configuration External port is COM1 Onboard port is COM2 Installing an IR port re quires disabling COM2 VGA Port The VGA port is for the onboard display controller User s Manual 2 Key Features amp Components Serial COM Ports Function Connecting Serial devices The external serial port
81. peration This is an 8 pin jumper that controls the Serial ATA fea ture The jumper has two functions It enables the onboard Serial ATA controller and it controls the Serial ATA data transfer rate The default setting is for 133MB second operation The alternate settings are for either 100MB or 150MB transfer rates J2 Serial ATA Bridge Operation Setting 100MB Sec 133MB Sec 150MB Sec Enable Serial ATA Disable Serial ATA Pins 1 2 Pins 3 4 Pins 5 6 Pins 7 8 Short Short Open Open Short Open Short Open Open Open Default Short User s Manual P4G Series Motherboard will Firmware Configuration The CMOS Setup Utility The BIOS CMOS Setup Utility a configuration record of system settings This record is based on the Optimized Defaults that are stored with the utility in Flash memory and can be reloaded at any time Many of these settings are either recommended or re quired for the motherboard to operate properly Other settings are customizable and can be changed to suit your specific system configuration and operation requirements A number of the variable settings such as CPU and IDE device settings are set to be automatically detected in the default configuration While these settings can also be established manually automatic detection is more con venient safe and reliable We strongly recommend that you leave all auto detection settings undisturbed unless you have a specific reason not to and you are ce
82. re turn the complete package to your vendor with proof of purchase User s Manual will 1 Introduction e Prepare Minimum System Components If you are installing the board in anew system you ll need at least the following internal components e Intel Pentium 4 478 pin processor e At least one DDR SDRAM memory module e Desired storage devices hard disk CD ROM etc You will also need whatever external system peripherals you Intend to use which will normally include at least a keyboard a pointing device and a video display monitor Hardware Options The P4G Series of motherboards have some hardware options you can purchase separately e FI Panel A front panel extender that mounts in a 54 inch drive bay in the system housing The FI Panel pro vides Compact Flash card Memory Stick and Se cure Digital card readers as well as additional audio and USB ports 6 Channel Audio Port Brackets All models Two types of audio port bracket are available to pro vide additional connectors for the onboard 5 1 au dio subsystem P4G Series Models Serial ATA ATA 133 FI Panel PAG X Optional P4GS Optional e has feature x does not have feature User s Manual 1 5 P4G Series Motherboard will 16 User s Manual User s Manual 2 Key Features amp Components Chapter Topics Hardware Features Motherboard Layout Key Features amp Components Software Features Driver Software Utility Software
83. rrrrrrerrrererrrereree 2 23 TUNDE eeraa EE eatoheaar EE EE EE A E 2 24 T MOST GE CMO Saeron E E 2 24 J DIMMVOLT1 DDR Voltage cccescescesceeeseeceeeeseeeteeteseeeeeeeteetesss 2 24 J USBV1 USB Standby Voltage ccccesceesecseeeeeeeeeeeeseeeeeeeeeaeenes 2 24 J PSKMV1 PS 2 Standby Voltage cccccscesseesseeeeeeeseeseeeeeeeeseeaeeess 2 24 J 2 Onboard Serial ATA ccccccccuseccusceceeuscseuseeauecsaeeveeseueerauessaseueess 2 24 Software FOQEUICS sronieiciuseriatneninninenieaisigertesetenenennmnsereensusueavesiwanan 2 25 Using the Power Installer DISC ccccscesseeeseeeeeeeeeeeeteeeeteseeeasteen eens 225 VET SOT e iantcrints cine E E E A R 2 26 CNTY SOR WA errie EE E E E TE Aal 3 Motherboard Configuration cccscscsscsccscsessecuesecueeeensseensseens 3 1 The Default Configuration sssssssnsnsnsnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnan 3 1 Hardware Configuration J umper Settings cccecsecsssseeeeeeeeeeeeeeseaseess Jel J umper J CMOS1 Clear CMOS Memory s ssssssesernsrsrerererererrsrsrerererereres 3 2 J umper J DIMMVOLT1 DDR Memory Voltage ccccceceseessseeeeeeeseesaes 3 4 J umper J USBV1 USB Standby Voltage cccccsecseeseseseseeeeeseeseeeees 3 4 J umper J PSKMV1 PS 2 Standby Voltage cccccccceseeeeesseeeeeeeeeeeees oie Jumper J 2 Serial ATA Bridge Operation cccceccecssceseeeeseeeeeeeeeaes che Firmware Configuration The CMOS Setup Utility cceceeseceeeeeee
