Home

Korg microX Musical Instrument User Manual

1. 1 s UL AE E 1 Playing programs and combinations 2 Listening tothe demo SONGS ecnrereransisiros 8 Introduction 9 Main features 9 Front and rear panel 11 Front DOUG leery uuu ss ae 11 i u 2 22 s 14 Objects in the Display and their functions 15 Basic Information 17 About the microX modes 17 DaS OPCA NON Gecserkrri oranin 19 S ET o E E E S E Turning the power on olf 23 Connecting the AC adapter u u 23 Tormine the paweorgik uyu a tasas 23 Turning the power Off J L I aa 24 Connections 25 Dasic COnm0ectongu u u sqa aasayshesabayastucgaeesassss 25 Connecting a damper pedal foot switch 2 i818 pl Lennon ec ee cree enn eeeeE ne eet 26 Connecting d COMPUTCE sssainrenscssstsresciancssaanengase 27 Connecting MIDI devices u uuu aiskawqha 35 Playing and Editing Programs 37 Playing programs 37 DElOCHNG Protams u ukawa arcana 37 Using conbollop u aa tiyki 40 Simple program editing 43 J i Cove e l Lus Samina s 43 REALTIME CONTROLS 1 2 3 4 lI Gal et ere re ert re 43 Dae your CC sree 45 Detailed Editing wi
2. i PHONES Quick Start 3 Turn the microX s VOLUME knob down to the left Turn on your audio monitor system and set the volume to a normal level 4 Turn on the microX by pressing the power switch located on the rear panel 5 Slowly raise the microX s VOLUME knob to an appropriate volume Playing programs and combinations By default Combination mode will be selected when you turn on the power Play the keyboard and you will hear the sound of bank A combination number 000 A combination consists of up to eight programs that are split zoned layered or velocity switched across the keyboard A combination can also use up to two Arpeggiators simulta neously a program can use only one Arpeggiator letting you produce far more complex sounds than a single program Although you could simply continue selecting and playing different combinations let s start by selecting and listening to the basic sounds of the microX programs Note If you don t hear any sound when you play the keyboard Check the connections once again Also make sure that the microX s VOLUME and the volume of your powered speakers or stereo amp are turned up appropriately Selecting programs by bank and number CATEGORY AUDITION VOLUME PROGRAM PAGE PAGE l2 SLOW SYNTH FAST SYNTH LEAD SYNTH MOTION SYNTH KEYBOARD GUITAR A COMBINATION A B C OC OCO BASS SE DRUMS EXIT
3. 105 Using Drum Kits 107 A hatis a Drom Kii uuu usa sa ansustasisasshsapis 107 Betore you start CCS essiensa 107 Faitme Droni Killaka payapaq 108 DAV a TUN Ki eanna a 110 External control settings L11 Using external controls aes 111 External contmolse Nip asisas 112 Saving an external control setup 112 Other functions I I I S S I I E I I I S I T RRR 113 Restoring the factory settings Loading the pielosded data jessica 113 Assigning a name Rename 114 Assigning functions to REALTIME CONTROLS B mode knobs 1 4 ib Adjusting the display contrast 115 Tap tempo COMO csscsaiee k Q usia 115 Appendices 117 Saving alqu uu n una canteens 117 Types of data that can be saved 117 About the Edit Buffer l u ua asas 118 T ouDIesho0tI B8 u u un sa 119 Specifications and options 122 Cl liri Ol a 122 Operating requirements for connection to a COUN PUNE eraron rea e EEE S 123 IPOE sap eiee ociscioctoutenerneenenete 125 MIDI Implementation Chart 124 MOEK agiia 126 vi This Quick Start is provided for those who just want to get started trying out the sounds right away It explains how to set up the microX how to select programs and control the sound and how to listen to
4. If you are using Windows XP go to Control Panel System select the Hardware tab and check Device Manager If the microX has not been detected correctly it will be displayed in Other devices or Unknown devices Reconnect the USB cable if the microX is again displayed as an Unknown device the com puter has failed to detect it correctly Delete the Unknown device entry and reinstall the driver p 28 Your software does not respond to the microX LI Is the USB cable connected correctly LI Did you install the driver L Has your computer detected the connected microX If you are using Windows XP go to Control Panel Sounds and Audio Devices Proper ties and click the Hardware tab If you are using Mac OS X go to Macintosh HD Application folder Utility folder Audio MIDI Settings select the MIDI Devices tab and check that the microX has been detected Some computers may not recognize the microX because of their hardware configuration L Check the microX s assignments and USB MIDI port settings L The connected device or software may not sup port the messages you are transmitting See the owner s manual of the connected device or software to verify that it responds to the mes sages you are transmitting Software does not operate correctly L Does your computer meet the operating requirements of the software Even if y
5. SE cable 2 Make the necessary settings in the microX s Global mode See Global mode settings on the microX below 32 Connecting to your computer via MIDI Here s how to connect the microX to your com puter via a commercially available MIDI interface 1 Connect the microX s MIDI OUT connector and MIDI IN connector to your computer via the MIDI interface For details on how to use your MIDI interface see its owner s manual amp Some models of USB MIDI interface may be unable to transmit or receive the microX s MIDI exclusive messages MIDI interface MID OUT MIDIIN MIDI ad Y I IN Computer 2 Make the necessary settings in the microX s Global mode See Global mode settings on the microX below Global mode settings on the microX Local Control On settings Turn on the Echo Back function of the external MIDI USB sequencer or computer so that data received at MIDI IN will be re transmitted from MIDI OUT USB and turn off the microX s Local Control setting so that microX s keyboard and tone generator will be internally disconnected When you play the keyboard of the microX the musical data will be transmitted to the external MIDI sequencer or computer and then echoed back to play the microX tone generator In other words by turning
6. L Connecting MIDI devices Connecting MIDI devices By connecting the microX s MIDI connectors to an external MIDI device you can transfer sound set tings and performance data such as note messages between your external MIDI device and the microx About MIDI MIDI stands for Musical Instrument Digital Inter face and is a world wide standard for exchanging various types of musical data between electronic musical instruments and computers When MIDI cables are used to connect two or more MIDI devices performance data can be exchanged between the devices even if they were made by different manufacturers MIDI connectors MIDIIN This connector receives MIDI data Use this to play the microX from another MIDI device or from an external sequencer MIDI OUT IN MIDI OUT This connector transmits MIDI data Use this to control external MIDI devices or to record into an external sequencer Controlling an external MIDI tone generator from microX When you wish to use the microxX s keyboard controllers and arpeggiator etc to play an exter nal MIDI tone generator use a MIDI cable to con nect microX s MIDI OUT connector to the MIDI IN connector of the external MIDI tone generator isz los a SMT MIDI OUT MIDI IN P MIDI keyboard Controlling microX s tone generator from an external MIDI device When you wish to play or control the micro
7. aj p e JISSIGNABLE1 ASSIGNABLE 2 ASSIGNABLE3 ASSIGNABLE 4 NASA AAA 3 ARP GATE ARP VELOCITY ARP LENGTH TEMPO 11 Introduction 1 VOLUME knob This adjusts the volume of the MAIN OUTPUT L MONO R jacks as well as the volume of the headphone jack 2 REALTIME CONTROLS SELECT button 1 4 knob Use the SELECT button to choose one of the real time controller modes A B C and use knobs 1 4 to control the tone effects MIDI control changes and arpeggiator etc while you perform p 43 92 When you turn the EXT CONTROLLER button on lit External Control will be on and the REAL TIME CONTROLS 1 4 knobs will transmit MIDI messages to external MIDI devices p 111 3 Arpeggiator The microX s arpeggiator is a polyphonic arpeg giator ARP ON OFF button This button turns the arpeggiator on off When on the button will light p 91 The LED located above the ARP ON OFF button blinks at quarter note intervals of the tempo In REALTIME CONTROLS C mode you can use the 1 2 3 and 4 knobs to vary the arpeggio pattern in realtime 4 External You can use the REALTIME CONTROLS 1 2 3 and 4 knobs to transmit MIDI messages EXT CONTROLLER button This switches the external function on off When on the button will light p 111 When this is on you can use the SELECT button to select the MIDI messages assigned to the knobs and operate the REALTIM
8. LI If you wish to receive MIDI exclusive mes sages is the GLOBAL 1 MIDI page MIDI Filter Exclusive box checked s gt p 33 LI Does this instrument support the types of mes sages that are being sent to it When using USB sound processing is slow or the tempo is unstable LI Is the MIDI driver installed for the USB port you ve connected The driver must be installed for each USB port you use If you connect the microX to a USB port other than the port you used when install ing the KORG USB MIDI Driver for Windows XP you ll need to reinstall the KORG USB MIDI Driver L Have you made the correct echo back setting on your computer and the correct Local Control setting on the microX Included CD ROM Can t install the driver included CD ROM LI Is the USB cable connected correctly LI Is the CD ROM inserted in your CD drive Make sure that the CD ROM is inserted cor rectly L Could the lens of your CD drive be dirty Use a commercially available lens cleaner to clean the lens L Are you attempting to install from a network CD drive This software cannot be installed from a net work connected CD drive LI Are you able to use USB If you are using Windows XP go to Control Panel System and select the Hardware tab In Device Manager check the settings for Universal Serial Bus Controller and USB Root Hub C Has the microX been detected as an unknown device
9. Tone generator section 64 MB of preset PCM ROM containing 642 mul tisamples and 929 drumsamples e The sampling frequency is 48 kHz and the maximum polyphony is 62 voices Filter synthesis section e 24 dB oct Low Pass Resonance type or 12 dB oct Low Pass amp High Pass type filters can be used A wide variety of filter effects can be achieved from active sounds with aggressive resonance to subtle tones using a high pass fil ter e Abroad range of editing parameters gives you control over every aspect of the sound Effect section One insert effect stereo in stereo out two master effects mono in stereo out and a three band master EQ stereo in stereo out can all be used simultaneously You can select from 89 types of effect algorithms and edit them e Highly flexible effect routing is possible Effects can also be routed freely to the individual out puts Alternate Modulation and Effect Dynamic Modulation e The synthesis section filter etc provides Alter nate Modulation functionality and the effect section provides Effect Dynamic Modulation functionality This allows you to freely apply modulation to parameters that affect the pitch filter amp EG LFO effects etc e LFO and delay time parameters can be syn chronized to MIDI clock tempo You can syn chronize sounds or effects to the tempo of the sequencer or the arpeggiator A great selection of 640 programs In the Program mode
10. microX X50 Application Installer will start up automatically If your computer is set so the installer does not run automatically double click KorgSetup exe on the CD ROM 2 From the list select KORG microX SYNTHESIZER CONTROLLER and click Next gt KORG Application Installer KORG KORG microX X50 Application Installer Please select the product and click Next 2X KORG microX SYNTHESIZER CONTROLLER x KORG X50 MUSIC SYNTHESIZER 2005 KORG INC 3 From the list select the applications that you want to install and click Install If you want to install the preloaded application template files for external control click microX External Control templates to select it KORG Application Installer KORG KORG microX Application Installer Please select the applications to install and click Install a KORG USB MIDI Driver Tools 1 07 2 microX Editor microX Plug In Editor we microX External Control Template m Open KORG Catalogs folder 2005 KORG INC The applications you selected will be successively installed 4 Follow the on screen instructions to install each application If you ve made settings as shown in the screen shot for step 2 the KORG USB MIDI Driver Tools Installer screen will appear first e Click Next gt e The License agreement will appear Care fully read the contents and if you agree
11. Age Comatose s R813 DEF Modulation Ag TINK Pad 2 ABS Crimson Sthz Category Program 2 Press the PROGRAM or COMBINATION button for the desired category The category you specify will be selected A category name is printed below each bank button 3 For example if you press the CATEGORY button and then press the PROGRAM E button you ll be able to choose only from programs in the Keyboard category The Keyboard category contains programs such as acoustic piano and electric piano etc You can also use the PAGE PAGE buttons to step through the categories one by one By using the VALUE dial or the ClickPoint A Y to select programs you can step through the programs in the same category Press the MENU OK button to confirm your selection If you decide not to select a program press the EXIT CANCEL button Selecting combinations by bank and number CATEGORYJ AUDITION PROGRAM PAGE PAGE A B C D E GM 5 A SLOW SYNTH FASTSYNTH LEAD SYNTH MOTION SYNTH KEYBOARD GUITAR ING A COMBINATION A B c COO BASS SE DRUMS EXIT CANCEL Y MENU OK MULTI GLOBAL COMPARE UTILITY 1 Press a COMBINATION A C button The button will light You will enter Combination mode and the bank you specified will be selected Notice that the upper line of the display indicates COMBI 0 Play mode name page number and name Modename Page number and
12. By connecting an optional damper pedal foot switch or foot pedal you can control even more functions and effects PEDAL SWITCH DAMPER DAMPER INDIVIDUAL OUTPUT ASSIGNABLE MIDI 1 2 PEDAL SWITCH IN OUT Connecting a damper pedal This pedal can provide a damper effect as you play This instrument also supports half damping Here s how to connect an optional Korg DS 1H damper pedal to the DAMPER jack and use it to control the half damper effect 1 Connect an separately sold DS 1H damper pedal to the DAMPER jack You ll be able to control the half damper effect if you ve connected the DS 1H If you ve connected a different switch type pedal it will function as a damper switch 2 After you turn on the power set the switch polarity and adjust the half damper response to ensure that the half damper pedal works correctly PG p 77 80 Connecting a foot switch If you connect an on off type foot switch such as the Korg PS 1 pedal switch to the ASSIGNABLE SWITCH jack you can use it to turn the sostenuto or soft pedal effect on off to turn the arpeggiator on off to switch programs or combinations to control tap tempo or to apply modulation to a sounds or an effect This switch will always function in the same way regardless of the program combination or multi set you ve selected You can assign the function in the Global mode 0 System Foot page 1 Connect a foot switch such as the separately sold
13. Status and MIDI settings In the MULTI 2 Track Param MIDI page set Sta tus to INT for the tracks that you want to play and set their MIDI channel to the global MIDI channel Adjust the programs so that they fit within the multi set For each track program specify the poly mono setting and adjust timbre parameters such as por tamento and transpose Layer split and velocity switch In the MULTI 5 Key Zone Key page and the 6 Vel Zone Vel page specify the range layer split velocity switching etc in which each program will sound Effects The output of each track can be sent to the insert effect the master effects and the master EQ You can use the mixer section to freely specify how the audio signals will be routed Controller Setup 7 5 Arpeggiator 7 1 5 A B Master Effect 1 2 Insert Effect 8 3 4 MasterEQ 9 4 gt AUDIO OUTPUT L MONO R The microX s keyboard AUDIO OUTPUT INDIVIDUAL 1 2 1 1 9 4 etc indicate the microX on screen pages and tabs 73 Using and Editing Multi sets There is one insert effect and two master effects and for each of these you can choose one of 89 effect types The master EQ is a stereo three band EQ The effect settings created and saved with a pro gram in Program mode are not used in Multi mode Effect settings are made independently for the Multi set A
14. When you press the COMPARE button in these modes the data in memory i e the written con tent is temporarily called into the edit buffer This lets you compare the settings being edited with the settings prior to editing Editing applies to the data in the edit buffer Programs or combinations will play according to the data in the edit buffer When you write the program Sait Butter or combination settings will be saved in internal memory Write edit buffer Internal Memory Program Combination Multi Bank A 0 127 Bank A 0 127 0 127 118 When you select a program or combination its data is called Select from internal memory into the Memory in Global mode When the power is turned on the Global mode data is called from internal memory into the Glo bal mode memory area Then when you modify the parameters in Global mode the data in the memory area will be modified If you wish to save this modified data in the internal memory you must first Write save it When you write the data in the memory area will be written into the global settings drum kits arpeggio patterns and external control sets of internal memory If you turn off the power without writing the modified data in the memory area will be lost Editing will affect the data that has been called into the memory area lt Edit When you write the various Global mode When the power is turned settings will be saved wae f
15. a dialog box will open Use the ClickPoint lt 4 gt Y to select param eters To enter a parameter value use the VALUE dial the ClickPoint A Y To execute the utility command press the MENU OK button If you decide not to execute press the EXIT CANCEL button The EXIT CANCEL button is equivalent to Cancel Done or Exit Write Combination Abbe Gd Groovy Monsters Category 13 Complex amp SE Ta ABBR Groovy Monsters Cancel Text dialog box Use the ClickPoint lt 4 gt A Y to select a text button such as WI and press the center to open the text dialog box In this dialog box you can rename text e g the name of a program combination or multi set p 114 P HEeR Cokes 0 B 1T12345S67839 abe mR EC DE IJELPINDP DR STI IS Z S A abcecde T3hilijiklmisGapd4rszstuuumuz e Function buttons Use the ClickPoint lt 4 Y to select one of these buttons and press the center to execute the tollowing functions Gea Dear Cs Cars Gea 15 Introduction Scroll bar This indicates that the list contains more selections or parameters than can be shown in the screen at one time Use the ClickPoint A Y to move within the list Scroll bar Combi Category 13 Comples amp SE TRF LO els BB 2 C BB ADY Stark Bell Useri gasicadi Trash Aliens BBd4 C092 Dude That SICK Page menu In Combination
16. check I accept the terms of the license agree ment and click Next gt i KORG USB MIDI Driver Tools for Windows XP InstallShield Wizard License Agreement Please read the following license agreement carefully SOFTWARE LICENSING AGREEMENT 1 GRANT OF LICENSE AND COPYRIGHT Korg grants you the original purchaser the right to use the program and the data file constituting this software and the upgrade program and the data file to be distributed to you with certain conditions hereinafter referred to collectively as Licensed Program on a single computer at a time The ownership of the disk in which the Licensed Prograrn is recorded belongs to you The ownership of the rights to and the copyright of the Licensed Program itself belongs to Korg Mi S I accept the terms in the license agreement OI do not accept the terms in the license agreement e Specify the installation destination The screen will show the installation destination folder If you want to change this click Change and select the desired installation destination e Click Next gt to begin the installation e When the installation is complete click Fin ish to exit the installer Install the next application in the same way If you selected microX Editor Plug In Editor in step 2 choose the application s you want to install e Successively select and install the Editor Standalone Plug In Editor VST and or Plug In Edito
17. is checked the Program will use the BUS Select and Effects Send settings for each key of the Drum Kit When Use DKit Setting is unchecked the Program will ignore the Drum Kit s BUS Select and Effects Send settings 3 Access the GLOBAL 4 DKit Voice Mixer page 4 Use the BUS Select parameter to send drum sounds through their own Insert effect or to the individual outputs If you like you can send each note to its own Insert effect or to the individual audio outputs in addition to the main L R outputs For example you might send all snare sounds to IFX and the remaining sounds to L R 5 Use Send1 MFX1 and Send2 MFX2 to set the send levels to the master effects Setting the pan for each key To use separate pan settings for each key 1 Access the PROG 5 Ed Amp1 2 Level Pan page 2 Under Pan make sure that the Use DKit Setting check box is checked When Use DKit Setting is checked the Program will use the pan settings for each key of the Drum Kit 3 Access the GLOBAL 4 DKit Voice Mixer page 4 Use the Pan parameter to specify the key s stereo output position Assigning aname We recommend that you assign a name to the Drum Kit you create You can do this by using the Rename Drum Kit utility For details on assigning a name see p 114 110 Saving a drum kit When you ve finished editing your drum kit you can save it
18. specify where the output of each timbre will be sent See diagram below L R The output will be sent to MAIN OUTPUT L MONO and R Note After passing through the master EQ the sound will be sent to MAIN OUTPUT L MONO and R IFX The output will be sent to insert effect IFX 1 2 1 2 The output will be sent to INDIVIDUAL OUTPUT 1 or 2 Note It will not be sent to the insert effect the master effects or the master EQ Off The sound will not be sent to MAIN OUTPUT L MONO R INDIVIDUAL OUTPUT 1 and 2 After passing through the master effects the sound is sent to the MAIN OUTPUT Choose this setting if you want to send the sound in series through the master effects at the send level specified by MFX Send See diagram below S1 Send1 MEFX1 S2 Send2 MEFX2 specifies the send level from each timbre to the master effects This can be set only if BUS Select is set to L R or Off The actual send level will be the send level of each timbre multiplied by the send level of each oscillator of the program selected for the timbre If the send level of a program is 0 the actual level will be zero even if the send level setting is raised here If IFX is selected for BUS Select set the send levels to the master effects by adjusting the S1 Send1 MEFX1 and S2 Send2 MFX2 parameters COMBI 8 Ed InsertFX Setup page located after the signal has passed thro