84. rtain of what you are doing Incorrect configuration of the CMOS Setup Utility can result in unreliable operation or a fail ure of the motherboard to work at all Using the CMOS Setup Utility Please refer to the Configuring the CMOS Setup Utility section in Chapter 5 for information on using the utility and some settings you might want to customize The utility does not run under an Operating System You must load it during the Power On Self Test POST while the com puter is starting up by press the Delete key or the Del key on the system keyboard s numeric keypad User s Manual Iwill 3 Motherboard Configuration BIOS CMOS Setup Utility Main Screen Load the CMOS Setup Utility during the POST by pressing the Delete or Del key The utility interface commands are explained at the bottom of each screen and General Help is available by pressing the F1 key See the section on Con figuring the CMOS Setup Utility in Chapter 5 for information on how to use this program The main screen has a basic list command instructions at the bottom of the screen and displays a function description of the highlighted item Phoenix AwardBIOS CMOS Setup Utility Standard CMOS Features H TWILL Smart Setting Advanced BIOS Features Load Fail Safe Defaults Advanced Chipset Features Load Optimized Defaults Integrated Peripherals Set Supervisor Password Power Management word PoP PCl Configura tup PO Health Status Saving Esc
85. ry window press the Enter key not Esc to exit the password entry window Save amp Exit Setup This saves the current utility configuration as a new con figuration record exits the utility and restarts the system using the saved configuration record Exit Without Saving Exits the utility and restarts the system without changing the saved configuration record In general it should not be necessary to use the CMOS Setup Utility once you have fully configured it In the event you do need to change or re establish the settings always make sure to save the settings when you exit the utility or the new settings will not be stored User s Manual Iwill 5 System Configuration Es Fi C H Phoenix AwardBIOS CMOS Setup Utility Standard CMOS Features H TWILL Smart Setting Advanced BIOS Features Load Fail Safe Defaults Advanced Chipset Features Load Optimized Defaults Integrated Peripherals Set Supervisor Password Power Management Setup Set User Password PoP PCI Configurati t Setup PC Health Status ut Saving Quit Te z Select Item Save amp Exit Setup Change Set Disable Password Phoenix AwardBIOS CMOS Setup Utility Standard CMOS Features H TWILL Smart Setting Advanced BIOS Features Load Fail Safe Defaults Advanced Chipset Features Load Optimized Defaults Integrated Peripherals Set Supervisor Password Power Management word PoP PCl Configura SAUE to CMOS and EXIT N gt W etup PO Health Status
86. satensaiacanesnen tiie riarscancsrcuss EREET 6 8 Hardware PrODIGMS censastuteetcitusatesstanebatennentusmeinesneaicnimneeareeesueinanents 6 8 General Hardware Troubleshooting c ceccecescesceseeeeeeeeeeeseeeeseeeteeeeens 6 8 Hardware Configuration Problems cccccsesseceseeeeeeeeeeeeeseeeeeeeeereeeess 6 9 Plug and Play Problems ccccecsecsecseeeeeeeeeeeeeeseeenetaeeeeeeeeetaess 6 10 Replacing the System Configuration Record ceccscessesseeeseeeeseeeeeeeens 6 10 Loading Optimized Defaults ccccccccsceecesseeeeeeeeeeeeeeeeeeseeseeseeeaess 6 10 7 Technical Specifications ssssssssssssnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnan 7 1 TECHNICAL SPECITICALIONS Sisnenainininasi a 7 1 C nnector PINGUIS reisiavarirnisidnoianiei iiia 7 3 VITI User s Manual User s Manual 1 Introduction What s In This Chapter Introduction Manual Structure Manual Features Critical Topics Packing List Pre Use Checklist 1 Introduction This is the User s Manual is for the P4G Series mother boards Anything in this manual that only applies to one board is clearly noted Please read this chapter before you use your motherboard and identify which parts of the manual you will need to refer to Please pay particu lar attention to the Critical Topics section Manual Structure This manual has seven chapters covering the following topics Chapter 1 Introduction Explains the manual structure and conventions and indi
87. saving DEEE Select Item it ave amp Exit Setup Save Data to CMOS Phoenix AwardBIOS CMOS Setup Utility Standard CMOS Features H IWILL Smart Setting Advanced BIOS Features Load Fail Safe Defaults Advanced Chipset Features Load Optimized Defaults Integrated Peripherals Set Supervisor Password Power Management word PoP PCl Configura Quit Without Saving lt M gt H tup FC Health Status Saving Loe z Select Item Save amp Exit Setup Abandon all Data User s Manual 5 25 P4G Series Motherboard will Installing an OS amp Support Software This section covers installing Operating System software and the support software on the Power Installer support CD ROM disc Once you have configured the CM OS Setup Utility you should install an OS If you install a sup ported Microsoft OS you should also install the driver software on the Power Installer disc Installing an Operating System This motherboard is primarily intended for use with the following Operating Systems e Microsoft Windows 9X e Microsoft Windows NT e Microsoft Windows 2000 e Microsoft Windows XP e Linux e Novell Netware e Unix Prepare the hard disk drive and install an OS according to the Instructions that come with the OS you will use Installing the Support Software The Power Installer CD ROM disc comes with required hardware drivers for Microsoft Windows and some addi tional utility software as noted in Chapter 2 If you ha
88. sys tem Suspend button the ACPI connector but not all sys tem housings have this button The same function can be performed at the Operating System level if the OS sup ports the feature User s Manual USB 2 0 USB 2 0 support is pro vided for Windows 2000 and Windows XP Under other operating systems the USB ports will func tion as USB 1 1 ports User s Manual 6 Using The Motherboard Indicator LEDs The motherboard front panel features connector supports three system status indicator LEDs e Power Status LED Indicator Lights when the system is turned on e System Hard Disk Drive Activity LED Indicator Flashes during hard disk drive access e Power Conservation Mode LED Indicator Lights to indicate the system is in a Suspend state power conservation mode Most system housings will have all of these LEDs mounted in the housing s front panel Additional System Features This motherboard supports the IWILL FI Panel front panel extender The FI Panel connectors on the motherboard connect to cables from the FI Panel which mounts in a 5 4 inch bay in the system housing and in cludes the following features e Compact Flash reader e Memory Stick reader e Secure Digital Card reader e Line Out audio jack Microphone jack e Two Hi Speed USB 2 0 ports Follow the instructions that come with the FI Panel to install and use the device The FI Panel is an optional purchase P4G Series Motherboard w
89. t system operation The Default Configuration The default configuration is set at the time of manufac ture The configuration is comprised of the hardware con figuration settings and the default firmware settings in the BIOS CMOS Setup Utility Hardware Configuration J umper Settings This motherboard is mainly configured in firmware which simplifies configuration There are also a few hardware settings The hardware settings are configured using stan dard jumper switches The motherboard has three jumper switches The first section is about the a BlOS related jumper and the second about the two hardware configu ration jumpers User s Manual 301 P4G Series Motherboard will The BIOS Related J umper J umper J CMOS1 Clear CMOS Memory JCMOS1 is a Jumper switch but it does not set a hard ware configuration setting The BIOS CMOS Setup Utility creates a system configuration record that is stored in CMOS memory in the real time clock chip If the configu ration record data becomes corrupted or is destroyed or if the CMOS Setup Utility settings are changed to an un usable configuration the motherboard may not run prop erly or at all CMOS1 provides a means to delete the configuration data stored in CMOS memory and reset the configuration to the CMOS Setup Utility s Optimized De faults Follow this procedure to clear CMOS memory If neces sary refer to the motherboard diagram and key in Chap ter 2 for the jumper l