19. Before you continue adjust your settings so that the microX can send MIDI data to your computer application or MIDI device 1 Press a PROGRAM A GM button The button will light We ve selected Program mode as an example here but you are free to select Combination or Multi mode if you wish 2 Press the EXT CONTROLLER button The button will light EXT CONTROLLER button SELECT button A B C REALTIME CONTRG EXT 2 3 4 DFF CONTROLLER CE CF C Cm secr A f ar 7 a U CAA OnORORON OHI NI NAI NA co Knobs 1 4 The 0 Play Ext Control page will appear Gch ClCHer4 each CCE Gch CCHAT 1 Gch CHATS GCh CCHETS GCh CCHA0 2 Geh CCBR091 Geh CCHO07 Gch Off Gch Off Gch Off FrogromJbFedit Are CNT Choose Setup Select and select the external control set that you want to use The set list is shown in the lower lines The functions of the currently enabled knobs are highlighted Press the SELECT button to select the functions group that will be controlled by the REALTIME CONTROLS 1 4 knobs When you turn knobs 1 4 the assigned MIDI control change CC will be transmitted on the assigned MIDI channel Note The microX s keyboard and other controllers will operate as usual Enter Combination or Multi mode and operate the knobs The External Control function lets you use the REALTIME CONTROLS 1 4 knobs as independent controll
20. Editing in the PROG 7 Ed Arp Ctrls Setup page See the preceding section for details on parame ters that can also be set from the PROG 0 Play Arp Play page Here we will explain the remain ing parameters e Access the PROG 7 Ed Arp Ctrls Setup page Setting the duration of the arpeggiated notes Gate Gate lets you specify the duration gate time of the arpeggiated notes If a user arpeggio pattern is selected you can set this to Step In this case the value of the Gt setting for each step GLOBALS Arp Pattern Edit page will be used Note This value will be in effect when the REALTIME CONTROLS C mode 1 ARP GATE knob is in the center position 12 o clock Be sure that the knob is in the center position when you make this setting Setting the velocity of the arpeggiated notes Velocity Velocity lets you specify the velocity of the arpeggiated notes If this is set to Key the velocity with which you actually played the note will be used If a user arpeggio pattern is selected you can set this to Step In this case the value of the Vel Velocity setting for each step GLOBAL 5 Arp Pattern Edit page will be used The arpeggiator in Combination and Multi modes Note This value will be in effect when the REALTIME CONTROLS C mode ARP VELOCITY knob is in the center position 12 o clock Be sure that the knob is in the center position when you make this setting Note When
21. GECA Pops Ballade Note If the display indicates Memory Protected the multi set memory protect is turned on Go to GLOBAL 0 System Preference page and uncheck the Memory Protect Multi setting p 88 3 Optionally you can also select a new location or change the Multi set s name or category e If you want to change the name use the Click Point to select the text button fif and then press the ClickPoint center to open the text edit dialog box You can give the Multi set a descriptive name using the on screen keyboard p 114 After entering the name press MENU OK button The text edit window will disappear returning you to the main Write dialog 4 In the Write Multi dialog box press the MENU OK button to write save the program 5 Amessage will ask you for confirmation If you are sure you want to write the program press the MENU OK button once again The multi will be written saved Control via MIDI Multi mode enables the microX to function as a MIDI tone generator that is controlled from the connected computer to play ensemble music con sisting of multiple instrument parts This mode also permits you to use the microX as a GM tone generator Parameters and performance data A multi set consists of tracks 1 16 parameters such as the multi set name effect and arpeggiator parameters and a tempo setting 75 Using and Editing Multi sets You can store 128 of
22. Licerise Select Destination Installation Type KORG USB MIDI Driver for Mac OS X Y Version 1 0 3 Installing Finish Up Apple the Apple logo and Mac are trademarks of Apple Computer Inc registered in the U S and other countries Copyright 2005 KORG Inc All rights reserved Go Back i Continue gt 4 Import information will appear Read the contents and click Continue 5 The License agreement will appear Carefully read the contents and click Continue A dialog box will ask whether you accept the terms of the license agreement If you accept click Agree 6 Ascreen where you can choose the Installation destination will appear Choose the installation destination and click Continue ean Install KORG USB MIDI Driver for Mac OS X Select a Destination Select a destination volume to install the KORG USB MIDI e Introduction Driver for Mac OS X software Read Me ZA I a j lu j License i i f 7 Select Destination SU sa Installation Type Macintosh HD ata Installing 11 9GB 5 1GB Free 4 9GB 3 3GB Free 40 4GB 37 0GB Free Finish Up e jaf Installing this software requires 622KB of additional space You have selected to install this software on the volume Macintosh HD Go Back Continue 7 The Easy Installation dialog box will appear Click Install 8 Depending on the versi
23. No to 01 Use the ClickPoint to select Gt Gate and change it to LGT 9 Use the VALUE dial to change Step Step No to 06 Use the ClickPoint to select Gt Gate and change it to LGT Note To simulate the timing nuances of a strummed guitar chord select Flam In Program mode select an acoustic guitar program and choose the user arpeggio pattern that you created here In the Setup page of PROG 7 Ed Arp Ctrls Setup set Gate to Step Then return to the GLOBAL 5 Arp Pattern Edit page For odd numbered steps set Flam to a positive value For even numbered steps set Flam to a negative value Drum pattern You can use the arpeggiator to play a rhythm pat tern by using Fixed Note with a drum program 1 Select a drum kit program For this example select preset program B020 Standard Kit 1 2 Select the GLOBAL 5 Arp Pattern Setup page and set the parameters Check Fixed Note If this is checked tones will always sound at the specified pitch If you set Mode Fixed Note Mode to Trigger All Tones playing a single note will cause all Tones to sound If you set Mode Fixed Note Mode to Trigger As Played the notes you play will determine how Tones are sounded TYpe AS Played Octave Motion Up Fixed Note Tone No Fixed Note No Mode Fixed Note Mode If Fixed Note is checked you will be able to set Tone No
24. PIL Joystick movement in the Y axis can adjust the depth of the wah effect PROG 4 Ed Filter1 2 LFO Mod p 54 PG p 18 Joystick movement in the Y axis can adjust the speed of the LFO PROG 3 Ed LFOs OSC 1 2 LFO 1 2 PG p 14 OCTAVE These buttons shift the range of pitches assigned to the keyboard in one octave steps over a range of 3 octaves Pressing the A button will raise the pitch in one octave steps Pressing the Y button will lower the pitch in one octave steps You can press the OCTAVE Y A buttons simul taneously to recall the written saved settings OCTAVE V A functions Press the Kevboard Press the y LED status A range button C6 C8 Rapidblinking A x Y G C Slowblinking a ov a j 4 x Y GG bak Y G G owm Y GG fodo Press the VI A buttons eee LED status range simultaneously Corresponds to Note With the factory settings changing the program combination or multi set will also recall the OCTAVE V A button setting that was written as part of that data This is because the GLOBAL 0 OCTAVE Keys Y A Use Prog Combi Multi s Octave setting is checked If this setting is not checked changing the program etc will not affect the OCTAVE Y A setting until you change the octave yourself p 88 REALTIME CONTROLS 1 2 3 4 SELECT Use the SELECT button to select real
25. Prog Basic page Oscilla tor Mode setting specifies whether the oscillator will be a drum kit or a conventional multisample such as piano or strings You can verify this setting in the PROG 2 Ed Pitch OSC1 page If Oscillator Mode is set to Single you ll be able to specify two multisamples and a velocity switch If this is set to Double you ll be able to make an additional set of settings in the OSC2 page If Oscillator Mode is set to Drums you ll be able to make settings for one drum kit A drum kit does have velocity switch settings but these set tings are made for the drum kit in Global mode and cannot be edited or saved in Program mode Before you start editing First select a Drum Program In Global Mode you ll play the kit that you re editing as if you were playing it from within the Program Combination or Multi set which was selected before you entered Global mode So before you enter the GLOBAL 4 DKit pages it s best to select a Program which is already set up for drums in Program mode with the appropriate EG settings effects and so on Choose a drum Program such as B020 Standard Kit 1 If you moved from Multi mode to Global mode playing the keyboard will sound the program and arpeggiator of the track that matches the global MIDI channel GLOBAL 1 Match the note mapping and key position for the drum kit In order for the note mappings to match the key b
26. Program Global or Multi modes pressing the MENU OK button will display a list of the pages in that mode To select a page use the ClickPoint lt 4 gt A Y to select the desired page and press the center p 19 Using the page menu to move When Page Menu Style Icon ETE Combination PRGE HENU Tone Adjust MIDI Filter 1 MIDI Filter2 Velocity Zore AFB YControls Insert Effect Master Effect When Page Menu Style List EZ Combination 1 Edit Tone Ad just 2 Edit Timbre Param 3 Edit HIDI Filter 1 AFPeggiator A 4 Edit hIDI Filter2 ArPeggiator B 5 Edit Key Z Ext Control u Note You can set Page Menu Style in the GLOBAL 0 System Preference page Other objects To use slider or knob shaped objects use the ClickPoint lt 4 Y to select the desired item and use the VALUE controllers to adjust the value Other types of objects are shown in the effect rout ing screen Slider Knob Master Ed G din dE1 RASS HET at Low Mid High Routing COMBI Ed InsertFa Setup 7T41 605 SelcIF2 5 mI BS 5T GPSphicPEG CB643 LAR 51 127 52 127 i H IF St Grophicres meaaAsEeETSa Basic Information Basic Information About the microX modes The microX has a wide range of capabilities it lets you play programs combinations edit them play the microX s sound generator using musical per formance data from an external MIDI sequ
27. Single Program 48 Slope 65 Split 64 Status 63 71 Synchronization 105 System exclusive 33 T Tab 15 20 Tap tempo 115 TEMPO 92 Tempo Sync 51 Text dialog 114 Three attributes of sound 46 Tone Adjust 67 Transpose 33 67 87 Tremolo 55 Tuning 87 U USB connector 32 User arpeggio pattern 99 Chord 102 Drum 102 Edit 100 Melody 102 User Scale 89 User All Note Scale 89 User Octave Scales 89 Utility 21 V Value 20 VALUE controller 20 Velocity 33 40 49 55 87 Velocity Switch 64 Vibrato 52 Volume 42 Timbre 61 Track 71 Volume balance 61 W Wah 54 Write 21 117 Combination 61 Drum kit 110 External control 112 Multi set 75 Program 45 User arpeggio 104 127 IMPORTANT NOTICE TO CONSUMERS This product has been manufactured according to strict specifications and voltage requirements that are applicable in the country in which it is intended that this product should be used If you have purchased this product via the internet through mail order and or via a telephone sale you must verify that this product is intended to be used in the country in which you reside WARNING Use of this product in any country other than that for which it is intended could be dangerous and could invalidate the manufacturer s or distributor s warranty Please also retain your receipt as proof of purchase otherwise your product may be disqualified from the manufacturer s or distributor s warranty KORG INC
28. Step to 03 and enter Tone 0 5 Set Step to 04 and enter Tone 0 6 Set Step to 05 and enter Tone 0 7 Set Step to 07 and enter Tone 0 We won t enter a tone in Step 06 8 Set Step to 08 and enter Tone 0 9 Press the MENU OK button 10 Use the VALUE dial to change Step Step No to the appropriate step Use the ClickPoint to select Ptch Pitch Offset and make the following settings Set the Step 01 Ptch Pitch Offset to 00 Set the Step 02 Ptch Pitch Offset to 10 Set the Step 03 Ptch Pitch Offset to 00 Set the Step 04 Ptch Pitch Offset to 00 Set the Step 05 Ptch Pitch Offset to 12 Set the Step 07 Ptch Pitch Offset to 00 Set the Step 08 Ptch Pitch Offset to 02 102 Chordal pattern 1 Set Step Step No to 01 and press the center of the ClickPoint 2 Select Tone 0 and press the center of the ClickPoint 3 Use the ClickPoint gt to change Step to 03 and enter Tones 1 2 3 and 4 We won t enter a tone in Step 02 4 In the same way change Step to 04 and enter Tones 1 2 3 and 4 5 Change Step to 06 and enter Tones 1 2 3 and 4 We won t enter a tone in Step 05 6 Step to 08 and enter Tones 1 2 3 and 4 We won t enter a tone in Step 07 7 Press the MENU OK button 8 Use the VALUE dial to change Step Step
29. bass and drums When shipped from the factory the preloaded Programs are organized into 16 categories In the PROG 0 Play page you can select programs by category as follows Using CATEGORY and the PROGRAM COMBINATION buttons to select 1 Press the CATEGORY button The category menu will appear The categories are displayed in the left side of the screen and a list of the programs in the selected category are displayed in the right side Sel Select Category No SEEE Comatose ABTS UCF Modulation A293 Tin lin Fad AdS Crimson Sth Category Program 2 Press the PROGRAM A GM or COMBINATION A C button for the desired category The category you specify will be selected A category name is printed below each bank button Note This method lets you select up to nine categories e You can use the PAGE PAGE buttons to step through the categories one by one 3 By using the VALUE dial or the ClickPoint A Y to select programs you can step through the programs in the same category 4 Press the MENU OK button to confirm your selection If you decide not to select a program press the EXIT CANCEL button B AUDITION PORTAN i DODODOO 3 COMBINATON 3 CATEGORY Fos copo 4 EXIT CANCEL v MENU OK MULTI GLOBAL COMPARE sp A eee Note You can also switch categories by using the ClickPoint
30. dial is used to set the value of the selected parameter p 20 VALUE dial Front panel 10 PAGE CURSOR PAGE PAGE buttons You can use these buttons to move forward or backward through the different tabs in a page By holding down the MENU OK button and pressing these same buttons you can move for ward or backward through the pages themselves such as page 0 1 2 etc amp p 20 While the category menu is displayed you can use these buttons to step through the categories one by one t p 38 ClickPoint The ClickPoint is a multi function controller You can move the ClickPoint in the lt 4 gt A Y direction to select parameters In addition you can press directly down on the cen ter of the ClickPoint in toward the body of the instrument to select an item in the display After selecting a parameter expressed as a numeri cal value etc press the center of the ClickPoint the value will be highlighted and now you can use J Y to increase or decrease the value To finalize the value press the center once again If you press the EXIT CANCEL button while pressing the ClickPoint center the selected value will be reset to 0 or the minimum value You can also press the ClickPoint center to access a dialog box to set the numerical value of an edit able condition or to turn a switch on off If you press the ClickPoint on the utility menu page menu or a text edit button p
31. lt 4 A Y to select the parameter whose setting you want to change DAME O Frogram CO DOrum Kit Combi For Local Control On or Exclusive select the parameter and press the ClickPoint center to switch the parameter on off For the Local Control On parameter local control will be off when the box is unchecked For Convert Position and Multi Mode select the parameter and turn the VALUE dial to change the setting 34 Example connections when using the microX Editor Plug In Editor If you want to mix the microX s audio signals with the audio signals sent from your host application via your audio interface or with audio signals from another sound module make connections as shown below Sos oon O Powered monitors E neuri If you want to apply a plug in effect to the microX s audio signals or to control the microX s audio signals in your host application together with the audio data from the KORG Legacy Col lection or other audio tracks make connections as shown below Make settings as appropriate for the host application you re using For details on setup see Editor Plug In Editor Manual PDF oon oon Powered monitors l all l
32. the microX provides 640 user programs plus 128 programs 9 drum sets for GM compatibility When shipped from the factory it is loaded with high quality programs that cover a wide range of musical needs Programs using multisamples that pro vide a broad range of sounds Based on 642 different multisamples that deliver a broad range of sounds ranging from acoustic instruments such as piano guitar and trumpet to synthesizer sounds or sound effects oscillator the preset programs provide a rich variety of edit able parameters filter and amp effects and arpeggiators Drum programs that support any style of rhythm part Based on 40 user drum kits and nine GM2 com patible ROM drum kits and taking full advantage of numerous editable parameters effects and arpeggiators the microX provides a great selection of preset programs for any style of music The drum kits that are the basis of each drum pro gram allow you to freely map any of the 929 drum or percussion sounds to each note of the keyboard You can also create your own drum kits and even specify filter and amp settings effect settings and individual audio output routings for each separate key 384 different combinations let you freely combine programs The microX provides 384 user combinations The factory settings contain a wide variety of Pre loaded combinations Introduction A combination allows you to use layers splits or velocity switchin
33. use the VALUE dial to specify the spacing between the arpeggiated notes Selecting the octave range of the arpeg giated notes Octave Use Octave to specify the octave range in which the arpeggio is produced e Use the ClickPoint to select Octave and use the VALUE dial to specify the octave range in which the arpeggio is produced Octave 4 UP Note If a user arpeggio pattern is selected the Octave Motion setting GLOBAL 5 Arp Pattern Setup page will affect the way in which the arpeggio is played 93 Arpeggiator settings Selecting the playback order of the arpeggiated notes Sort Sort is different than selecting the arpeggiator pattern Sort specifies whether the notes of the arpeggio will be sounded in order of their pitch regardless of the order in which they were played or in the order in which you played them e Use the ClickPoint to select the Sort check box and press the center Checked the arpeggio will sound each note in the order of its pitch regardless of the order in which you actually played the notes Unchecked the arpeggio will sound each note in the order in which you actually played the notes Sort Sort ON UP rT rr Letting the arpeggio continue playing even after you take your hand off the keyboard Latch Latch specifies whether the arpeggio will con tinue play
34. 1 Ed Basic OSC1 page 2 Use the ClickPoint lt gt A Y to highlight High Multisample e Use the VALUE dial to make your selection PROG 1 Ed Basic O5C1 Aultisample OSE 1 High Multisample Velocity Sl L H B 1 iOctave 1 167 PTT Few Level 127 iTranspose 88 541 Click Tune HHH8 Pigs Rew Level 127 iDelay Bms F siri Nizoned dition Basic oscillator settings e Alternatively you can select a multisample by category With High Multisample highlighted press the CATEGORY button to access the category menu amp p 38 M Smpl Category i4 0rum Wave sea Fiand Eras Eass EE t e51esr 6en Tree z B32Z 638 Ee1 Tree LP s B931639 Flexatone Bq4l6d48 Chinese Gong EEEE d1 Click Use the PAGE PAGE buttons to select a category Then use the VALUE dial to select a multisample Press the MENU OK button to finalize your selection 3 Specify the basic pitch of the oscillator This is set by the Octave parameter 4 In the same way select a different multisample for Low Multisample You have now assigned the High and Low multisamples Next we ll set the velocity range 5 Specify a velocity value for Velocity SW LH Notes played on the keyboard at a velocity less than the value you specify will sound the Low multisample velocities at or above this velocity value will sound the High multisample For examp
35. 4015 2 Yanokuchi Inagi city Tokyo 206 0812 Japan 2006 KORG INC
36. ALT1 ALT2 RANDOM and 251 user arpeggio patterns are provided With the factory settings these con tain a wide variety of preload arpeggio patterns In addition to providing conventional arpeggiator functions the polyphonic arpeggiator of the microX can respond to the pitches or timing of your keyboard playing and produce a diverse range of chords or phrases This can be used to play a variety of drum phrases bass phrases or guitar and keyboard backing riffs The arpeggiator 10 is also effective for use with subtly moving pads synth sounds or sound effects In Combination mode and Multi mode the microX provides dual polyphonic arpeggiators that can simultaneously play two arpeggio pat terns You can apply separate arpeggio patterns to drum and bass programs or use keyboard splits or velocity to switch between arpeggio patterns for an even more dynamic performance External control setups You can assign twelve MIDI control changes to the REALTIME CONTROLS 1 4 knobs The microX can hold 64 such sets of twelve control change assignments You can use this capability to control a wide range of parameters in realtime such as on the KORG Legacy Collection or other soft synthesizers or the level and pan of your DAW Digital Audio Workstation Direct USB connection to your com puter The microX provides a convenient USB connector that allows single cable connection to your com puter without requiring a MIDI inter