90. taeeeranterens Sd The Make Driver Utility cccccecssceesseeseueeseeeseaeeeteeeeeeseaeeesaneerens 5 29 Making a LINUX SUPPO DISK anusririasreieiisriniine 5 30 Installing the Utility Software ccccccecessseseseeseeeseseeeeeeesteeeeaeeeens 5 30 6 Using the Motherboard ssssssssssnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn 6 1 USING System FEACUIES sseui a anii 6 1 Front Panel System Controls amp Indicators ssssssssrsrerererererrrerrrrrererrrrrn 6 1 SV SECM CONTO S pminxencicennutiteannctmen tit anie ENERE EA ENRERE 6 1 MAC Or LED raar AEE 6 3 Additional System Features cccceccecsscseceeteeeeeeeeeesseeeetestaeteetesseaes 6 3 Wake on LAN WOL siscsssscnhssaeiegdinnen nkwnsainrasndamdanentapinengennavnitinnenkisweewnd 6 3 Installing amp Configuring An IR Port ssssssssssssnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn 6 4 Performance Optimization s ssssssssnsnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn 6 6 System Memory s ssssssnsrsrsrsrrnrsrsrsrerrnrsrrrrrrrrsrsrrrnrrrsrsrrrrerernrnrrersreet 6 6 Disk Subsystems iniiseewssvnraasdiaisndeneserreariaidaensivanateketecedidennamatesatenncend 6 6 Processor Upgrades amp Adjustments cccecseceseeeeeeeeeeeeteseeteseneastaeeess 6 6 OnDOatd 521 AUU O scrierea aa rai 6 7 Speaker TYPES cccecsscceceeceeceeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeetaetaetaeteesesaetnes 6 7 Speaker CONNECTIONS cccecceccecssceeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeteeeeteenegas 6 7 TROUDICSNOOUING sicses
91. tallation procedure Technical specifications are listed in Chapter 7 mPGA478B Socket This socket is for 478 pin Pentium 4 CPUs only Note Both 400MHz and 533MHz Frontside Bus Pentium 4 CPUs are supported Fan Heatsink assembly retention mechanism 2 6 User s Manual DIMM Sockets System memory sockets are for e PC1600 200MHz e PC2100 266MHz unbuffered DDR SDRAM modules See Chapter 4 for impor tant installation informa tion User s Manual 2 Key Features amp Components System Memory Sockets Function The DIMM system memory sockets are for in stalling DDR SDRAM system memory modules Description There are two DIMM memory module sock ets on the motherboard These sockets are for 200MHz PC1600 or 266MHz PC2100 DDR SDRAM memory modules The sockets function independently allowing a variety of memory configurations up to a total of 2GB More Information See the section on Installing System Memory in Chapter 4 for configuration specifications and installation instructions Technical specifications are listed in Chapter 7 DDR DIMM memory sockets P4G Series Motherboard will AGP Slot For AGP 4X 1 5V cards only Do not use 3 3V cards The AGP Slot Function The AGP slot is for installing an AGP interface video display card Description The AGP slot is a high speed slot designed exclusively for an AGP video display card The AGP slot supports the following type of AGP
92. tant on off or instant on 4 second delay off In the delay mode when you push the power button for less than 4 seconds when the system is turned the system goes into the Suspend power conservation mode In this mode you have to push the button for more than 4 seconds to turn the system power off Reset Switch Function Restarts the system to cold boot Use Press the button to restart the system This forces a restart under all conditions Don t use the Reset button if you can shut the system down from within the Operating System Note On Reset amp Rebooting You should always restart or shut down the system by using the OS command for this This procedure allows the OS to shut down properly minimizing the possibility of hard disk drive problems or data loss If the system crashes or hangs you may have to restart the system at the hardware level There are two hardware reboot options a keyboard command and the Reset button You can effect a warm reboot with a key command if the OS supports it For example all versions of Microsoft Windows support restarting the computer with the Ctrl Alt Del Delete command You can try this command first if it is Supported Otherwise you will need to use the Reset button Suspend Button Function Toggles system in and out of Suspend mode Use Press the button to cause the system to enter or resume from Suspend mode Note The front panel feature connector supports a