37. All Tones playing a single note on the keyboard will cause the rhythm pattern to play If Mode Fixed Note Mode is set to Trigger As Played playing a single note on the keyboard will cause only the kick Tone00 to play Playing two notes on the keyboard will cause only the kick Tone00 and snare Tone01 to play In this way the number of keys that you play will be played by the same number of tones Set the parameters for each step Use Vel Velocity etc to add accents to the rhythm pattern Note The Gt Gate and Vel Velocity settings you make here will be valid if the Gate and Velocity parameters PROG 7 Ed Arp Ctrls Setup page of the program selected in Program mode are set to Step If these parameters have a setting other than Step the Gt Gate and Vel Velocity that were specified for each individual step will be ignored and all notes of the arpeggio will sound according to the specified gate and velocity Note Before you set Gate move the REALTIME CONTROLS C mode 1 ARP GATE knob to the center position 12 o clock Note Before you set Velocity move the REALTIME CONTROLS C mode 2 ARP VELOCITY knob to the center position 12 o clock 103 Arpeggiator settings Dual polyphonic arpeggiator editing in Combi and Multi modes Here we will use a combination as an example in our explanation The same procedure applie
38. B mode functions for the REALTIME CONTROLS 1 2 3 and 4 knobs can be viewed for Program mode in the 0 Play Program page and for Combination mode in the 0 Play Combination page Playing programs and combinations Using the arpeggiator As you selected and listened to various programs and combinations you probably noticed that some of them began playing automatically This is because of the arpeggiator The arpeggiator is a function that automatically generates arpeggios the notes of a chord played individually in a rhythmic pattern Most arpeggiators produce an arpeggio when you play a chord on the keyboard In addition to this the microX s arpeggiator is a polyphonic arpeggiator that is able to produce a variety of chordal transformations or phrases based on the pitch or timing of the notes you play on the keyboard These functions let you use the arpeggia tor to play a wide range of patterns including drum or bass phrases and guitar or keyboard backing riffs It is also effective to use the arpeggiator as part of the sound creating process when creating subtly moving pads synth sounds or sound effects In Program mode you can use one arpeggiator In Combination mode and Multi mode you can use two arpeggio patterns simultaneously dual polyphonic arpeggiator This gives you a variety of possibilities such as applying separate arpeggio patterns to a drum program and a bass program or using splits or velocity to switch
39. Default Settings in Multi Mode The following table shows the default settings for Multi mode that are automatically selected when GM Initialize is executed or when the microX receives a GM ON messages F0 ZE 7F 09 01 F7 Parameter Taqna eS Pogana cousin gDOTISRSTANDAROKR m G Jj G j wum 4 o kr s Other Master Effect and Master EQ parameters 76 x i ae Control via MIDI Selecting a multi set You can switch multi sets via MIDI by sending MIDI Song Select messages A song select message will be transmitted when you switch multi sets Conversely you can switch multi sets by receiving a song select message from the source you specify If the Global Multi Mode is set to for Master switching the multi set number will cause each track with a Status of EXT EX2 or BTH to trans mit bank select program change volume pan portamento send 1 and 2 post IFX pan and post IFX send 1 and 2 messages on the channel speci fied for that track Switching the program assigned to a track via MIDI Receiving MIDI program change messages to select programs amp p 39 Using MIDI program change messages to select programs Note In order to select programs via MIDI program changes the track s Status must be set to INT The MIDI channel of a track is specified by MULTI 2 Track Param MIDI MIDI Channel When a program change is received on
40. Ed Track Param MIDI page and the Program Change setting is located in the COMBI 3 Ed MIDI Filter1 1 page The result of receiving a program change on the global MIDI channel will depend on the GLOBAL 1 MIDI Combi Combination Change setting Using Controllers Just as in Program mode you can use controllers such as the joystick OCTAVE Y A buttons and REALTIME CONTROLS 1 4 to add a broad range of expression to your playing in Combina tion mode These controls let you modify the tone pitch vol ume effects etc in realtime while you play For more details see Using Controllers p 59 REALTIME CONTROLS 1 2 3 and 4 will also function as external controls Sending MIDI information from the various controllers When you select a combination on microX a MIDI program change for the selected combination number will be transmitted on the global MIDI channel At the same time bank select program change and volume CC 7 messages will be transmitted on the MIDI channel specified for each timbre that is set to Status of EXT or EX2 However these messages will not be transmitted for timbres that are set to the same MIDI channel as the global MIDI channel In this case EX2 tim bres will show the Program Select Bank as and will transmit the bank number that was speci fied in Bank EX2 MSB and Bank EX2 LSB 2 1a MIDI messages transmitted
41. Global mode user drumkit settings GLOBAL 4 arpeggiator settings GLOBAL 5 external control settings GLOBAL 6 and all other glo bal settings GLOBAL 0 3 You into its own memory area e Note that Compare can t be used in Global mode If you want to edit a user drum kit or user arpeggio pattern you should first use Copy Drum Kit or Copy Arpeggio Pattern to copy the drum kit or user arpeggio pattern you want to edit into a vacant number and then edit the copy Caution when the arpeggiator is used by multiple programs or combi nations When you edit a user arpeggio pattern the changes will have an effect on any Program Com bination or Multi set that uses this same pattern Initializing an arpeggio pattern With the factory settings all of the microX s user arpeggio patterns U000 U250 contain preloaded data If you want to create a new arpeggio pattern choose an appropriate arpeggio pattern and ini tialize it Note Even if you ve initialized a pattern you can reload the factory preset data at any time using the Global mode p 113 1 Press the GLOBAL button to enter Global mode and access the GLOBAL 5 Arp Pattern Setup page 2 Select the arpeggio pattern that you want to initialize Type AS Played Octave Motion Up iC IFimed Mote Torp n on f i rA kan Woar a PEED PSE MT oR nrgej 3 Access the GLOBAL 5 Arp Pattern Edit page 4 Press the UTILITY button F
42. Local Control OFF you can pre vent notes from being sounded in duplicate as would otherwise occur if a note were sounded by the microX s own keyboard and again by the data that was echoed back If the arpeggiator function is on playing the microX s keyboard will not cause the arpeggiator to operate and only the musical data produced by playing the keyboard will be transmitted The arpeggiator will operate only in response to the notes that are echoed back and received at MIDI IN In this way turning off Local Control prevents the arpeggiator from operating in duplicate Use this setting when you wish to record on the external MIDI sequencer or computer only the notes that trigger the arpeggiator and to use the Connecting a computer echoed back notes to operate the arpeggiator while monitoring your recording or during play back Note If you want the note data produced by the arpeggiator to be recorded on the external sequencer computer set Local Control on and turn off the Echo Back setting of the external sequencer computer The default setting for Local Control is On To turn off Local Control the Local Control On GLO BAL 1 MIDI page check box to uncheck it PG p 82 When using the microX by itself leave Local Con trol turned on If this is off when microX is used by itself playing the keyboard will not produce sound Note The microX s Local Control setting can be turned Off by the Loca
43. Note You ll need to turn off the memory protect setting for drum kits In the GLOBAL 0 System Preference page uncheck the Memory Protect Drum Kit check box p 88 1 Press the UTILITY button to access the utility menu and choose Write Drum Kits 2 Press the MENU OK button to write the drum kit data A dialog box will ask you for confirmation 3 Press the MENU OK button to save or press the EXIT CANCEL button if you decide not to save The drum kit data will be written saved External control settings The microX s external control function lets you use the four REALTIME CONTROLS knobs to control an external MIDI device You can specify the MIDI channel and MIDI control change that each knob will transmit One set of control settings consists of twelve such assignments four knobs x three groups and there are a total of 64 sets With the factory settings the control sets contain preloaded data For example there are setups that let you control soft synthesizers such as the KORG Legacy Collection and other setups that let you control the level and pan of a DAW Digital Audio Workstation program in realtime See the microX External Control Template List PDF for details on the control change CC set tings assigned by the preloaded external control templates and the application settings to which they correspond Using external controls Selecting external controls Note
44. OF Mode Reset Page Mend Style lor J Recalling the last selected mode and page at power on The state of microX when the power is turned on will depend on the setting of Power On Mode If Power On Mode is set to Reset factory set ting microX will automatically select the Combi nation mode 0 Play 88 If Power On Mode is set to Memorize microX will power on using the same mode and page that were selected when the power was previously turned off Protecting the memory If one or more of the Memory Protect boxes are checked operations such as writing loading etc will be prohibited for the corresponding type of memory If you want to edit and write save settings you ll need to uncheck this box In order to load the pre loaded data you ll first need to uncheck the Mem ory Protect box for the data you want to load Foot Page Foot Foot Sl Assign Foot SL Assign Foot Pedal Assign Off KORG Standard f KORG Standard Damper Polarity Foot SW Polarity Specifying the function of the ASSIGNABLE Switch and ASSIGN ABLE Pedal Assignable Switch Foot SW Assign lets you assign a function to a footswitch such as the optional Korg PS 1 con nected to the rear panel ASSIGNABLE SWITCH jack e This is set by Foot SW Assign You can choose from the following functions Alternate modulation source Effect dynamic modulation source Switch portamento on off Control t
45. Octave 1 C sSort eaten O kEey Sune Dreubsars H Are E O53 Echo Jamm AFPeggiator Fun FIA IFIE Pattern LBd5S Gf Soaul Strum Octave 1 Sort FlLatch C key Sync keyboard combi J Froga TD His Ware ad ar Er C 1 Ezt c trli As you can see from the Timbre Assign table in the upper right arpeggiator A is assigned to timbre 4 and 8 and arpeggiator B is assigned to timbre 2 When you play the keyboard the Dr BigBeats 2 arpeggio pattern will play the pro gram Drum n Bass Kit of timbre 4 The Gt Stab Rhythm arpeggio pattern will play the program Funkin Guitar of timbre 2 e If you uncheck Arpeggiator Run A or Arpeggiator Run B the unchecked arpeggia tor will stop If you check it once again and play the keyboard the arpeggiator will begin running Look at the COMBI 7 Ed Arp Ctrls Scan Zone page and you will see that the A keys Btm and Top are set so that arpeggiator A will operate only for B3 and lower keys and that the B Top Key and Bottom Key are set so that arpeggiator B will operate only for C4 and higher keys A Key Etm EIB Top 63 E Key Btm Cd Top G9 A Wel Btm B81 Top 127 B Wel Btm 881 Top 127 Dual polyphonic arpeggiator set tings The dual polyphonic arpeggiator functionality lets you do the following things e Assign an arpeggiator for each timbre Choose from Off arpeggiator A or arpeggiator B step 5 e Inde
46. Play Arp Play A and B pages are essen tially the same as for a program 1 Access the COMBI 0 Play Arp Play A page and make settings for arpeggiator A 2 Access the COMBI 0 Play Arp Play B page and make settings for arpeggiator B Arpeggiator A B Arpeggiator Run OMBI 0 Pla BN oa 000 Groov a Run WA Fattern Freset d RAHDOH Reso F Octave 2 z Sort Lee tel CiKey Sune eee 7 Timbre Assign A Combilfelect Arpeggio Pattern Select the arpeggiator s that will run Use the Arpeggiator Run check boxes to specify the arpeggiator s that you want to run The arpeggiator s that are checked here will operate when the ARP ON OFF button is on However the arpeggiator will play a timbre only if the table displayed beside the check boxes assigns arpeggiator A or B to a Timbre 1 8 These settings are made in COMBI 7 Ed Arp Ctrls Setup page Assign p 96 Arpeggiator A Arpeggiator B For each arpeggiator A and B you can make set tings for Pattern Reso Resolution Octave Sort Latch Key Sync and Keyboard p 92 96 Checking the structure of a user arpeg gio pattern Let s see how arpeggiators of the combination is constructed 1 Select combination C053 Echo Jamm and look at the Arp Play A page and Arp Play B page i Play A Combi Select O53 Echo Jamm Arpeggiator Run IA HE l Fattern Uid Or Bigkeats 2
47. S 011u00 WNLEIY O O G6 0 C Oe GSW 8S1 NdY O x LOL OOL 125 Appendices Index A Alternate modulation 51 Amp 55 Amp EG 55 AMS 51 ARP ON OFF 91 Arpeggiator 91 Adjusting the tempo 92 Link 88 On Off 91 97 Arpeggio pattern 93 Initialization 99 User arpeggio pattern 99 ASSIGNABLE PEDAL 27 89 ASSIGNABLE SWITCH 26 88 Assigning aname 114 Audio output 25 AUDITION 38 Audition function 38 Bank Select 39 63 71 BPM MIDI Sync 86 Bypass 86 C Category Combination 58 Name 90 Program 38 Chain 83 Check box 15 ClickPoint 13 Combination 57 Bank 58 Category 58 Select 57 Combination mode 57 Compare 47 63 74 99 108 Connection 25 Computer 27 Control Track 70 Convert Position 33 126 Copying the settings of a combination multi set 72 D DAMPER jack 26 Damper pedal 26 41 Demo song 8 Detune 67 Detuned sound 49 Dialog 15 Display 15 119 Contrast 115 Double Program 48 Drum Kit 50 107 Bank 107 Edit 108 Effect send 110 Drum sample 108 Drums Program 48 Dual polyphonic arpeggiator 96 104 Dynamic modulation 85 Edit Buffer 118 Edit cell 15 Effect 79 EG 51 EG INTENSITY 44 EG RELEASE 44 Envelope Generator 51 Exclusive 33 Exclusive Group 109 External control 111 F Filter 53 EG 54 Keyboard Track 54 Fixed Note Mode 103 Foot pedal 27 42 Foot switch 26 39 42 G Global mode 87 H Half Damper 41 HI Hyper Integrated synthesis
48. a h92 irum p Prum E12 EB393 Ero E126 DB28 Elid ABDB Dark SunProphet Sterlingbusy Beilocd H Process Hard Darkombat ma A ia 2 Use the ClickPoint to highlight Program Select and use the VALUE dial etc to select a program You can use either of the following methods to select a program e Turn the VALUE dial e Press the center of the ClickPoint to highlight the field then use Y to select a program and press the center to finalize your selection e Selecting by Category p 38 Listening to the program sound of just one timbre Here s how you can listen to the sound of a single timbre by itself 60 1 Press the UTILITY button to access the utility menu 2 Use the ClickPoint A Y to choose Solo Selected Timbre and press the ClickPoint center Now you will hear only the program sound of the currently selected timbre The lower part of the display will indicate Solo Prog Program Select a asz Drum J brum Ent ctr 3 To cancel this setting choose Solo Selected Timbre once again and press the ClickPoint center Receiving MIDI program changes to switch timbre programs See Switching the program of a timbre via MIDI p 58 Note MIDI program changes only work for Timbres whose Status is set to INT Adjusting atimbre s pan and volume Adjusting the pan stereo position Here s how to adjust the pan o
49. a MIDI Start message will cause the arpeggiator to reset to the beginning of the pat tern This has no relation to the Key Sync setting 105 Arpeggiator settings 106 What is a Drum Kit Drum Kits as the name implies are optimized for creating drum sounds Drum Kits are created in Global Mode They offer a number of special fea tures such as e Each note can play a different sound e On each note you can use up to two Drum Samples with velocity switching e Each note has separate settings for the most important sound parameters including vol ume filter cutoff and resonance envelope attack and decay pitch e You can specify the insert effect routing and master effect send level for each note For example you can use this to send just the snare to a compressor You can use Drum Kits only in Programs whose Oscillator Mode is set to Drums Drum Kit memory structure The microxX has 49 Drum Kits divided into Inter nal User and GM General MIDI groups as shown below You can edit or write into any of the locations except for the GM bank which cannot be erased If you want to start with a GM bank drum kit and edit it use the Copy Drum Kit utility to select a drum kit and copy it to the USER bank Drum Kit banks wank No Contents USER 32 39 User initialized Drum Kits 40 48 GM2 Drum Kits Drum Kit Programsand Oscillator Mode The PROG 1 Ed Basic
50. a MIDI channel that matches the channel setting of a track the program will change if the Status of that track is INT However program changes for a track will also depend on the Program Change setting The Status setting is located in the MULTI 2 Track Param MIDI page and the Program Change setting is in the MULTI 3 MIDI Filter1 1 page If you ve installed the included microX Plug In Editor control plug in into your DAW software you can conveniently select the microX programs from a list within your DAW For more details see Editor Plug In Editor Manual PDF MIDI control from the microX s con trollers If the Status is INT or BTH playing the key board or operating the controllers on the Control Track will play control the microX s tone genera tor with the settings program level etc of the selected track and any other track set to the same MIDI channel will also sound at this time If the Status is EXT EX2 or BTH these messages will be transmitted on the MIDI channel specified for that track For more about the MIDI messages transmitted when you operate the microX s controllers and the AMS Alternate Modulation Source and DMS Dynamic Modulation Source that correspond to each MIDI message see MIDI transmission when the X50 microX s controllers are operated PG p 166 Other MIDI control For details on how the microX operates when tra
51. a preload user arpeggio pattern is selected setting the Gate or Velocity to Step will add a sense of groove to the arpeggio pattern Making the arpeggio pattern shuffle Swing Swing modifies the timing of the even num bered arpeggiated notes letting you give a shuf fle character to the pattern Editing in the PROG 7 Ed Arp Ctrls Scan Zone page e Access the PROG 7 Ed Arp Ctrls ScanZone page _ _ _ Key Btr C 1 Top EB Wel Btm 881 Top 127 tre Specifying the range of notes in which the arpeggiator will operate Key Btm Key Top Key Btm Key Top The arpeggiator will oper ate when you play keys within the specified range Keys outside of this range can be played in the normal manner and will not be affected by the arpeggiator on off For example if you set Pattern to Preset 0 UP check Latch set Key Top to B3 and Key Btm to C 1 playing a note B3 or lower will trig ger the arpeggiator Since Latch is on the arpeg gio will continue even after you release the keys You can use the C4 and higher keys to play con ventionally along with the arpeggio sounded by the B3 and lower keys To change the arpeggio play keys in the range of B3 and below Specifying the range of velocities in which the arpeggiator will operate Vel Btm Vel Top Vel Btm Vel Top The arpeggiator will oper ate when you pla
52. also want the effect settings of the combination to be copied check the With Effects check box 5 Specify the tracks of the multi set to which you want the eight timbres of the combination to be copied If you want to copy the settings of the combination to tracks 1 8 choose Track 1 to 8 If you want to copy them to tracks 9 16 choose Track 9 to 16 6 If you want the sound of the combination including its arpeggiator performance to be recorded on your external MIDI sequencer in order to reproduce the same sounds as when you were recording you should check the Auto adjust Arpeggio setting check box This will make adjustments to the MIDI channel and other settings of some tracks and add tracks as necessary to ensure that the arpeggio performance will be reproduced Depending on the settings of the combination you may need to make additional changes to the track settings Note This is available if you ve selected Track 1 to 8 In order to use the Auto adjust Arpeggio setting function the combination you re copying must have already been written with its ARP ON OFF button turned on 7 Press the MENU OK button to execute the copy 8 Set the Control Track to 01 72 In order to play the sounds and the arpeggiator in the same way as in Combination mode you must choose a track that is set to the global MIDI channel Play the keyboard and you will hear the same sounds as wh
53. and Fixed Note No Select Tone No and then set Fixed Note No to specify the note number that the tone will sound Here set Tone No and Fixed Note No as follows Fixed Note No w ea Ps F 3 closed hi hat A 3 open hi hat The drumsamples that correspond to each note number will differ depending on the drum kit After you ve used the keyboard to find the drum sound you want to use you can enter Fixed Note No Access the Edit page Each Tone in the display will be shown as a small circle For each horizontal line Tone in the display you will specify a drumsample note number of the drum kit Next we will input a rhythm pattern Creating a user arpeggio pattern Input the kick Tone00 Set Step Step No to 01 and press the center of the ClickPoint Enter Tone 00 Then set Step Step No to 05 and enter Tone 0 Input the snare Tone01 Set Step Step No to 03 and enter Tone 01 Then set Step Step No to 07 and enter Tone 01 Input the closed hi hat Tone02 Choose Step Step No 01 02 03 05 06 and 07 and enter Tone 02 for each of these steps Input the open hi hat Tone03 Set Step Step No to 04 and enter Tone 03 Then set Step Step No to 08 and enter Tone 03 Edit Press the MENU OK button If Mode Fixed Note Mode is set to Trigger
54. and name Parameter name Category number Tempo and name Tab ia Bank Program Program BCT number Category 12 MotionSynth Program H IN teller ts Select program maan repta J number and name Tab Knob B assign list 2 Make sure that Program Select program number and name is selected If this is not selected use the ClickPoint Y to highlight the Program Select indication 3 Use the VALUE dial etc to select the program you want to play CATEGORY AUDITION 1 4 PROGRAM PAGE PAGE 2 A B C D E GM A SLOWSYNTH FASTSYNTH LEADSYNTH MOTION SYNTH KEYBOARD GUITAR COMBINATION CATEGORY A B 3 COCOC lt lt BASS SE DRUMS ooo 5 lt MENU OK MULTI GLOBAL COMPARE UTILITY nnn You can use the following methods to select a pro gram e Turn the VALUE dial e Press the center of the ClickPoint to highlight the field then use A Y to select a program and press the center to finalize your selection 4 Press a PROGRAM A GM button to switch banks When you select a different Bank the button s LED will light and the selected bank will appear on the left side of the display 37 Playing and Editing Programs For example to select bank B press the PROGRAM B button The B button will light and the name Bank B will appear in the l
55. and thickness to any type of sound These are ideally suited for use with electric pianos strings guitars and so on In an ensemble pitch variations between instruments create a rich slightly warbling sound Essentially this gives the impression that a number of musicians are playing together The chorus effect simulates this In stereo performance the stereo image is widened thus creating a magnificent spatial ambience Flanger effects 20 St Flanger 22 St Env Flanger add unique characteristics to a sound Although similar to chorus a flanger uses a shorter delay time and feeds some of the output signal back into the effect creating a strong swell Flangers work very well on sounds that contain a lot of harmon ics as well as on distorted guitar sounds Phasers 23 St Phaser 25 St Env Phaser cyclically modulate the phase of the sound They are similar to the chorus and flanger effects in that both use modulation but the manner in which the tonal quality changes is different They are effective with electric piano guitars and synth sounds with a reasonable sustain Other modulation and pitch shift effects Rotary speaker effect 40 Rotary SP simulates the rotating speaker effect used in organs It is ideal for use with organ sounds but it will also create a unique effect with other sounds Pitch shifters 38 Pitch Shifter 39 PitchShift Mod shift the pitch of the input signal You can mix the pitch shift
56. arpeggio pattern ARP LENGTH 1 Press the REALTIME CONTROLS SELECT button to make the right C LED light 2 Turn the 3 ARP LENGTH knob to change the length of the arpeggio pattern At the center position 12 o clock the length will be the same as the arpeggiator s Lgth Length setting 7 Ed Arp Ctrls Setup page Turn the knob toward the left to shorten the pattern or toward the right to lengthen the pattern The arpeggio pattern will play repeatedly for the number of times specified by LENGTH Changing this value will change the character of the pattern Note This has no effect for the preset patterns UP DOWN ALT1 ALT2 RANDOM Saving your settings The ARP ON OFF button on off status together with the REALTIME CONTROLS knob and key settings are saved when you write the program combination or multi set Editing arpeggio settings that appear in the display You can make arpeggiator related settings in the PROG 0 Play Arp Play page or in the PROG 7 Ed Arp Ctrls Setup and Zone pages The 0 Play Arp Play page contains selected parameters taken from the 7 Ed Arp Ctrls Setup page that are particularly effective for editing during a per formance However parameters other than Swing can be controlled as described in Arpeg gio controllers p 91 Sort ClLatch r Keu Sync Keyboard F ul Est etr1l Arpeggiator features in Program mode Pattern SB
57. close e Ifthe utility menu is displayed press the EXIT CANCEL button to close the menu 5 Writing saving When you re finished editing you can save your changes if necessary For example if you ve edited a program your changed will be lost if you select another program or turn off the power The same applies to a com bination or multi set Settings you edit in Global mode will be remem bered as long as the power is on but your changes will be lost when you turn off the power For details on the Write operations see the follow ing pages Programs p 45 e Combinations p 61 e Multi sets p 75 e Global settings pages 0 3 p 90 e Drum kits p 110 e Arpeggio patterns p 104 External control p 112 e Saving data p 117 21 Introduction 22 Turning the power on off Connecting the AC adapter amp You must use only the included AC adapter Using any other AC adapter may cause malfunctions Note Make sure that the microX s power switch is set to STANDBY the outward position 1 Connect the plug of the included AC adapter to the power connector on the microX s rear panel 2 Connect the power cable to the AC adapter 3 Plug the power cable into an AC outlet 4 To prevent the plug from being pulled out accidentally wrap the AC adapter cable through the cable hook located on the rear of the microX Be careful not to bend the base of the plug unnecessarily C
58. dB octave low pass filter with resonance Low Pass amp High Pass This is a 12 dB octave low pass filter and a 12 dB octave high pass filter connected in series 2 If you ve selected Low Pass Resonance as the filter type you can set the parameters for Filter Frequency specifies the cutoff frequency Overtones above the specified cutoff frequency will be diminished making the tone more mellow darker 53 Playing and Editing Programs Resonance specifies the resonance level This boosts the overtones in the region of the specified Frequency giving the sound a distinctive character PROG d Ed Filter Basic Filter1 Type Frequencd 23 Reso AHS Sl 2 W1 Resonance 55 Intensity 83 zs nigi rem r Bozie Wedd IMede Utero E J SSS If you ve selected Low Pass amp High Pass as the filter type you can use the Filter A parameters to adjust the low pass filter and the Filter B parameters to adjust the high pass filter Overtones above the Filter A Frequency will be diminished making the sound more mellow darker Overtones below the Filter B Frequency will be diminished decreasing the low range and making the sound thinner PROG A T a Basic Filter1 Type Filteri Tupe MIRE EE ii a MH E Frequency 29 Rpp RRN I OE Frequency B bosie WMedt Mode e E S s P Rus RLEY HEY pa I paig i Modulating the filters You can modulate the filter cutoff fr
59. different modes A B and C allow each knob to control one of three separate parameters The REALTIME CONTROLS 1 4 knobs can transmit MIDI messages as specified by the exter nal control setup to your external MIDI equip ment If you turn the EXT CONTROLLER button on lit these knobs will be switched to the external control function and will be disconnected from the internal sound generator For more about external control see External control settings p 111 1 Press the REALTIME CONTROLS SELECT button to switch the function of the realtime controllers to A mode B mode or C mode Each time you press the button A mode B mode or C mode will be selected alternately and the corresponding LED will light 43 Playing and Editing Programs Note If CC 70 79 are assigned to REALTIME CONTROLS A mode or B mode the sound edited by knobs 1 4 can be saved by the Program Write operation r p 45 SELECT button pO 1 SELECT A IPFCUTOFF RESONA QD 5 Assicnasie AssG C ARP GATE ARP V 2 3 4 i ROR WAN OKOLO Knobs 1 4 2 Rotate the desired knob to control the sound etc See the explanations that follow A mode controls In A mode knobs 1 4 will control edit the fol lowing functions Note Placing the knobs in the center 12 o clock position will produce the values specified by the program parameters Knob 1 LPF CUTOFF Adjust the cutoff frequency of the
60. interface and connect the microX via its MIDI connec tors Operating requirements for the KORG USB MIDI Driver and the edi tor software Contents of the CD ROM L microX Editor Plug In Editor for Windows XP Mac OS X KORG USB MIDI Driver for Windows XP Mac OS X L microX External Control Template L Parameter Guide PDF LI Editor Plug In Editor Manual PDF L microX External Control Template List PDF L Software License Agreement PDF Please note before use Copyright to all software included in this prod uct is the property of Korg Inc e The license agreement for this software is pro vided separately You must read this license agreement before you install this software Your installation of this software will be taken to indicate your acceptance of this agreement KORG USB MIDI Driver operating requirements Windows e Computer A computer with a USB port that satisfies the requirements of Microsoft Windows XP 27 Setup Operating system Microsoft Windows XP Home Edition Professional or x64 Edition The driver for x64 Edition is a Beta version Macintosh Computer An Apple Macintosh with a USB port that satisfies the requirements of Mac OS X e Operating system Mac OS X version 10 3 or later amp Please be aware that in the case of some computers the system may not function correctly even if your computer meets the above requirements microX Editor Plug
61. low pass filter When you adjust the cutoff frequency of the filter the brightness of the sound will change The effect will depend on the settings of the program param eters but normally rotating the knob toward the left will darken the sound and rotating it toward the right will brighten it Level LPF Frequency Low Cutoff High frequency lt gt Knob 2 RESONANCE HPF Adjust the resonance level of a low pass filter or the cutoff frequency of a high pass filter The content that is controlled will depend on the filter type specified by the program By adjusting the filter resonance level you can increase or decrease the resonance level to add a unique character to the sound 4 4 Adjusting the cutoff frequency of the high pass fil ter will modify the thickness of the sound from which the low frequency range has been filtered out Level Cutoff frequency lt gt Knob 3 EG INTENSITY Adjust the filter EG intensity the depth at which the filter EG is applied Rotating the knob will affect the depth of the filter EG Normally rotating the knob toward the left will make the filter EG apply less deeply and rotating it toward the right will make the filter EG apply more deeply Since the filter EG will operate based on the cutoff frequency of the filter knobs 1 and 3 will work together to control the tonal changes produced by the filter Level Time Knob 4 EG RELEASE Adju
62. lt to select Category No in the top line of the category menu and then turning the VALUE dial Selecting programs Using a footswitch to select Pro grams You can assign a footswitch to step through Pro grams one by one either going up 0 1 2 3 etc or going down 3 2 1 etc This lets you change Programs without using your hands great for quick Program changes in live performance situations To set this up 1 Connect a foot switch to the rear panel ASSIGNABLE SWITCH jack Use a simple on off footswitch such as the optional KORG PS 1 Press the GLOBAL button to enter Global mode 3 Press the EXIT button to access the GLOBAL 0 System page N 4 Press the PAGE button to access the Foot tab Foot Foot Sl assign Foot Sh Assign Program Up Foot Pedal Assign Off KORG Standard C KORG Standard Damper Polarity Foot SW Polarity Eoin j Erer M Foot J O 5 Select Foot SW Assign and specify either Program Up or Program Down Program Up lets you select the next higher program number each time you press the foot switch Program Down lets you select the next lower program number each time you press the foot switch 6 Set the Foot SW Polarity to the polarity of the pedal you ve connected If you ve connected a separately sold PS 1 pedal switch choose the KORG Standard setting With these settings you will step through the prog
63. makes the pitch change smoothly when you play the next note before releasing the previous note The Time parameter controls how long it take the pitch to change As this value is increased the 52 pitch will change over a longer time With a value of 000 there will be no portamento Creating Vibrato You can use an LFO to create vibrato LFO 1 2 Intensity sets the depth to which the selected LFO will affect the pitch With a setting of 12 00 vibrato will produce a maximum of 1 octave of pitch change JS Y Int specifies the amount of vibrato that the LFO will produce when the joystick is pushed away from yourself AMS Intensity specifies the depth of the vibrato effect created by LFO when you operate an AMS Alternate Modulation Source For example sup pose you set LFO1 AMS to KnobM1 Knob Mod1 CC 17 and raise the AMS Intensity If Knob B Assign Knob 1 B is set to Knob Mod 1 CC 17 vibrato will be applied when you turn the microX s knob 1 or when CC 17 is received PROG Ed Pitch O5C1 LFO LFO1 Intensity Pitch LF0172 Modulation AME Enobiii E TE Jary nt taeda intensity 188 18 LF02 intensity 06 05 AMS HIDI AFterT J54 Int 86 00 Intensity 88 80 021 Nostell osce a Pitch EG When the Intensity value is set to 12 00 the pitch EG specified in the Pitch EG page will produce a maximum of 1 octave of pitch change To realistically simulate the s
64. mode two arpeggia tors can operate simultaneously In this case if you start an arpeggiator whose Key Sync is unchecked while the other arpeggiator is already running the arpeggiator you started will synchro nize to the J Tempo based on the timing of the already running arpeggiator Note If Key Sync is checked A and B will each operate on their own timing Synchronization with an external sequencer in Program Combination or Multi modes When the microX is the master If J Tempo is INT the arpeggiator will operate based on the timing of the internal MIDI clock Tempo will be INT if GLOBAL 1 MIDI MIDI Clock is Internal The tempo will also be INT if the Auto setting is selected and MIDI clock is not being received from an external device When the microX is the slave If J Tempo is EXT the arpeggiator will syn chronize to the MIDI clock and Start messages etc received from the external MIDI sequencer or sim ilar device Tempo will be EXT if GLOBAL 1 MIDI MIDI Clock is Ext MIDI or Ext USB The tempo will also be EXT if the Auto setting is selected and MIDI clock is being received from an external device Synchronization to external MIDI clock The arpeggiator will synchronize to the J Tempo based on the timing of the external MIDI clock Synchronization to the MIDI Start mes sage e When the arpeggiator is on and operating receiving
65. numberand name Tab Control assign list 2 Make sure that Combi Select combination number and name is selected If this is not selected use the ClickPoint A Y to highlight the Combi Select indication 3 Use the VALUE dial etc to select the combination you want to play PROGRAM P PAGE A B c D E GM 5 A m SLOW SYNTH FAST SYNTH LEAD SYNTH MOTION SYNTH KEYBOARD GUITAR IN A COMBINATION i 3 a a CC OCO BASS SE DRUMS EL MENU 0K MULTI GLOBAL COMPARE ee ss You can use either of the following methods to select a program e Turn the VALUE dial 57 Playing and Editing Combinations e Press the center of the ClickPoint to highlight the field then use A Y to select a program and press the center to finalize your selection 4 Press a COMBINATION A C button to switch banks When you select a different Bank the button s LED will light and the selected bank will appear on the left side of the display For example to select bank B press the COMBINATION B button The B button will light and the name Bank B will appear in the left of the display Auditioning the sound 5 Play a note on the keyboard to hear the sound you selected Note You can t use the AUDITION button to play a riff phrase in Combination mode Overview Combination Banks When shipped from the factory it is
66. program combi nation multi set category arpeggio pattern etc The following table shows the items that you can rename and the corresponding page PROG 0 9 Utility Write Program TO COMBI 0 9 Utility Write Multi set name MULTI 0 1 Utility Rename Track MULTI 0 9 Utility Write Multi GLOBAL 4 Utility Rename Drum GLOBAL 5 Utility Rename Arpeggio pattern name Arpeggio Pattern External control set GLOBAL 5 Utility Rename name Ext Control Setup Program category name GLOBAL 3 TEXT Combination category GLOBAL 3 TEXT name l 1 Use the ClickPoint to select the text button W and press the center to open the text dialog box See the table above for the appropriate page Note Ina utility menu command select the text button in the dialog box that appears In GLOBAL 3 select the text button WW in the page The text dialog box will appear I HENGT Jkt 0123456789 Z MABCOEFGH JIKLMNOPOGRS TUUMAY2 DVI abode tgh ijk Tmropars tuvwny2d po For example to enter the text shown in the illustration you would proceed as follows 2 Use the ClickPoint lt 4 gt Y to select Clear All text will be erased from the text box 3 Enter A Use the VALUE dial to select A Press the ClickPoint gt The cursor will move 114 5 You can enter text using just the ClickPoint When you press the ClickPoint center the square framed cursor in the text bo
67. programs by categories such as piano or drums r p 38 Selecting combinations by using a foot switch You can change combinations even while both hands are busy playing on the keyboard convenient for live applications Selecting combinations by receiving MIDI program changes You can switch combinations from an external MIDI sequencer or an external MIDI controller See below for details controller filtering and so on As with Programs each Combi has 1 Insert Effect 2 Master Effects and a Master EQ for shaping and transforming the sounds of the individual Tim bres Finally Combis can use 2 Arpeggio patterns modules at once Selecting combinations from the front panel 1 Press a COMBINATION A C button The button will light You will enter Combination mode and the bank you specified will be selected Notice that the upper line of the display indicates COMBI 0 Play mode name page number and name The bank number you specified is shown below COMBI 0 Play Modename Page number and name Parameter name Category number Tempo and name Tab name Balik COMBI O F1 Combi t Combi Select number OMmpination Combi Select Bank Category 13 Complex amp SE dJ B932 Combi ma Groovy Monsters G THTUDREFy CTTIPEEy noob SE meno d eu Select com I s r bination Knob Mod knob Mod 2 Knob Mod 5 Knob Modd tombi M Froa JL Mis I Arp A J arp EJ Ert Ctrll
68. select the Arp A or the Arp B page and uncheck the Arpeggiator Run check box 6 To modify the name of a user arpeggio pattern use the Utility Rename Arpeggio Pattern p 114 7 If you wish to save the edited user arpeggio pattern in internal memory you must write the user arpeggio pattern In this case both user arpeggio patterns will be written simultaneously If you turn off the power without writing the edited contents will be lost 104 8 If you wish to save the state of the combination at the same time return to Combination mode and write the combination p 61 Note When editing a user arpeggio pattern pay attention to the global MIDI channel the channel of each track and the arpeggiator assignments and make sure that the arpeggiator you are hearing is the pattern that you wish to edit Assigning aname We recommend that you assign a name to the arpeggio pattern you create You can do this by using the Rename Arpeggio Pattern utility For details on assigning a name see p 114 Saving a user arpeggio When you re finished editing you should save the user arpeggio The Tempo Pattern Octave Resolution Sort Latch Key Sync and Keyboard set tings of a user arpeggio pattern are parameters that are saved together with the program combi nation or multi set These parameters are not saved by the Write operation described he
69. set ting the arpeggio pattern will always play the specified pitches regardless of the note numbers received from the keyboard p 102 The A Key Btm and Key Top COMBI 7 Ed Arp Ctrls Scan Zone page are set so that arpeggiator A will operate only for notes B3 and lower Arpeggiator A is also assigned to T5 but this is so that the T4 program Trance GarageKit will sound only when the arpeggiator is on Notice the timbre settings for T4 and T5 status MIDI Channel Assign u m 2 A 02 e Ifthe arpeggiator is off playing the keyboard will sound the timbre s that are set to Gch or to the global MIDI channel in this case 01 Since the MIDI Channel of T4 is set to 02 it will not sound T5 is set to Gch but since Sta tus is Off it will not sound e Any MIDI channel that is assigned to a timbre will trigger the arpeggiator In this case these will be MIDI Channel 02 and Gch global MIDI channel When the arpeggiator is on playing the keyboard will trigger arpeggiator A which is assigned to T5 Gch T4 will be sounded by arpeggiator A Since the Status of T5 is Off it will not sound e Since the Status of T5 is Off it will not sound regardless of whether the arpeggiator is on or off Itis a dummy timbre that causes T4 to sound only when the arpeggiator is on 98 Combination B071 In The Pocket Select and play combination B071 In The
70. set to Tap Tempo p 88 several times at the desired tempo to control the playback tempo in realtime This function is convenient when you want to match the playback tempo of the arpeggiator play back to another beat in real time The Tap tempo feature also provides real time control over any BPM or tempo based effects The following example shows the procedure for using Tap tempo in Program mode 1 In Program mode select a drum program You may find it convenient to choose from the Drum category 2 In the PROG 0 Play select the Arp Play page and check the Latch check box 3 Turn on the front panel ARP ON OFF button 4 Press the foot switch when Foot SW Assign is set to Tap Tempo several times at the desired tempo The tempo J indication in the upper right of the display will change according to the playback tempo When you play the keyboard the arpeggiator will play a drum pattern at the specified tempo 5 Lightly press the foot switch on the beat and slightly shorten the intervals at which you press the button The playback tempo of the drum pattern will speed up slightly Note Tap tempo control can be used whenever the TEMPO knob can be operated 115 Other functions 116 Appendices Saving data Types of data that can be saved You can save data in the following ways e Write the data into the microX e Save the data using the included microX Edi to