93. tem information CPU cooling fan speed and various voltage levels Default amp Autodetected Settings The list of system information is autodetected and dis played Setting Options amp Constraints None CMOS Setup Utility PC Health Status Phoenix AwardBIOS CMOS Setup Utility PC Health Status Current CPU1 Temperature Item Help CPUFan Speed Menu Level F i2 U UBAT lt U gt CUSB U gt tl Move Enter Select z rPUZ PD Ualue Fi ave E G Exit Fi General Help FS Previous Values F6 Fail Safe Defaults F7 Optimized Defaults User s Manual 5021 P4G Series Motherboard will IWILL Smart Setting Section Function Configures CPU settings and enables the onboard ATA 133 and Serial ATA controllers if present Default amp Autodetected Settings The default settings autodetect the CPU and PCI Clock settings The Spread Spectrum setting reduces interfer ence generated by the board circuitry when Enabled Setting Options amp Constraints Don t change the auto detected settings unless you really know what you are doing You can configure the CPU settings manually Configuring CPU settings at variance with Intel s specifications can damage the CPU and void the CPU warranty You can disable The PromiseATA ATA 133 storage controller if you are not using it CMOS Setup Utility IWILL Smart Setting Phoenix AwardBIOS CMOS Setup Utility IWILL Smart Setting CPU Clock i33MHz Menu L
94. the standard onboard IDE controller Processor Upgrades amp Adjustments Processor speed has a significant effect on overall system performance To increase system performance you can consider using or upgrading to a faster processor The Intel Pentium 4 processor used by this motherboard comes in a variety of clock speeds To maximize perfor mance select a processor with the fastest clock speed the system budget or specification allows The CMOS Setup Utility s IWILL Smart Setting section will automatically detect and configure whatever proces sors are Installed Manual configuration is also available but setting the Intel Pentium 4 processor to operating parameters outside those specified can damage the CPU and void the warranty User s Manual User s Manual 6 Using The Motherboard Onboard 5 1 Audio The onboard audio subsystem provides support for con necting a 5 1 speaker system to the computer Speaker Types A 5 1 speaker system has the following speakers Front Left amp Right Channel e Rear Left amp Right Channel e Center Channel e Bass Subwoofer The 5 stands for the five speakers and the 1 for the Subwoofer These speakers make up the full set for a Home Theater speaker system Speaker Connections There are several means of connecting a 5 1 speaker sys tem to the board The rear I O panel provides the follow ing connections e Line Out For the Front Left amp Right Cha
95. ubsystem ATA 133 IDE and Serial ATA drivers Se lect a listed item and fol low the onscreen instruc tions User s Manual 5 System Configuration Review the Installation Guides by clicking on its name Install the appropriate USB 2 0 ATA 133 and Serial ATA drivers as needed for the OS you are using The Adobe Acrobat reader install program will run when you try to view an Installation Guide if you have not already installed it Install the program and then repeat the procedure to read the guide information If you will use Windows 2000 or Windows XP Install the supplied USB 2 0 driver Other versions of Windows and other operating systems are not supported Under them the USB ports will function as USB 1 1 ports If you have installed either a Smart Card Reader or a Memory Stick Secure Digital card reader or have installed the optional Fi Panel install the Fl Panel driver Click on the item and follow the installation program s instruc tions to install the driver The Make Driver Utility The Make Driver utility makes driver floppy disks You can use this utility to make a Windows driver disk for the onboard Realtek LAN chip i MILL Diser Diskete Maker wil Make things happen Please select the installation diskette you want to create Cink F ligh Point 3704072 RAI Oriver and L lib Onboard RealTek 81290 f 61006 Lan Creer Tabosa Promise AT 41 34 Diner Onboand Sena ATA133 Greer Inset the