71. steps of one octave Note You can t use the AUDITION button to play a riff phrase in Combination mode Selecting combinations by category In Combination mode you can select combinations by category just as in Program mode For the procedure see Using the CATEGORY and PROGRAM COMBINATION buttons to select a category amp p 3 Using controllers to modify the sound You can operate the microX s joystick OCTAVE Y A and realtime controllers to add expres sive variation to your performances J oystick You can use the joystick to vary the pitch or adjust the depth of modulation The actual result will depend on the program and combination but these controllers are normally used to apply the following effects Y Deepen the vibrato ONET aoe pitch Mirar mili pitch 1 Deepen the wah effect OCTAVE You can use the OCTAVE YV A buttons to shift the pitches assigned to the keyboard in one octave steps over a range of 3 octaves Y OCTAVE A Quick Start REALTIME CONTROLS 1 2 3 4 SELECT Use the SELECT button to select realtime controller mode A B C and use knobs 1 4 to control the tone effects MIDI control changes and arpeggiator etc while you perform Use these knobs when you want to modify the sound while performing or to make simple edits SELECT button REALTIME CONTR 1 2 3 4 2 3 4 I N _ LPF CUTOFF RESONANCE HPF EG INTENSITY EG RELEA
72. the MIDI Channel of timbres 1 4 to Gch COMBI 27 Ed TimbreParam MIDI tatus ra Bass El Pir Elr4eti ae Mati Gch T Gch ss Tad Bag 4 Set J Temp to specify the tempo This is the same as for a program r p 92 However the tempo is shared by both arpeggiators A and B 5 Make Assign settings Assign arpeggiator A or B to the desired timbres Each timbre will be played by the arpeggiator that has been assigned to it Make Arpeggiator Run settings Check the arpeggiator s that you want to operate The arpeggiator s checked here will run when the ARP ON OFF button is turned on With the settings shown in the display for steps 2 and 3 turning the ARP ON OFF button on will cause arpeggiator A to operate for timbres 1 and 2 and arpeggiator B to operate for timbre 3 When the ARP ON OFF button is turned off timbres 1 4 will sound as a layer If all timbres Assign are Off or if neither Arpeggiator Run A or B is checked the arpeggiator will not function Inthe Arp A and Arp B pages set the parameters for arpeggiators A and B The parameters for A and B are the same as for a program t p 92 In the Scan Zone page specify the range in which arpeggiators A and B will operate The parameters for A and B are the same as for a program t p 94 You can use keyboard ranges or playing velocity to operate the arpeggiator or to switch betwe
73. the Status of the track is EXT EX2 or BTH the corresponding MIDI messages will be transmitted on the MIDI channel that is specified for that track Receiving MIDI data from an external sequencer to play the microX By default the microX s tracks 1 through 16 are set to MIDI channels 1 through 16 with track 1 receiv ing channel 1 track 2 receiving channel 2 and so on 1 To hear the track 1 whose MIDI Channel setting is 1 transmit performance data MIDI note on off messages from your external MIDI sequencer on MIDI channel 1 If the Status is INT or BTH the microX s tone generator will sound If the Status is Off EXT or EX2 the microX s tone generator will not sound Silencing a specific track Mute The microX provides a Mute function that lets you temporarily silence the desired track s 1 16 For example you can use this to listen only to the rhythm section while you record a new track You can also use this function to modify the structure of the song 1 Access the MULTI 0 Play Program page 2 Select the PLAY MUTE and press the ClickPoint center Each time you press the PLAY and MUTE settings will alternate If MUTE is selected this track will not produce sound even if it receives note data from the microX s keyboard or from an external device qeata ETH itt BiG Eat ctr AEI E28 SPER Kit 1 Frog z Frog Ael Hing I Note The mute setting of each track wi
74. the overall pitch Edit this setting when you are playing the microX with other instruments or when playing along with music on CD or tape You can adjust the pitch in a range of 50 cents one semitone 100 cents If this is at 0 middle A is tuned to 440 Hz Key Transpose shifts the pitch in semitone steps Edit this setting when you want to transpose the sound of the entire microX You can adjust the transposition in a range of 1 octave Adjusting the way in which velocity will affect the volume or tone You can adjust the way in which changes in veloc ity will affect the volume or tone by selecting dif ferent velocity curves Each curve has its own character so you can select the curve that is appro priate for your own playing dynamics playing style and the effect that you wish to obtain PG p 76 Velocity Curve selects the velocity curve Bypassing the effects If the FX SW TEX Off MFX1 Off and MFX2 Off boxes are checked the insert effect master effect 1 and master effect 2 will respectively be bypassed This applies to the entire microX regardless of the mode For example if you ve connected the microX s outputs to an external mixer and are using an external effect processor to apply reverb or chorus to the sound you can turn off the microX s master effects 87 Global Mode Linking the arpeggiator to programs and combinations You can specify whether the arp
75. these multi sets in the microX Tracks 1 16 consist of the following setting parameters and will transmit and receive the performance data listed below MIDI tracks 1 16 Setup parameters Bank Program No Pan Volume Status MIDI Channel Bank Select When Status EX2 Force OSC Mode OSC Select Portamento Transpose Detune Bend Range OSC On Off Ctrl Delay Use Program s Scale MIDI Filter Key Zone Veloc ity Zone Track Name IFX Indiv Out BUS Select Send1 MFX1 Send2 MFX2 Performance data Note On Off Program Change including Bank Select Pitch Bend After Touch Poly After Control Change Exclusive Message Tempo You can record tempo as performance data by adjusting it while you realtime record onto an external MIDI sequencer By receiving this data you can change the setting of the multi set during the playback You can use performance data MIDI RPN data to change the settings of a multi set during play back Other parameters By editing the settings during realtime recording you can record the corre sponding MIDI exclusive messages as perfor mance data on your external MIDI sequencer This gives you a way to change the settings of the multi set during playback GLOBAL 1 MIDI MIDI Fil ter Exclusive must be checked e For details on Control Change messages and RPN PG p 172 175 For details on MIDI System Exclusive messages PG p 176
76. to transmit These two settings determine the CC and MIDI channel of the message that is transmitted when in Program mode etc you select this external control setup use the SELECT button to select group A and operate knob 1 Next make settings for Knob 2 A through Knob 4 A and then use the SELECT button to select groups B and C and specify the channel and message transmitted by Knob 1 B Knob 4 B and Knob 1 C Knob 4 C Assigning aname It s a good idea to name any external control set ups that you create so that you can remember its purpose Use the Rename Ext Control Setup utility to assign a name For more details see page 124 112 Saving an external control setup When you ve finished editing save your external control setup Note You ll need to turn off external control memory protect In the GLOBAL 0 System Preference page uncheck the Memory Protect Ext Control item p 88 1 Press the UTILITY button to access the utility menu and choose Write Ext Control Setup To write Save your settings press the MENU OK button A dialog box will ask you to confirm that you want to write the settings Press the MENU OK button to write your settings or press the EXIT CANCEL button if you decide not to write your settings Other functions Restoring the factory set tings Loading the preloaded data If desired you can restore the mi
77. to A and JS Y Int to B specify the depth of the wah effect created by the LFO when you move the joystick toward yourself or when CC 2 is received The AMS setting selects a AMS modulation source to scale the amount of the LFO applied to Filters A and B The two filters share a single AMS source with separate intensity settings For example if you set Knob B Assign Knob 1 B to Knob Mod 1 CC 17 and set AMS to Knob M1 17 you can turn the REALTIME CONTROLS B mode knob 1 to apply an auto wah effect PROG di Ed Filter1 LFO Mod LFoOi Int to A Filter tro stn LFO intensity to H t H AME F J5 Int to A 16 to B 06 iint to A 88 B 08 Using the Amp section PROG 6 Ed Ampi 2 Level Pan Ampi Level Pan Pan Coed i AMS Of Shee Gt Getties i Intensity 08 AMS modulation In addition to the EG LFOs and Key Track you can use two AMS sources to modulate the filters For instance you could use the joystick to change the brightness PROG 4 Ed Filter1 Filter Modulation Mod 2 Filter A AMS 4 Intensity 38 tensity 16 Intensity 68 Intensity 68 Using the Amp section The Amp section includes controls for volume and pan You can control the volume using the Amp EG LFO 1 2 Keyboard Track and velocity along with other AMS sources Each Oscillator has its own Amp section Amp1 for OSC1 and Amp2 for OSC2 Different sounds have characteristic sh
78. to something other than Gch These will be timbres that play only when arpeggiator is on a very useful technique for creating arpeggiator utilized combinations For more details see The arpeggiator in Combination and Multi modes p 95 In particular note the relationships between arpeggiator assignments and MIDI Channel 63 Playing and Editing Combinations MIDI filter settings Here you can specify whether the MIDI data sent and received by timbres 1 8 will be filtered COMBI F Ed HIDI Filter 1 Progr ar iE si Nz oo Ee Eee ace ea SAS lt pase If a check box is checked the corresponding MIDI data can be sent and received If Status is INT movements of the microX s controllers or incom ing MIDI data will apply an effect for the program of that timbre Effect Dynamic Modulation func tionality is not affected by these settings If the Status is EXT or EX2 movements of the microX s controllers will transmit MIDI data on the channel of that timbre MIDI transmit receive settings for the entire microX are made in MIDI Filter GLOBAL 1 If a check box is unchecked the corresponding MIDI data will not be sent or received As another example let s say that you ve selected a bass Program for Timbre 1 and a piano Program for Timbre 2 with the goal of creating a bass piano split You could make the following settings so that pressing the damper pedal
79. when you operate microX are transmitted on the global MIDI chan nel At the same time timbres whose Status is EXT or EX2 will transmit the same messages on their own MIDI channel For details on the MIDI messages transmitted when you operate an microX controller and on the AMS Alternate Modulation Source and DMS Dynamic Modulation Source corresponding to the MIDI messages see MIDI transmission when the X50 microX s controllers are operated PG p 166 59 Playing and Editing Combinations Simple combination editing You can edit any of the Combinations shipped with microX or you can start with an initialized Program to create sounds from scratch On the microX you can use the edit of COMBI 0 Play page and the realtime controller knobs and switches of the front panel to make simple changes to a program without having to enter the editing pages that contain the detailed editing parameters Changing the programs within the Combination Changing the Program assigned to each timbre 1 8 is a quick way to dramatically alter the sound of the Combination Note You can make the following settings from either the COMBI 0 Play page or the 1 Ed Tone Adjust page Selecting programs from the front panel and LCD To change the Program assigned to a Timbre 1 Access the COMBI 0 Play Prog page This page shows information about the programs assigned to Timbres 1 8 Prog Program Select
80. will move between pages in the order of 0 Play gt 1 Ed Tone Adjust lt gt 2 Ed Track Parameter lt gt 3 Ed MIDI Filter1 lt gt etc The page that appears will be the page of the tab you selected most recently EXIT CANCEL button e You can press the EXIT CANCEL button to return to page 0 from any page Selecting tabs PAGE PAGE buttons You can press these buttons to move forward or backward in steps of one tab 1 Press the PAGE button to access the page for the next right tab Press PAGE button to access the page for the previous left tab This example shows the Combination page through Prog page of COMBI 0 Play 20 D10868 EB12 EB99 EB73 E126 Doza Elid RB6 Dark Sunbrophet Sterlingeusy Egila H PFrocazsi Hard DorHombat Cape Tent ctr 2 As you repeatedly press the PAGE button or PAGE button you will move consecutively through the tabs As you page up past the last tab of a page you will then move to the first tab of the next page Likewise as you page down past the first tab of a page you will then move to the last tab of the preceding page 3 Selecting a parameter and editing the value 1 Use the ClickPoint lt 4 A Y to select the parameter you want to edit The value will be highlighted and the parameter name is displayed in the upper right of the display We call this the edit cell 2 To modify the valu
81. 15 the selected command or page will appear Pressing the Click Point center on a check box will switch the item on off Pressing the ClickPoint center on a button such as OK or CANCEL will confirm the corre sponding choice MENU OK button Press this button to access the page menu p 19 By holding down the MENU OK button and pressing the PAGE button or PAGE button you can move forward or backward in steps of one page If a dialog box is open this button will confirm the settings in the dialog box and close it This is the same function as the OK button EXIT CANCEL button When you are in a page other than 0 of each mode you can press this button to move to page 0 of that mode If you press the EXIT CANCEL button while pressing the ClickPoint center the selected value will be reset to 0 or the minimum value When a dialog box is open this button will cancel the settings made in the dialog box and close the dialog box corresponds to the Cancel If a Util ity menu or page menu is open pressing EXIT CANCEL button will close the menu 11 UTILITY COMPARE UTILITY button Press this button when you want to use the utility functions p 21 COMPARE button Use this button when you wish to compare the sound of the program combination or multi set that you are currently editing with the un edited sound that was written into memory p 20 12 OYSTICK This controls pitch or modu
82. 89 effect types The master EQ is a stereo three band EQ ARPEGGIATOR A program can use one arpeggiator You can select an arpeggio pattern specify the range in which the arpeggio will be generated and specify the range of notes keys and velocities that will trig ger the arpeggiator Overview of editing pages In the PROG 0 Play page you can select and play programs and use the performance editor or real time controllers to make simple edits to the sound You can also adjust the arpeggiator settings The other pages let you modify the sound in more detailed ways e Select and play programs e Use the Performance Editor for easy editing and to do simple editing of arpeggio patterns Select an external control set Specify the program type as Single Double or Drum Select multisamples e Specify Mono or Poly voice assignment e Select the temperament e g equal temperament e Pitch settings Pitch EG settings e Type and speed settings etc for the two LFOs provided for each oscillator Make settings in the pitch filter and amp pages to specify the depth of the LFO settings you make here 1 Ed Basic 2 Ed Pitch 3 Ed LFOs 4 Ed Filter1 Filter tone settings Filter EG settings 5 Ed Filter2 e Settings related to Amp 1 2 volume including amp EQ and pan stereo position 6 Ed Amp1 2 e Arpeggiator settings Shared with 0 Play parameters You may edit either e Contro
83. Assign Programs to each of the 16 MIDI Tracks each with separate volume pan EQ and keyboard and velocity zones make settings for effects and two Arpeggiator p 69 Global mode Global mode lets you make overall settings for the entire microX and edit arpeggiators drum kits and external control sets For instance you can Make settings that affect the entire microx such as master tune and global MIDI channel e Create user drum kits arpeggiators user scales and external control sets e Rename program and combination categories e Set the function of the assignable pedals and assignable switches Make settings for the external control function p 111 Transmit MIDI System Exclusive data dumps 17 Introduction PROGRAM MODE Insert Master Effect IX MFX1 Multi Sample H Multi Sample L Arpeggiator FILTER2 PITCH2 GLOBAL MODE COMBINATION MODE Insert Master Effect DRUM KIT TIMBRE 1 PROGRAM Ke ee Drum Sample Sample H TIMBRE 2 PROGRAM Drum Sample Sample L TIMBRE 3 PROGRAM TIMBRE 4 PROGRAM TIMBRE 5 PROGRAM ARPEGGIATOR PATTERN TIMBRE 6 PROGRAM User Pattern Preset 0 4 TIMBRE 7 PROGRAM User Pattern U000 250 TIMBRE8 PROGRAM MULTI MODE TRACK 1 PROGRAM TRACK 9 Insert Master Effect TRACK 2 PROGRAM TRACK 10 PROGRAM TRACK 3 TRACK 11 PROGRAM Arpeggiator A Arpeggiatpr B 18 Basic operations Basic operations After you ve
84. Bae ie eel ae u Octave 1 Gate Step Sort r Ku Syre Reso F Velocity Key CiLatch Keyboard Swing 0608 Editing in the PROG 0 Play Arp Play page e Access the PROG 0 Play Arp Play page Selecting an arpeggio pattern Pattern An arpeggio pattern can be selected from preset arpeggio patterns Preset 0 Preset 4 and user arpeggio patterns U000 250 With the factory set tings U000 250 contain a wide variety of preload user arpeggio patterns e Use the ClickPoint to select Pattern and use the VALUE dial to select an arpeggio pattern The way in which the pattern is played will depend on settings such as Octave and Sort Preset 0 Preset 4 in the following diagrams show how the arpeggio will be played when Octave is set to 1 and Sort is checked Preset 4 RAN DOM is one possibility Preset 0 UP Preset 1 DOWN Ty Preset 2 ALT1 ALTI Se Preset 3 ALT2 Preset 4 RANDOM noon F U000 U250 With the factory settings various arpeggio pat terns are preloaded These include a variety of pat terns such as drum or bass phrases or guitar or keyboard backing riffs Changing the timing value of the arpeg giated notes Resolution Use Reso Resolution to specify the spacing between the arpeggiated notes in a range of Ss J e Use the ClickPoint to select Reso and then
85. CANCEL y MENU OK MULTI GLOBAL COMPARE UTILITY 1 Press one of the PROGRAM A GM buttons The button will light You will enter Program mode and the bank you specified will be selected Notice that the upper line of the display indicates PROG 0 Play mode name page number and name Mode name Page number and name Parameter name Category number and name Tab name Tempo Bank PROG HdE Program Program Select number I Bank Category 12 Motionsynth AJ 148 Program 000 Kombat raat Pinot e CEREN CLENY GEEN program Enab Mod 1 knob Mod z Knob Mod 3i Krob Mod number roaro FEAE I Are 1 and name Tab Knob B assign list 2 Make sure that Program Select program number and name is selected If this is not selected use the ClickPoint A Y to highlight the Program Select indication Playing programs and combinations 3 Turn the VALUE dial to select the program you want to play You can also press the center of the ClickPoint to highlight the field then use A Y to select a program and press the center to finalize your selection 4 Press one of the PROGRAM A GM button to switch banks When you select a different Bank that button s LED will light and the selected bank will appear in the left side of the display For example to select bank B press the PROGRAM B button The B button will light and the name Bank B will appear in the left of
86. Double set the Amp1 Pan to L001 and the Amp2 Pan R127 This will make OSC1 go to the left speaker and OSC2 go to the right speaker With a setting of Random the pan will change randomly each time you play a note on microx producing an interesting effect Pan AMS and Intensity Intensity specifies the depth of the pan modula tion from the selected AMS source If you set AMS to Note Number the pan will change according to the keyboard position of each note played With a setting of LFO1 or 2 the sound will sweep from side to side creating an auto pan effect Pan Use DKit Setting Use DKit Setting applies when Oscillator Mode is set to Drums 56 If this is checked the Program can use a different pan position for each drum sound as specified by the Drum Kit If this is unchecked all drum sounds will use the Program s pan position The factory presets and GM drum kits use individual pan positions for the different drums so normally it s best to leave this checked s AMS Off Else DKit Setting Intensity 08 Effects Effects are covered in their own section of the manuals so we won t go into too much detail here p 79 Insert Effect You can make insert effect settings in the PROG 8 Ed InsertFX page The Insert Effect can be assigned to either an indi vidual oscillator or the entire Program You can use any type of effects from distortions and com pressors to chor
87. E CONTROLS 1 2 3 and 4 knobs to transmit these MIDI messages to an external MIDI device 12 5 MODE BANK Select Use these buttons to select banks and enter modes The microX has four modes p 19 PROGRAM A B C D E GM but ton COMBINATION A B C button GLOBAL button MULTI button 6 Display You can select a page tab or parameter in the dis play and specify its value p 15 7 CATEGORY You can select programs multisamples combina tions timbre track programs effects or drum samples by category CATEGORY button Press this button to access the category menu and choose a program etc from the list The category menu will appear if you have selected an appro priate mode page or parameter 1 p 38 45 82 108 8 AUDITION Demo Song Player AUDITION button In Program mode when you press the AUDI TION button the button will light a riff phrase appropriate for the preloaded or preset program will play This is called the Audition function To stop auditioning press the AUDITION button once again Demo song player When you hold down the CATEGORY button and press the AUDITION button the Demo Song Player page will appear Select a song and press the AUDITION button to begin playback Press the AUDITION button once again to stop playback To exit from this mode press the EXIT CANCEL button s p 8 9 VALUE controller The VALUE