96. upport software Driver that supports the chipset and the Intel Appli cation Accelerator that enhances system perfor mance e Audio driver software Audio driver and utilities for the onboard audio sub system Graphic driver software Driver software for the onboard video display e Installation Guides Acrobat PDF files that explain how to install the sup plied USB 2 0 ATA 133 and Serial ATA drivers e FI Panel Driver Drivers for Compact Flash Card Memory Stick and Secure Digital Card readers Can be used for the op tional FI Panel or individual devices Please see Installing OS amp Support Software in Chapter 5 for more information Power Installer EE Driver latatlotiom CC P4G sect mn Mall TWIEE MOTHERBOARD Driver installation screen agama Driver Installation Intel INF Driver Intel AA Driver Audio Driver Graphic Driver Lan Driver Installation Guide ATA133 Installation uide FI Panel Driver Option Exit http www twill net 2 26 User s Manual Iwill 2 Key Features amp Components Utility Software The Power Installer disc also has several Windows utility programs on it e Acrobat Reader Acrobat Reader allows you to read documents in the Adobe PDF format including online documents on the Power Installer disc and a wide range of other content The reader is free and can be up graded at the Adobe web site www adobe com when new versions become available e McAfee Ant
97. urer for information on solving the problem In some cases a firmware or driver upgrade may resolve the problem P4G Series Motherboard will Plug and Play Problems This motherboard supports the automatic recognition and configuration of expansion cards that support the Plug and Play PnP specification Most currently available expansion cards support PnP PnP simplifies card instal lation by allowing the system to handle system resource allocation If you install an expansion card that is not PnP compliant you may still need to configure the card manually Consult the card s documentation for instruc tions or other information Replacing the System Configuration Record As noted previously the CMOS Setup Utility creates a system configuration record and stores it in CMOS memory on the motherboard This record must be cor rect and uncorrupted for the system to operate properly It is possible for the system configuration record can be come corrupted or lost If this occurs the system will not operate properly or at all This is not a serious problem You can restore a working configuration using the CMOS Setup Utility to create anew configuration record by load ing the Optimized Defaults and reentering any other set tings you had made Loading Optimized Defaults The CMOS Setup Utility does not require an operating system to run You run the utility by typing the Del or Delete key while the system is starting up to brings
98. ve installed a supported Microsoft OS you must install the required drivers If you have installed Linux you can create Linux support disks 5 26 User s Manual Power Installer Main Screen Click on the model name for this board in the Socket 478 section Note The screen illustrations in this section are for the P4G The P4GS version in cludes Serial ATA material Power Installer P4G Main Screen You can automatically in stall the required Intel chipset support by choos ing Auto Installation or you can do all installations manually by choosing Manual Installation Either way you must install the Intel chipset support be fore you Install anything else 5 System Configuration Installing Windows Drivers This section assumes you have installed one of the sup ported Microsoft Operating Systems on the system hard disk drive To install Windows drivers insert the Power Installer support CD ROM disc in the system s CD ROM or other optical drive and wait for the Power Installer interface to automatically load If it doesn t start run the Power Installer interface directly from the disc by running Setup The Power Installer main screen will appear Click on a motherboard model number to open the section for it EE twill Power installer CD E PE T L 7 7 aa Tie a Se TWILE MOTHERBOARD P4G Fea Auto Installation Exit http www twill net Manual Installati

Iwill P4GS INTEL 845G Motherboard

Contents

Download Pdf Manuals

Related Search

Related Contents