88. ENU OK button GLOBAL 3 Arp Pattern Edit Step No Oo ON SD Qi 11 When you play the keyboard as shown in the illustration the arpeggiator will begin playing Tone 0 corresponds to the pitch of the lowest key of chord you play on the keyboard If Sort is unchecked it will correspond to the pitch of the first note you play 12 For steps 01 08 make settings for Ptch Pitch Offset Gt Gate Vel Velocity and Flam Ptch Pitch Offset This offsets the pitch of the arpeggio note in semitones up or down You can input the same tone for each step and change the Ptch Pitch Offset value for each to create a melody using a single tone Melody pattern Gt Gate Specify the length of the arpeggio note for each step With a setting of LGT the note will continue sounding either until the next note of the same tone or until the end of the pattern With a setting of Off the note will not sound Vel Velocity Specify the strength of the note With a setting of Key the note will sound at the strength with which it was actually played Note The Gt Gate and Vel Velocity settings you make here will be valid if the Gt Gate and Vel Velocity parameters PROG 7 Ed Arp Ctrls Setup page of the program selected in Program mode are set to Step If these parameters have a setting other than Step the Gt Gate and Vel Ve
89. Gt Gate Vel Velocity and Flam To change the step use the ClickPoint to select Step Step No and then use the VALUE dial to select the desired step In this page you can use the ClickPoint lt 4 to move between steps Tone At each step a chord consisting of up to 12 tones Tone No 00 11 can be sounded The grid of horizontal dotted lines in the center of the display indicate the tones When Step Step No is selected you can press the center of the ClickPoint to specify the tone Use the ClickPoint A Y to select a tone and press the center to enter that tone The tone will switch on off each time you press the center Use the ClickPoint lt gt to move to the next or previous step Select a step use Y to select a Tone and then press the center to enter Press the MENU OK button when you re finished Creating a user arpeggio pattern 1 Set Step Step No to 01 and press the center of the ClickPoint 2 Select Tone 0 and press the center of the ClickPoint 3 Use the ClickPoint gt to change Step to 02 and enter Tone 1 4 In the same way change Step to 03 and enter Tone 2 Set Step to 04 and enter Tone 1 Set Step to 05 and enter Tone 3 Set Step to 06 and enter Tone 1 Set Step to 07 and enter Tone 2 Set Step to 08 and enter Tone 1 10 Press the M
90. IFX The output will be sent to insert effect IFX See diagram below BUS Select All OSCs L R PROG 8 Insert FX IFX Indiv Out BUS Select Post IFX Insert Effect Pan CC 8 BUS Select tt mono x 2 BUS Select All OSCs IFX Select from L R 1 2 1 2 off FROG Ed InsertFi BUS BUS Select BUS Select BUS Select CAN osts SEN M q Qa i pir T vai ma Senge Tee epi 1 2 1 2 The output will be sent to INDIVIDUAL OUTPUT 1 or 2 See diagram below Note It will not be sent to the insert effect the master effects or the master EQ FROG Ed InsertFi BUS BUS Select BUS Select EUS Select AT OSCs gt DR Pee TEPENE 1 aft iu W iy rm Senge fig i Off The sound will not be sent to MAIN OUTPUT L MONO R INDIVIDUAL OUTPUT 1 and 2 After passing through the master effects the sound is sent to the MAIN OUTPUT Choose this setting if you want to send the sound in series through the master effects at the send level specified by MFX Send See diagram below FROG Ed InsertFi BUS 6US Select BUS Select GUS Select AT OSTs AFA Send 0SC1 Sendi 6356 i OSC2 Sendi 838 Send BER Senda 034 ET ra J j gt PROG 9 Master FX al Send1 Send2 L R BUS Post IFX AUDIO OUTPUT Send1 2 MAIN L MONO R Chain Master Effects Return1 2 A MFX1 I mono x2 i p gt AUDIO OUTPUT INDIVIDUAL 1 2 PROG 8 Insert FX a PR
91. IIIC ae AK SYNTHESIZER CONTROLLER Operation Guide HYPER INTEGRATED SYNTHESIS SYSTEM O Precautions Location Using the unit in the following locations can result in a mal function e In direct sunlight e Locations of extreme temperature or humidity e Excessively dusty or dirty locations e Locations of excessive vibration e Close to magnetic fields Power supply Please connect the designated AC adapter to an AC outlet of the correct voltage Do not connect it to an AC outlet of voltage other than that for which your unit is intended Interference with other electrical devices Radios and televisions placed nearby may experience reception interference Operate this unit at a suitable dis tance from radios and televisions Handling To avoid breakage do not apply excessive force to the switches or controls Care If the exterior becomes dirty wipe it with a clean dry cloth Do not use liquid cleaners such as benzene or thinner or cleaning compounds or flammable polishes Keep this manual After reading this manual please keep it for later refer ence Keeping foreign matter out of your equipment Never set any container with liquid in it near this equip ment If liquid gets into the equipment it could cause a breakdown fire or electrical shock Be careful not to let metal objects get into the equipment If something does slip into the equipment unplug the AC adapter from the wall outl
92. In Editor operating requirements amp You must install the KORG USB MIDI Driver if you want to connect the microX to your computer via USB and use the microX Editor Plug In Editor amp It is not possible to run multiple instances of microX Editor Plug In Editor on the operating system This means that it is not possible to use these editors to edit two or more microX units simultaneously Windows Computer CPU Pentium III 1 GHz or better Memory 256 MB or more Monitor 1 024 x 768 pixels 16 bit color or better A computer with a USB port that satisfies the requirements of Microsoft Windows XP Operating system Microsoft Windows XP Home Edition or Professional Service Pack 1 or later Macintosh e Computer CPU Apple G4 400 MHz or better Memory 256 MB or more Monitor 1 024 x 768 pixels 32 000 colors or better An Apple Macintosh with a USB port that satisfies the requirements of Mac OS X Operating system Mac OS X version 10 3 9 or later 28 Windows XP Installing the KORG USB MIDI Driver and the editor software microX X50 application installation The microX application installer automatically installs the KORG USB MIDI Driver Tools and microX Editor Plug In Editor that are provided on the included CD ROM Note You must install the KORG USB MIDI Driver Tools before you connect the microX to your computer via USB 1 Insert the included CD ROM into your CD ROM drive Normally the
93. K button The text edit window will disappear returning you to the main Write dialog If you want to specify the category use the ClickPoint to select Category and use the VALUE dial to specify the desired category The category you specify here can be used when selecting by category with the CATEGORY button You can select by Category in the following pages PROG 0 Play page COMBI 0 Play Prog page Program Select COMBI 1 Ed Tone Adjust Prog page MULTI 0 Play Program page Inthe Write Program dialog box press the MENU OK button to write save the program Amessage will ask you for confirmation If you are sure you want to write the program press the MENU OK button once again The program will be written saved 45 Playing and Editing Programs Detailed Editing with Programs You can create your own original sounds by edit ing the factory Programs or by initializing a Pro gram Bank E 127 Init Program and starting from scratch You can save these Programs into any bank other than Bank G or g d which cannot be modified Before you begin editing The three attributes of sound pitch tone and volume Sound has three basic attributes pitch tone and volume To control these attributes the microX provides oscillator filter and amp amplifier sec tions The oscillator settings vary the pitch the filter settings mo
94. Leth Length specify the length of the pattern After the pattern has played for the length specified it will return to the beginning This setting can also be changed during or after editing For this example set it to 8 6 Make settings for the J Tempo Reso Resolution Oct Octave Sort Latch K Sync Key Sync and Kbd Keyboard parameters Note These are program parameters but can be set from here as well If after moving here from Program mode you modify these parameters and wish to keep your changes return to Program mode and write the program These parameters are not saved by Write Arpeggio Pattern For this example make the settings shown in the illustration 3 100 7 The Type Arpeggio Type Octave Motion and Fixed Note parameters specify how the arpeggio will be developed These settings can be changed during or after editing Access the Edit page GLOBAL 5 Arp Pattern Edit Step Ho k I zetup Negi A pattern consists of Steps and Tones Step A user arpeggio pattern can have a maxi mum of 48 steps The arpeggiator will play from the first step in steps equal to the timing value specified by Reso Resolution The vertical lines of the grid shown in the center of the display indicate the steps Use Step Step No to select the step For each step specify Ptch Pitch Offset
95. MIDI channel of the Control Track PG p 56 Multi Mode e You can control the program parameters of a track in realtime using AMS Alternate Modu lation or control changes You can also use the MIDI Sync function to synchronize the LFO speed to the tempo e You can use the Dmod Dynamic Modulation function to control effect parameters in real time You can also use MIDI Sync to synchro nize the LFO speed or delay time to the tempo e You can assign a name to the multi set and to each track Multi set structure and corresponding pages Setting parameters Setting parameters External MIDI sequencer Mipich USB g BUS 8 1 2 Setting parameters Setting parameters Setting parameters Track Setting parameters Setting parameters Insert Effect Master Effect Setting parameters Control Track Track 16 Setting parameters Individual Outputs e You can copy the settings of a combination to a multi set e The PLAY MUTE setting lets you quickly mute or un mute a desired track e The Tone Adjust function lets you make detailed adjustments to the program used by each track Overview of Multi set parameters Select a program for each track In the MULTI 0 Play Program page select a pro gram for each track
96. MPARE LED is lit the button will again go dark and your previous edits will be lost Selecting a program for each timbre You can select a program for each timbre in the COMBI 0 Play Prog page or in the COMBI 1 Ed Tone Adjust Prog page For the procedure see Changing the programs within the Combination p 60 Status and MIDI settings Status and MIDI channel Status This controls the status of MIDI and the internal tone generator for each Timbre Normally if you re playing an internal Program this should be set to INT If the status is set to Off EXT or EX2 that internal sounds will not be played Off simply disables the Timbre entirely The EXT and EX2 settings allow the Timbre to control an external MIDI device Bank Select when status EX2 When the Status is set to EX2 these parameters allow you to transmit MIDI Bank Select messages for changing banks on external MIDI devices MIDI Channel Timbres that you wish to play from microX s key board must be set to the global MIDI channel Your playing on the keyboard is transmitted on the global MIDI channel and will sound any tim bre that matches this channel Normally you will set this to Gch When this is set to Gch the MIDI channel of the timbre will always match the global MIDI channel even if you change the global MIDI channel amp On some preloaded combinations Timbres used by arpeggiator may have their MIDI Channels set
97. Mode PROG 1 Ed Basic Prog Basic page setting is Single oscillator 2 will not sound Only the level of oscillator 1 will change For a Drums program this performance editor will have no effect Amp Level Indicates the amp level This will adjust the volume of the entire program Attack Time Indicates the attack time of the filter EG and amp EG This will adjust the speed of the attack from note on Note In order to maximize the effect of the Attack Time adjustment the amp EG Start Level Attack Level Start Level Modulation and Attack Time Modulation parameters are also adjusted Decay Time Indicates the decay time and slope time of the filter EG and amp EG IFX Balance This simultaneously adjusts the W D Wet Dry balance of all insert effect MEX Balance This simultaneously adjusts the Return 1 and 2 parameters of the master effects Note Depending on the settings of the program parameters the result may not be noticeable 5 If you want to save the modified sound select the utility menu command Write Program and write the program p 45 amp The edited content will be lost if you select another program or turn off the power before saving REALTIME CONTROLS 1 2 3 4 SELECT The REALTIME CONTROLS 1 4 knobs can be used to edit parameters such as the filter cutoff fre quency resonance the amp and filter EGs vol ume portamento time pan LFO speed and more Three
98. OG 9 Master FX IFX Indiv Out BUS Select Select from L R IFX 2 i Off a mono x2 i Post IFX 1 i Insert Effect Pan CC 8 BUS Select BUS Select L R Select from L R 1 2 1 2 Send1 Send2 L R BUS eee laqana aa a a a yee gt ta eames aeetenas eaten gran usnu a BUS Select Li S S IFX m A PostIFX AUDIO OUTPUT Send1 2 I MAIN L MONO R Chain Master Effects Return1 2 7 MFX1 Q stereo E mono MFX2 stereo mono x2 AUDIO OUT INDIVIDUAL 1 2 Effects settings BUS Select All OSCs 1 2 PROG 8 Insert FX IFX Indiv Out BUS Select Select from L R IFX 1 2 1 2 Off BUS Select All OSCs Off L PROG 8 Insert FX IFX Indiv Out BUS Select Post IFX Insert Effect nC BRT BUS Select TA from o 2 1 2 3 MFX Send specifies the send level from each 2 oscillator to the master effects This is valid only if BUS Select All OSCs is set to L R or Off If IFX is selected for BUS Select All OSCs 3 the send level to the master effects is adjusted by the Send 1 MFX1 and Send 2 MFX2 parameters PROG 8 Ed InsertFX Setup page after the signal has passed through the insert effect Selecting an insert effect and rout 4 ing after the insert effect 1 Access the PROG 8 Ed InsertFX Setup page The Setup page displays the state of the routing and the insert effect settings In t
99. OUI IN pebueyd uueuoO lInej q oiseg 49 011U0D J9zZIS UUAS 124 MIDI Implementation Chart NOLLVLNAWAIdWI IAIN uo uongeuudojut aow IOF 1olnqrrsrIp Sioy e2o ANOA 1nsuoo ON X ONOW 440 INWO r PON A 1Od AsO INWO SPON s A O ONOI NO INWO lt 2 89DON A1Od NO INWO 8pol payoddns ase aun asieody Jalseyy pue auN ulj ISe QoueRleg ISEN uun oA SEN UO WalshS WS Auinbuy sebessaw aaisnjoxe Hioy 0 uollippe Ul 9UN BSJeOD 00 z0 OUNI SUI 00 L0 abues pu q yid 00 00 8g8SNW 8S1 8 OsJUOD lI90 A JOyeIHHaduy 00 g0 10 U09 ayed JoyeI HBaduy 00 VO 44O NO JoyelbBaduy 00 z0 gSN 8S1 ASN XF 10 IGIA 3XF 40 lisoddo ay parjaded JOU nq p llltusu 1 euj lu SI 4909 IAIN WWAOTD U UM L Ajanoadsay ajqeuz s aAisnjoxy abueuy joujuoy yono sayy eGueyy wes6o1d 19414 IGIN 2 TV8O 19 usym penieoe paliwsuel 3 9 Wy ds SO ON x 10S90Y O ZZL EZL O 01 u09 soyeIHBBediy 0 spuods uioo 8 oun a _ ot O 1ZL 0 O 199 8g Buos pome j s JoyelbBbaduy 0 uollisoq DUOS a K OK K K OK OK OK K K OK K OK OK K d ZL 0 O zL 0 O SU S AlIl9V s Bess A HO S O0N IIV xny HO UO E90 puewwop sul e tj y20 9 u 9 s S ne ebuey sjqeue bueuo WesBOld Dx S49 01 U09 IIV JOSEY HO PUNOS IIV O gt ZL OZI D 3A189981 eyeq 101 u09 xy gt O LOL O or ubisse g V SQOUy
100. PS 1 to the ASSIGNABLE SWITCH jack 2 After turning the power on use GLOBAL 0 System Foot page Foot SW Assign and Foot SW Polarity to assign the function controlled by the foot switch and to specify the polarity p 88 Connecting a computer Connecting a foot pedal If you connect a separately sold EXP 2 foot con troller or XVP 10 expression volume pedal to the ASSIGNABLE PEDAL jack you can use it to apply modulation to sounds or effects or to adjust the overall volume This pedal will always function in the same way regardless of the program combination or multi set you ve selected You can assign the function in the Global mode 0 System Foot page 1 Connect an separately sold XVP 10 or EXP 2 to the ASSIGNABLE PEDAL jacks 2 After turning the power on use GLOBAL 0 System Foot page Foot Pedal Assign to assign the function controlled by the foot pedal p 89 Connecting a computer You can connect the microX to your computer and use it as both an input keyboard and a MIDI sound module You can also use the included editor to edit the microX from your computer You can connect the microX to your computer in either of the following ways e Usea USB cable Note Use the KORG USB MIDI Driver if you re connecting the microX via USB to a computer that meets the requirements described in KORG USB MIDI Driver operating requirements below e Use a commercially available MIDI
101. Pocket Before you play make sure that the global MIDI channel GLOBAL 1 MIDI MIDI Channel is set to 01 Arpeggiator A is assigned to T7 and T8 and arpeggiator B is assigned to T5 When you play the keyboard the T7 program HipHop Kit will be sounded by the arpeggio pattern Dr In The Pocket The T5 program Chord Trigger will be sounded by the arpeggio pattern Bs Echo The B Key Btm and Key Top COMBI 7 Ed Arp Ctrls Scan Zone page are set so that arpeggiators B will operate only for the G3 note and above e Arpeggiator B is assigned to T8 as well but this setting is so that the T7 program HipHop Kit will sound only when the arpeggiator is on See the preceding section Combination B021 Urban Nature RnB Writing the arpeggiator settings Arpeggio parameters you edited in Combination or Multi mode are saved along with the settings when you write the combination or multi set For the writing procedure see Saving your edits p 61 for a combination or to Saving your edits p 75 for a multi set Linking the arpeggiator to the com bination If you want the arpeggiator settings of a combina tion to become active when that combination is selected check Combi for Auto Arp GLO BAL 0 System Basic page Creating a user arpeggio pattern Creating a user arpeggio pat tern User arpeggio patterns can be created in Global mode e When you play the keyb
102. Return 2 MFX1 Chai stereo Ca tl MFX2 G stereo Chain Signal Chain Direction LR Mix MFX2 MFX1 6 Move to the MFX1 or MFX2 page and set the parameters of the effect that you selected as the master effect For details on the parameters of each effect see PG p 104 Master EQ 1 Use the stereo 3 band master EQ to make final equalizing adjustments immediately before the sound is output from the MAIN OUTPUT L MONO and R jacks Set the Low Mid and High gain in the PROG 9 Ed MasterFX Setup page Low and High are shelving type and Mid is a peaking type adjustment These settings are linked with the Low Mid and High Gain settings of the Master EQ page In addition to these settings the Master EQ page also lets you specify the center frequency and bandwidth Mid only of each band and make settings for dynamic modulation 83 Effects settings Effect settings in combina tion and Multi Routing In Combination and Multi modes you can specify the routing of each timbre track to the insert effect and master effects These settings are made in the same way in each of these modes We will be using the example of Combination mode in our explana tion here 1 Access the COMBI 8 Ed InsertFX BUS page COMBI 3 Ed InsertFi BUS BUS Select EAR Hoti ta es ie penti i IF Fs L R LAR sitar KU ny PAG an PAN 51006 5100 i a a Se E SPAS I AA 2 In BUS Select
103. SE ARP ON OFF CONTROLLER LAN ANN PANN i P sn _ ss OLO OF OC GBD be Assicnasie 1 ASSIGNABLE 2 ASSIGNABLE 3 ASSIGNABLE 4 x x C ARP GATE ARP VELOCITY ARP LENGTH TEMPO Knobs 1 4 Here we ll explain how to use the realtime controllers in Program mode Note We won t be using the External Control function so make sure that the EXT CONTROLLER button is dark If it is lit press the EXT CONTROLLER button once 1 Press one of the PROGRAM A GM buttons The button will light 2 Choose Program Select program number and name and turn the VALUE dial to select the program that you want to control using the realtime controllers 3 Press the REALTIME CONTROLS SELECT button to light the A LED located at the right of the button 4 Turn knob 1 LPF CUTOFF to adjust the cutoff frequency of the low pass filter When you adjust the cutoff frequency of the filter the brightness of the sound will change The effect will depend on the settings of the program parameters but normally rotating the knob toward the left will darken the sound and rotating it toward the right will brighten it 5 Turn knob 2 RESONANCE HPF to adjust the resonance level of a low pass filter or the cutoff frequency of a high pass filter The content that is controlled will depend on the filter type specified by the program By adjusting the filter resonance level you can increase or decrease the resonance level to add a u
104. The pitch that sounds will depend on the PROG 2 Ed Pitch OSC1 page Pitch Slope setting Use this setting when you want only to change the pitch such as with tom or cymbal sounds Placing drum samples Here s how to place two drum samples and switch between them using velocity 1 Access the GLOBAL 4 DKit High Sample page 2 Select the High Drum Sample Press the CATEGORY button to view a list of the drum samples organized by category For Editing Drum Kits Fine tuning the sound of each sam details on how to make a selection see Selecting by Category p 38 Select a drum sample name in the list so that it is highlighted Press the MENU OK button to confirm the selection Press the PAGE button to access the GLOBAL 4 DKit Low Sample page Specify the Low Drumsample as you did in steps 2 4 Now you have assigned drum samples to the High Drumsample and Low Drumsample Next we ll assign the velocity range for these drum samples Set the Velocity SW L H The Low drum sample will sound when you play a key less strongly than the specified velocity value and the High drum sample will sound when you play more strongly For example if you set Velocity SW LH to 100 the drum sample assigned to Low will sound when you play the keyboard softly and the multisample assigned to High will sound when you play strongly Note If you don t w
105. When you edit a drum kit your changes will affect all programs that use that same drum kit If you want to edit one of the preloaded drum kits it is best to copy the drum kit into a vacant area of the USER bank and then edit the copy of the drum kit 108 Editing Drum Kits Basic Editing 1 Select the Program that you wish to use while editing the Drum Kit For more details see First select a Drum Program p 107 2 Press the GLOBAL button to enter Global mode 3 Access the GLOBAL 4 DKit High Sample page GLOBAL 4 DKit High Sa Drum Kit S20Usery Orumkita2 TITITIITITIIITITTITITUITITIPTITIYIIIPITITUITITIPIITITIWIIPIUTIYUITITITYIT We Sl L H BB 1 E FIASSign Level H 66 L 06 4 Use the Drum Kit parameter at the top of the screen to select the Drum Kit that you wish to edit 5 Use the Key parameter to select the note that you wish to edit Use the front panel VALUE dial etc to edit the setting This Key selection applies to all three Drum Kit editing tabs 6 Use the Assign check box to specify whether the key will have its own settings or use the same settings as the next higher note If Assign is checked the key will have its own settings This is the default If Assign is not checked the key won t have its own settings Instead it will use the same settings as the next higher note except that the drum samples will be played at a lower pitch
106. X s tone generator from an external MIDI keyboard or sequencer etc use a MIDI cable to connect the MIDI OUT connector of the external MIDI device to the MIDI IN connector of microX a IN MIDI OUT i MIDI keyboard Controlling two or more external MIDItone generators from microX You can also use a MIDI patch bay to control mul tiple MIDI devices II microX mon IAA MIDI keyboard 1 MIDI patch bay MI DI OUT MIDI IN 6 MIDI tone generator Connecting an external MIDI sequencer You can connect the microX to your external MIDI sequencer and use it both as an input keyboard and as a MIDI sound module 1 Connect the microX s MIDI OUT connector to your MIDI sequencer s MIDI IN connector and connect the sequencer s MIDI OUT connector to the microX s MIDI IN connector 2 Make the necessary settings in the microX s Global mode See Global mode settings on the microX p 32 MIDI sequencer 35 Setup 36 Playing and Editing Programs What s a Program Programs are the basic sounds of the microX Programs are important elements of other modes as well In Combination mode you can combine multiple programs to create complex sounds and in Multi mode you can play multiple programs by Playing programs Selecting programs There are several different ways to select p
107. XIT CANCEL button You can also exit by pressing one of the PROGRAM A GM COMBINATION A C GLOBAL or MULTI buttons Changing the play mode You can play back the demo songs in succession or only one song at a time use the Click Point lt P gt Y to select Play Mode and use the VALUE dial etc to change the set ting Continue to next song When the currently selected demo song finishes playing the next demo song will play automatically Stop at end of selected song When the currently selected demo song finishes playing playback will stop e If you want all of the demo songs to continue playing repeatedly use the ClickPoint lt gt A Y to select the Repeat All check box and then press the ClickPoint center to add a check mark Note This is available only if Play Mode is set to Continue to next song This Quick Start section is just an introduction to introduce you to your new synthesizer Please take the time to read the more in depth sections of this manual that follow Introduction Main features High quality sound featuring the HI synthesis system The microX Music Synthesizer features Korg s acclaimed HI Hyper Integrated synthesis sys fem The HI Hyper Integrated synthesis system is a PCM tone generator system with extensive modu lation and effect routing capabilities as well as full digital signal processing that guarantees a rich pristine sound
108. affected by the LFO s for which you set an LFO1 Mod Intensity LFO2 Mod Intensity value Intensity AMS Intensity adjusts the depth by which the tremolo effect produced by the LFO will be affected when you assign an AMS LFO1 AMS LFO2 AMS For example if you set AMS LFO1 or LFO2 to JS Y 02 you can move the joystick toward your self or receive CC 2 to apply a tremolo effect Amp EG Amp Envelope Generator The Amp EG lets you control how the volume changes over the course of a note PROG 6 Ed Ampi1i2 L SPER A 99 Bae 5 400 T Att 0 99 5 400 B 60 Levei Aod Time Hod AMS tt AMS 1 04 868 5 0 AA BA i AMS OFF EG Start Level 66 7 6 0 8 5 8 B B 660 A DA 5 8 Re 55 Playing and Editing Programs Every instrument has its own characteristic vol ume envelope This is part of what gives each instrument its identifiable character Conversely by changing the volume contour for instance applying a string like Amp EG curve to an organ multisample you can produce interest ing and unusual sounds Piano Pari AMS Of Cate Gist eri iiny I Intensity 00 The main Pan parameter determines the place ment of the sound in the stereo field after the sig nal has passed through the oscillator filter and amp Normally you ll set this to C064 so that the sound is centered equally between the left and right speakers To create a stereo effect when Oscillator Mode is set to
109. affects only Timbre 2 s piano sound 1 Access the COMBI 3 Ed MIDI Filter1 2 page 2 Un check the Damper CC 64 box for Timbre 1 3 Check the Damper CC 64 box for Timbre 2 64 Layers Splits and Velocity Switches Within a Combination you can use note number and velocity to determine which Timbres will sound The Programs assigned to each Timbre can sound in three ways as part of a layer a split or a veloc ity switch A Combination can be set to use any one of these methods or to use two or more of these methods simultaneously Layer Layers cause two or more Programs to sound simultaneously when a note is played Layer Two or more programs sound simultaneously Split Splits cause different Programs to sound on differ ent areas of the keyboard MAA Split Different programs will sound in different areas of the keyboard Velocity Switch Velocity Switches cause different Programs to sound depending on the velocity how hard you play the notes gam eT St III Velocity Switch Keyboard playing dynamics velocity switches between different programs On microX you can use a different Program for each of up to eight Timbres and combine two or more of the above methods to create even more complex setups Program A Program B Program D Strong Keyboard playing Program C Soft dynamics Example Band C D are split In the lower keyboard range A and B are layer
110. age structure e Basic settings for the entire microX 0 System Controller settings for the pedals etc connected to the rear panel 1 MIDI MIDI related settings for the entire microX e User registered scale settings 2 User Scale Specify 16 octave scales and one all note scale 3 Category Name Edit category names for programs and combinations 4 DKit Edit drum kits 5 Arp Pattern Edit user arpeggio patterns e External control settings Assign CC to REALTIME CONTROLS knobs 6 Ext Control For details on how to access each page tab or util ity command and how to edit the values see Basic operations p 19 amp The edits you perform in Global mode will be preserved until you turn off the power is turned off but will be lost when the power is turned off Four types of data are handled in Global mode user drumkit settings GLOBAL 4 arpeggiator settings GLOBAL 5 external control settings GLOBAL 6 and all other global settings GLOBAL 0 3 You into its own memory area amp Note that Compare can t be used in Global mode System setup 0 System Basic Page Basic Master Tunelcent Basic iFa sU Auto Arp Master Tune BEE idd sgh OIFA Ott Program Key Transpose 66 OMF Off i Combi Welocity Curve d Normal CIMF22 off OCTAVE keys s a z Use Progr Combis Multi s Octave bazie M Frer I Fort Tuning to another instrument Trans posing Master Tune adjusts
111. alized Combination Bank C 127 Init Combination to create your own original sounds You can use the factory Programs to create new Combinations or use your own custom Programs You can write save these combinations in any bank A C Before you begin editing A combination has eight timbres Each timbre con sists of a program with parameters such as key board zone velocity zone mixer settings MIDI channel and filter See the diagram entitled Com bination structure and corresponding pages Overview of Combi mode parame ters Select a program for each timbre In the COMBI 0 Play Prog page or COMBI 1 Ed Tone Adjust Prog page select a program for each timbre Status and MIDI settings In the COMBI 2 Ed Track Param MIDI page set Status to INT for the timbres that you want to play and set their MIDI channel to the global MIDI channel Combination structure and corresponding pages Timbrel Parameters Program Timbre2 Timbres Parameters Insert Effect 8 1 Timbre 62 k i Insert Effect Master Effect Individual Outputs Layer split and velocity switch In the COMBI 5 Ed Key Zone Key page and the 6 Vel Zone Vel page specify the range layer split velocity switching etc in which each pro gram will sound Adjust the programs so that they fit within the combination For each timbre program specify the poly mono setting and adjust timbre parameter
112. ame page number name tab name and the parameter name of the edit cell Modename Page number name Tab name Parameter name ep Play A Combi Select b Tab Most pages are divided into two or more tabs Use the PAGE PAGE buttons to select a tab and view that page c Parameters The parameters for various settings are displayed in the display Use the ClickPoint lt gt A Y to select the desired parameter d Edit cell When you use the ClickPoint lt gt A Y the selected parameter will be highlighted in the dis play This area is called the edit cell and your editing will affect the highlighted area For details on how to edit the value see 3 Selecting a parameter and editing the value p 20 e Check box Use the ClickPoint lt gt Y to select a check box and usethe VALUE dial the center of the ClickPoint to add or remove the check mark When checked the parameter will function when unchecked the parameter will not function Utility menu When you press the UTILITY button in a page the utility menu will appear The utility menu con tains commands that can be used in that page The utility menu that appears will differ depending on the page that is selected For details on selecting and executing a utility command see 4 Selecting and executing a Utility function p 21 Dialog boxes When you select a utility menu command etc
113. ant to use this function set Velocity SW LH to 001 Only the High drum sample will sound Note This is the same type of function as velocity multisample switching in a program p 49 ple 1 If you like adjust the Levels for the two Drum Samples Set the High and Low Level settings to adjust the volume balance Set the tuning and EG parameters as desired For each Drum Sample you can control offsets to the Program s settings for transposition tuning and EG attack and decay times You can adjust the sound or specify reverse playback for each drum sample For each drum sample set the FC Filter Cutoff and Reso Resonance parameters and specify S Ofs and Rev Reverse PG p 87 Repeat steps 1 3 to set up each key of the Drum Kat You can also copy settings from one Key to another using the Copy Key Setup utility command Using Exclusive Groups 1 Access the GLOBAL 4 DKit Voice Mixe er page Use the Excl Group Exclusive Groups to make one drum sound cut off another drum sound such as closed and open hi hats For example let s say that you ve assigned an open hi hat and a closed hi hat to the same exclusive group Play the open hi hat sound While it s still ringing play the closed hi hat The open hi hat sound will be cut off simulat ing the action of a physical hi hat Using Hold The Program Hold param
114. apes to their volume levels For example the volume of a piano note begins at a high volume the instant you play the note and then decreases gradually The volume of an organ note on the other hand remains constant as long as you continue pressing the key The volume of a note on a violin or wind instru ment can be varied during the note by the musi cian i e by regulating the amount of pressure on the bow or the force of the breath Volume Piano Volume Organ Volume remains constant until note is released Volume decays gradually Time Time Setting the basic amp level The basic volume level is set by the Amp Level parameter You can then alter this using the modulation sources below Velocity Int 45 AHE PACH E _ Intensity 60 IBM5 0 ff l Intensity d EAMS KrobMi i7 Int 4a EG mpe Med eG j Keyboard Track This lets you vary the volume relative to the note you play For more details see Keyboard Track p 54 Velocity Amp Modulation Velocity Intensity is used by most programs to decrease the volume of softly played notes and increase the volume of strongly played notes Normally you will set Amp Modulation to posi tive values As this setting is increased there will be greater volume difference between softly played and strongly played notes LFO1 2 Mod Specifies how the LFO s will produce cyclic changes in volume tremolo effect The volume will be
115. at BUS Select or BUS Select following the insert effect is set to 1 2 1 2 p 81 LI If specific tracks in Multi mode do not sound Make sure that the PLAY MUTE is set to PLAY p 70 C Make sure that the Status is INT or BTH p 71 L Are the Key Zone and Velocity Zone set so that sound will be produced when you play p 65 Notes do not stop L In PROG 1 Ed Basic select the Prog Basic page make sure that the Hold check box is unchecked PG p 6 119 Appendices L In GLOBAL 0 System Foot page make sure that Damper Polarity or Foot SW Polarity is set correctly PG p 80 Noise or oscillation is heard LI When using the BPM MIDI Sync function to control the delay time of an effect noise may occur in the delay sound This noise is due to discontinuities in the delay sound and is not a malfunction L Some effects such as 015 St AnalogRecd gen erate noise intentionally It is also possible to create oscillation using a filter with resonance These are not malfunctions Programs and Combinations Settings for oscillator 2 are not displayed L Make sure that the PROG 1 Ed Basic Prog Basic page Mode Oscillator Mode parame ter is set to Double A combination does not play correctly after you load data L Are the bank numbers of the programs used by the combination the same as when the com bination was created If you have switche
116. ated settings for the entire microX such as the global MIDI channel and the MIDI clock setting You can also use the utility commands of this page to transmit MIDI System Exclusive data dumps PG p 81 Creating user scales 2 User Scale Creating an original scale and assigning it to a Program On the User Scale page you can create your own original scales These include sixteen different User Octave Scales in which the pitch of each note of the octave is repeated for all octaves and one User All Note Scale in which the pitch of each of the 128 notes can be specified independently By adjusting the pitch of each key in the range of 99 cents you can raise or lower it by approxi mately one semitone relative to the normal pitch The user scales you create here can be used by specifying the scale for a program for each timbre of a combination or for each track of a Multi set You can choose these scales from the following pages Here s how to set the scale type for each track in Multi mode 1 Create a user octave scale or a user all notes scale Program GLOBAL ea ES Scale User Octave ae ce D FR oe A m E E Select a key and use the VALUE controllers to adjust the pitch The range of 99 raises or lowers the pitch approximately one semitone above or below the standard pitch Octave E iss 63 66 Note You can copy one of the preset scales and edit it to create an origina
117. between arpeggio patterns Here we ll explain how to use the arpeggiator in Program mode Using the realtime controllers to control the arpeggiator 1 Press one of the PROGRAM A GM button The button will light 2 Choose Program Select program number and name and turn the VALUE dial You will notice that the ARP ON OFF button is lit for some programs Select one of these programs and play the keyboard the arpeggiator will start playing Even for other programs you can press the ARP ON OFF button the button will light to turn on the arpeggiator Play the keyboard to make the arpeggio start 3 Press the REALTIME CONTROLS SELECT button to light the C LED located at the right of the button 4 Turn the 4 TEMPO knob to change the tempo 5 Turn the 1 ARP GATE knob to change the duration of the arpeggiated notes Note When knobs 1 3 are at their center position 12 o clock the parameters they control will have the values specified within the program 6 Turn the 2 ARP VELOCITY knob to change the level of the arpeggiated notes 7 Turn the 3 ARP LENGTH knob to change the length of the arpeggio pattern Changing the length of the arpeggio pattern will change the character of the pattern This doesn t work for the preset patterns UP DOWN ALT1 ALT2 and RANDOM Changing the arpeggio pattern The microX contains preset arpeggio patterns Preset 0 through Preset 4 and user arpeggio pa
118. bles as shown in the connec tion diagram below Connecting audio output devices Here you can connect a set of amplified monitor speakers or your audio system to output microX s sound Connecting the MAIN OUTPUT L MONO and R These are the main outputs They are unbalanced phone jacks These are the main stereo outputs their volume is controlled by the VOLUME knob All of the fac tory Programs and Combis are programmed to play through these outputs If you re editing a program or combination or playing back from an external MIDI sequencer in Multi mode you can set BUS Select to L R so that the sound will be sent from these jacks 1 Connect the MAIN OUTPUT L MONO and R jacks to the INPUT jacks of your powered monitor system mixer etc Audio output device connections If you are outputting in stereo make connections to the L MONO jack and the R jack If you are outputting in monaural make connections to the L MONO jack We recommend that you playback in stereo if possible If you re playing back through a stereo audio amp or a stereo radio cassette player that has external input jacks connect these jacks to the jacks marked LINE IN AUX IN or External Input You may need to use an adapter plug or adapter cable amp If you playback microX through your stereo audio system be aware that high volumes may damage your speakers Be careful not to raise the volume excessively Connect
119. but ton the arpeggiator will be switched on off When this is on the button will light and playing the keyboard will start the selected arpeggio pattern ARP ON OFF button SELECT button C REALTIME CONTR JS 1 2 3 4 6 6 6 yo Q SELECT A P A IN NN H O O O EXT ARP ON OFF CONTROLLER Knobs 1 4 91 Arpeggiator settings Adjusting the arpeggiator tempo TEMPO 1 Press the REALTIME CONTROLS SELECT button to make the right C LED light 2 Rotate the 4 TEMPO knob to adjust the tempo The J value in the upper right of the display will change You can set this in the range of 40 240 The LED located above the ARP ON OFF button blinks at quarter note intervals of the timing you specify You can also set the timing from within the display Use the ClickPoint to select J and turn the VALUE dial to specify the tempo The LED will blink at the specified tempo Note You can set the tempo by pressing a separately sold PS 1 foot switch that is connected to the PEDAL jack when Foot SW Assign is set to Tap Tempo Note The arpeggio playback speed is affected by the Reso Resolution setting 0 Play Arp Play page 7 Ed Arp Ctrls Setup page M I MIDI Clock GLOBAL 1 MIDI is set to Ext MIDI or Ext USB or set to Auto and MIDI clock messages are being received from an external device the display will indicate J EXT This lets y
120. croX s programs combinations multi sets and Global mode settings to their factory set state You can do this by reload ing the preloaded data amp This operation will rewrite any data that had been previously written to the internal memory If you don t want to lose this data you should save it using the included microX Editor Plug In Editor or save the data using a commercially available data filer 1 Press the GLOBAL button to enter Global mode The button will light 2 Press the EXIT button You will be in the GLOBAL 0 System page 3 Press the UTILITY button to access the Utility menu 4 Use the ClickPoint Y to select Load Preload Data and press the center A dialog box will appear Load Preload Data 5 Choose Kind and use the VALUE dial to select the data that you want to load Choose All if you want to restore all settings to the factory set state If you execute this with the All setting all programs combinations multi sets drum kits arpeggio patterns global settings and external control sets will be loaded 6 Press the MENU OK button A dialog box will ask you to confirm the operation 7 Press the MENU OK button once again All preloaded data will be loaded Ag If the Memory Protected dialog box appears un check the memory protect setting and perform the load operation once again p 88 Loading individual banks or data item
121. d TimbreParam O50 Force o5 Mode Mati Moti E Moti E Meti Moti Ba Moti Elmeti U a ait ait PRG PRG PRG Both Both Both Both Both Both Both PRG PRG PRG i PRG PRG You can make these settings in COMBI 2 Ed Tim bre Param OSC Force OSC Mode Normally this should be set to PRG so that the sound will play as set by the original Program If you wish to force a polyphonic program to sound monophonically set this either to Mono or LGT Legato Conversely set this to Poly if you wish to force a monophonic program to play poly phonically OSC Select Normally this should be set to Both If the timbre is using a program whose Oscillator Mode is Double and you want only OSC1 or OSC2 not both to sound set this to OSC1 only OSC1 will sound or OSC2 only OSC2 will sound Portamento Normally this should be set to PRG If the Program uses portamento but you d like to disable this for the current Combination set this parameter to Off Conversely if you want to force the portamento to be on or just to change the portamento time set this to a value of 001 127 The portamento will change to use the newly specified time Altering Programs to fit within a Combination the wi i 408 DD i HARAG i BDDB 140000 0000 0008 0B00 i BBB8 HG PRG FRG JERG FRG PRG PRG PRG PRG Delay and scale settings COMBI z Ed Timbre Param Other ET rns You can make these sett
122. d program banks you can use the Change all bank references menu com mand to change the program bank for each tim bre of a combination PG p 77 Multi set When you loaded data a Multi set does not sound correctly L Are the bank number of the programs used by the song the same as when the Multi set was created A combination copied using Copy From Combi sounds different than it did in Combination mode L Did you make the correct settings in the Copy From Combination dialog box p 72 In the Copy From Combination dialog box check the Auto adjust Arpeggio setting box before you execute the copy 120 Effects Effects are not applied L Are the Effect Global SW IFX Off MFX1 Off or MFX2 Off GLOBAL 0 System Basic page settings checked p 87 LI If you are in Combination and Multi mode and master effects are not applied when you raise the S1 Send1 MEFX1 or S2 Send2 MFX2 of the timbre track does Rtn1 Return 1 or Rtn2 Return 2 from the master effect need to be raised p 83 Alternatively has Send 1 or Send 2 for each oscillator of the program used by the timbre track been lowered p 84 The actual send level is determined by multiplying the send setting of each oscillator in the program with the send setting of the timbre track Arpeggiator Arpeggiator does not start L Is the ARP ON OFF button turned on lit LI If the arpeggiator does not start for a combina tion o
123. dify the tone and the amp settings modify the volume The microX s oscillator filter and a m p On the microX the settings that determine the pitch are located in the PROG 1 Ed Basic and PROG 2 Ed Pitch pages In the Ed Basic page you can specify the waveform multisample and the basic pitch of the waveform In the Ed Pitch page you can specify how the pitch will follow the keyboard and make other pitch related settings Filter settings are made in the PROG 4 Ed Filterl and PROG 5 Ed Filter2 pages These set tings adjust the tone Finally Amp settings are made in the PROG 6 Ed Amp1 2 pages These settings adjust the vol ume and send the sound to the outputs Program structure and corresponding pages Program Basic 1 1 QSC1LFO 3 1 OSCI LF02 3 2 Filter1 A B 4 1 Amp Level Pan 6 1 OSC1 Pitch Mod 2 1 2 Filter Mod 4 23 Amp1 Mod 6 2 Filter LFO Mod 4 4 Filterl EG 4 5 Oscillator Basic 1 2 4 Ampl EG 6 3 AEG 75 osci These three sections determine the basic sound of the program EG LFO keyboard tracking AMS Dmod controllers In addition to the sections described above the microX provides ways in which the sound can be varied according to time key range or various types of performance expression These are con trolled by modulators and controllers such as EG envelope generator LFO Low Frequency Oscil lator keyboard
124. e of the edit cell use the VALUE dial or the ClickPoint Note You can use the COMPARE button to compare the sound you re editing with the original unedited sound VALUE controllers VALUE dial Use this dial to edit the selected parameter s value ClickPoint After selecting a parameter expressed as a numeri cal value etc press the center of the ClickPoint the value will be highlighted and now you can use A Y to increase or decrease the value To finalize the value press the center once again If you press the EXIT CANCEL button while pressing the ClickPoint center the selected value will be reset to 0 or the minimum value In addition you can press the ClickPoint center to turn a check box or switch on off COMPARE button Use this when you wish to compare the edits you have made to a program or combination s sound with the un edited original i e the sound that is written into memory When editing a program or combination press this switch The LED will light and the last writ ten settings for that program number or combina tion number will be recalled When you press the COMPARE button once again the LED will go Basic operations dark and you will return to the settings that you were editing If you edit the settings that are recalled by press ing the COMPARE button i e the settings that are written into memory the LED will go dark and it will not be possible to ret
125. e preceding example 1 Access the COMBI 5 Ed Key Zone Key page 2 In the example above you could set the Bottom Key of timbre 1 to G3 and set the Top Key of timbre 2 to G4 so that these two timbres overlap 3 Access the COMBI 5 Ed Key Zone Slope page 4 Next if you set the Bottom Slope of timbre 1 to 12 and set the Top Slope of timbre 2 to 12 the sound will change gradually instead of changing suddenly 5 The COMBI 5 Ed Key Zone Review page shows a graphic indication of the region of keys or note data for which timbres 1 8 will play The region that will sound is shown as a line and the shaded area indicates the portion occupied by the slope Creating Velocity Switches Next let s create a simple velocity switched Com bination like the diagram below nine Brass K Velocity Timbre 2 Strings switch 1 Access the COMBI 0 Play Prog page 2 Select a brass sound for Timbre 1 and a strings sound for Timbre 2 3 Access the COMBI 2 Ed Timbre Param MIDI page 4 For Timbres 1 2 set Status to INT and MIDI Channel to Gch the Global Channel 5 Access the COMBI 6 Ed Vel Zone Vel page 6 Set Timbre 1 s Top Velocity to 127 and its Bottom Velocity to 64 7 Set Timbre 2 to a Top Velocity of 63 and a Bottom Velocity of 1 The strings program will sound when you play the keyboard softly and the brass program will sound when you pla
126. ect MIDI and press the center The GLOBAL 1 MIDI page will appear GLOBAL 1 MIDI MID Channel Bi Hote Receive All HIDI HIDI Channel HIDI Filter E Enable Program Change FIBank m Combi PIAfterT C tr Change IES Wsive MIDI Clock Auto BT Convert Position PFeMIDI FlLocal Control on 5 Use the ClickPoint lt 4 A Y to select MIDI Channel and use the VALUE dial to specify the global MIDI channel With the default settings the global MIDI channel MIDI Channel is set to 01 Selecting programs To switch programs send a MIDI program change from your external MIDI device or computer To switch banks send a Bank Select control change message CC 0 upper byte CC 32 lower byte The microX will switch to the program of the specified bank at the time that it receives a pro gram change following the bank select message 39 Playing and Editing Programs microX microX Bank Bank pA ow e 0 177 ST x 0w e 2 o op m e s enr x E ow 6 4 o rm m us oer Tm s o oa e on o ar om ESE s rm mj o oa 00 D rn e o oa Note In bank G program numbers 000 through 127 correspond to 001 128 Note R Receive indicates that only reception is supported Note Bank select messages will not be transmitted or received if the GLOBAL 1 MIDI page MIDI Filter Bank is unchecked Note The table above describes the ope
127. ed In the higher keyboard range C and D are switched by velocity and layered with A As an additional possibility you can set the slope for a key zone or velocity zone so that the volume diminishes gradually This lets you change a split into a keyboard crossfade or a velocity switch into a velocity crossfade Layers Splits and Velocity switches Keyboard X Fade keyboard CTT Creating Key Splits and Layers Let s create a Combi which combines both splits and layers like the diagram below Timbre 1 Timbre 2 Timbre 3 C 1 B3 C4 G9 1 Access the COMBI 0 Play Prog page 2 Select a piano sound for Timbre 1 a brass sound for Timbre 2 and a strings sound for Timbre 3 3 Access the COMBI 2 Ed Timbre Param MIDI page 4 For Timbres 1 3 set Status to INT and MIDI Channel to Gch the Global Channel 5 Access the COMBI 5 Ed Key Zone Key page 6 Set Timbre 1 s Top Key to G9 and its Bottom Key to C4 7 Set Timbres 2 and 3 to a Top Key of B3 and a Bottom Key of C 1 The piano program will sound when you play a key above or including C4 The brass program and strings program will sound when you play a key below C4 1 ee Goo BS Key Zone Slope In addition to hard splits in which the sound changes abruptly you can use the Slope param eters to gradually fade a sound in or out over a range of keys We ll assume that you are continuing to edit from th
128. ed sound with the original sound to cre ate a chorus effect or create special effects in which the pitch continues to rise or fall 80 Early reflection and delay effects Early reflection effect 41 Early Reflect produces only the early reflections of a reverb effect Using just these early reflections you can add weight or spatial effects to a sound such as reverberation Without the reverberation you can achieve a clean effect sound Delays 43 LCR Delay 51 Sequence Dly create an echo effect by delaying the sound for a fixed length of time You can also make the delayed sound repeat feed back Dry sound iw Time Level e a Delay time Reverb effects Reverb 52 Rev Hall 57 Rev Brt Room is an effect that creates the spacious reverberation of sounds played in a hall or room Reverb simulates the sounds that are reflected from the ceiling and wall When you hear music in a concert hall the sound from the instruments and voices reaches your ear directly but also reaches your ear after being reflected off the ceiling and walls and being delayed by a corresponding length of time In this way the direct sound the dry sound is joined by numerous reflections that create the impression of a large acoustical space The way in which the sound is reflected will depend on the materials of the ceiling and walls and also on the size and shape of the hall These factors also affect the way i
129. eft of the display e Each time you press the GM button the bank will alternate as shown below G g d gt G g d gt G Auditioning the sound 5 Play a note on the keyboard to hear the sound you selected Alternatively you can press the AUDITION button the button will light to turn on the Audition function and the microX will automatically play a riff phrase suitable for the selected program Overview Program Banks When shipped from the factory it is loaded with 640 Programs You can also save any programs that you create Programs are organized into six banks as shown in the following table Program banks Prog Bank oo Explanation With the factory settings these banks contain a wide variety of preloaded programs that use for the internal PCM ROM preloaded multisamples effects and programs arpeggio patterns 128 programs can be written or rewritten to each bank fora total of 640 G 001 GM These banks contain 128 GM 128 programs programs and nine GM drum programs that are compatible with the GM sound map The programs of these banks are read only Bank G containsthe GM g d 001 GM2drum programs G lets you select 128 128 programs programs numbered from 001 128 and g d lets you select nine drum programs You can t write Save data to these banks 38 Selecting by Category You can select Programs from within a category such as keyboard organ
130. eggiator settings written to a program or combination will also be selected when you select that program or combi nation or whether the arpeggiator settings will remain in their current state when you switch the program or combination When the microX is shipped from the factory the former setting is selected You can use the latter setting if you want to use the same arpeggiator settings to generate phrases and patterns while you select and try out different programs and combinations If the Auto Arp Program or Combination boxes are checked selecting a program or combi nation respectively will also select the arpeggiator settings that are written in that program or combi nation OCTAVE When you switch programs combinations or multi sets you have the option of also recalling the OCTAVE V A button setting that is written as part of this data If the OCTAVE Keys Y A Use Prog Combi Multi s Octave box is checked the OCTAVE Y A button setting written in the data will be recalled when you select the program etc If this box is not checked the OCTAVE V A setting will not change when you select the program etc the current setting will be maintained until you switch the octave yourself Preference Page Preference Multi Mode System Preference Memory Protect Multi Mode DAME O Frogram CO Orum Kit combi Q ArF UsrPat hutti O Ext Control LCD Contrast 36 Bank Map Gh Power
131. eloaded Programs x Multi sets User Drum Kits 40 Drum Kits 32 preloaded Drum Kits Preset Programs 128 GM preset programs nine GM2 preset drum programs Insert Effect 1 insert effect stereo in out Master Effects 2 master effects mono in stereo out Oscillator Programs Master EQ 1 master EQ 3 band stereo Effect types 89 effect types available for insert effects or master effects Effect dynamic modulation function Dmod Program mode one arpeggiator Combination and Multi modes two arpeggiators 40 240 Modulation Dual polyphonic arpeggiators A iat rpeggiators Number of arpeggio patterns Controllers OYSTICK OCTAVE YV J A KNOBS 1 4 REALTIME CONTROLS SELECT ABC Controllers 5 preset 251 user 251 preloaded ON OFF REALTIME CONTROLS C mode knobs 1 4 Buttons COMPARE AUDITION Knob VOLUME VALUE select ClickPoint lt 4 gt A JI V center Buttons OK CANCEL User Interface 122 Operating requirements for connection to a computer Audio Outputs 1 4 phone jacks unbalanced VOLUME slider controls only the MAIN OUT L MAIN OUTPUTS MONO and R jacks L MONO R Output impedance 1 1kQ stereo L MONO is 550Q for mono L MONO R 12 0 dBu INDIVIDUAL OUTPUTS 1 2 Maximum Level INDIVIDUAL OUTPUT 1 2 11 6 dBu Analog Load impedance 100 kQ or greater 1 8 mini stereo phone jack volume controlled by VOLUME slider linked with MAIN OUTPUT L Mono Headphones Ou
132. emental information such as specifications Parameter Guide The Parameter Guide contains explanations and other information regarding the operations of the parameters and settings on the microX The explanations are organized by mode and page Explanations and other information on the effects and their parameters are also provided for teach effect Refer to this guide when an unfamiliar parame ter appears in the display or when you need to know more about a particular function Conventions in this manual Abbreviations for the manuals OG PG In the documentation references to the manuals are abbreviated as follows OG Operation Guide PG Parameter Guide Procedure steps 1 2 3 This indicates the steps of a procedure Symbols 4 M Note These symbols respectively indicate a caution a MIDI related explanation a supplementary note Example screen displays The values of the parameters shown in the exam ple screens of this manual are only for explana tory purposes and may not necessary match the values that appear in the LCD display of your instrument MIDI related explanations CC is an abbreviation for Control Change Num ber In explanations of MIDI messages numbers in square brackets always indicate hexadecimal numbers Table of Contents Precautions 11 Aboutthismanual ili Quick Start
133. en arpeggiators A and B By using the COMBI 5 Ed Key Zone Key page and COMBI 6 Ed Vel Zone Vel page to set keyboard ranges and velocity ranges in conjunction with each other you can create even more variations If you wish to save the edited combination settings in internal memory turn off memory protect in Global mode and write the combination In the GLOBAL 0 System Preference page uncheck the Memory Protect Combination check box amp p 88 10 The Status MIDI Channel and Assign settings shown in the display of steps 2 and 3 can be made so that certain timbres will sound only when the arpeggiator is On and will be silent when the arpeggiator is not Off 97 Arpeggiator settings Setting examples Although this is a somewhat sophisticated editing technique we will describe the settings of one of the preset combinations as an example Combination B021 Urban Nature RnB Select combination B021 Urban Nature RnB and play it Before you play make sure that the global MIDI channel GLOBAL 1 MIDI MIDI Channel is set to 01 e Arpeggiator A is assigned to T timbre 4 and 5 When you play the keyboard the arpeggio pat tern Dr Nature RnB will sound only the T4 program Trance GarageKit e The arpeggio pattern uses the Fixed Note set ting which is appropriate when playing a drum arpeggio Fixed Note is checked in GLO BAL5 Arp Pattern Setup page With this
134. en playing the combination Begin multi track recording on your external MIDI sequencer and operate the microX s keyboard and controllers When you perform multi track recording the multiple channels sounded by the arpeggiator will also be recorded at the same time 10 When you ve finished performing stop recording Play back the recording and verify that it reproduces the sounds you heard while recording What you can do in Multi mode What you can do in Multi mode A multi set has sixteen tracks Each track consists of one program and parameters such as keyboard zone velocity zone mixer settings MIDI channel and filter settings See the illustration Multi set structure and corre sponding pages Multi mode has the following major functions e There are 128 multi sets Each set lets you assign a program to each of the sixteen tracks and you can combine these programs as splits and layers just as in a combination e Each multi set lets you make settings for one stereo insert effect two master effects and a stereo master EQ e You can use two arpeggiators and you can syn chronize them to your MIDI sequencer e By setting the Status of a track to INT or BTH you can play the microX from your exter nal MIDI sequencer as a multi track sound module PG p 55 Multi Mode e By setting the Status of a track to BTH EXT or EXT you can play an external sound module on the
135. encer and make settings that affect the entire microX such as transposition and tuning The largest unit used to organize these features is called a mode The microX has four modes Program mode Programs are the basic sounds of microX In Pro gram mode you can e Select and play Programs e Edit Programs Make detailed settings for oscillators filters amps EGs LFOs effects arpeggiator etc e Create drum programs using drum kits as cre ated in Global mode e Play and control one Arpeggiator p 43 Combination mode Combinations are sets of up to 8 Programs that can be played simultaneously letting you create sounds more complex than a single Program In Combination mode you can e Select and play Combinations e Use microX as a 8 track multitimbral tone gen erator e Edit Combinations You can use the Tone Adjust function to make simple edits for the program of a timbre Assign Programs to each of the 8 Timbres each with separate volume pan EQ and keyboard and velocity zones make settings for effects and Arpeggiator p 60 e Control and play up to two Arpeggiator Multi mode You can use the microX as a 16 track multi timbral sound generator The microX will receive GM or other performance data from an external MIDI sequencer and play back this data e Select and playback Multi sets e Edit Multi sets You can use the Tone Adjust function to make simple edits for the program of a track
136. equency using the Filter EG the LFOs keyboard tracking and other built in and MIDI controllers This is a great way to add a rich variety of tonal change to the sound Keyboard Track Most acoustic instruments get brighter as you play higher pitches At its most basic keyboard track ing re creates this effect by increasing the cutoff frequency of a lowpass filter as you play higher on the keyboard Usually some amount of key track ing is necessary in order to make the timbre con sistent across the entire range e When Ramp Low is set to a positive value the cutoff frequency will rise as you play lower on the keyboard making the sound brighter When set to a negative value the cutoff frequency will fall as you play lower on the keyboard making the sound darker e When Ramp High is set to a positive value the cutoff frequency will rise as you play higher on the keyboard making the sound brighter When set to a negative value the cutoff frequency will fall as you play higher on the keyboard making the sound darker 54 Int to A and Int to B adjust the effect that keyboard tracking will have on filters A and B For more details see 4 2a Keyboard Track PG p 17 Filter EG The Filter EG is a multi stage envelope which you can use to modulate the filter naturally as well as other Program parameters The EG itself is set up on the Filter page the way tha
137. er EQ These settings are made in the same way as for programs p 83 Specifying the MIDI channel that will control effects Insert effect You can specify the MIDI channel that will control the insert effect dynamic modulation Dmod and the Pan CC 8 Send 1 MFX1 and Send 2 MFX2 settings that follow the insert effect An asterisk is shown at the right of Ch01 16 for the channel numbers of timbres that are routed to IFX If multiple timbres tracks of different MIDI channels are routed to IFX set the Control Channel to specify the channel you ll use to con trol the effect For a combination you will normally use the Gch global MIDI channel to control the effect For a multi set you can use any MIDI channel that is convenient All Rt stands for All Routed indicating that you can control the effect using the channel of any timbre track that is routed Master effects You can specify the MIDI channel that will control dynamic modulation Dmod for the master effects For a combination you will normally use the Gch global MIDI channel to control the effects For a multi set you can use any MIDI channel that is convenient Dynamic modulation and BPM MIDI Sync Dynamic modulation Dmod is a function that lets you use MIDI messages or the microX s controllers to control specific effect parameters in realtime BPM MIDI Sync is another function that controls effect
138. ers in any mode If the EXT CONTROLLER button is on changing programs in Program mode or switching to Combination mode etc will not affect the control set This means you can select another sound on the microX without changing the way you re controlling an external MIDI device or conversely you can change the way you re controlling an external MIDI device without switching sounds on the microX 111 External control settings External control setups You will use Global mode to create external con trol setups Selecting an external control setup The content that you edit in Global mode is preserved until you turn off the power but will be lost when the power is turned off There are four types of data that you manage in Global mode user drum kit settings GLOBAL 4 user arpeggio patterns GLOBAL 5 external control settings GLOBAL 6 and all other global set tings GLOBAL 0 3 You can write each of these into its own memory area and assigning control changes 1 Press the GLOBAL button to enter Global mode Access the GLOBAL 6 Ext Control Knob A page Ch Gch CCHBT1 Ch Gch ECHBBS Ch Gch CCHATA Use Setup Select to select the external control set that you want to edit Use Knob 1 A MIDI Channel to select the MIDI channel on which you want to transmit the message Next use Knob 1 A CC Assign to specify the MIDI control change CC that you want
139. et Then contact your nearest Korg dealer or the store where the equipment was pur chased THE FCC REGULATION WARNING for U S A This equipment has been tested and found to comply with the limits for a Class B digital device pursuant to Part 15 of the FCC Rules These limits are designed to provide rea sonable protection against harmful interference in a resi dential installation This equipment generates uses and can radiate radio frequency energy and if not installed and used in accordance with the instructions may cause harm ful interference to radio communications However there is no guarantee that interference will not occur in a particular installation If this equipment does cause harmful interfer ence to radio or television reception which can be deter mined by turning the equipment off and on the user is encouraged to try to correct the interference by one or more of the following measures e Reorient or relocate the receiving antenna e Increase the separation between the equipment and receiver e Connect the equipment into an outlet on a circuit differ ent from that to which the receiver is connected e Consult the dealer or an experienced radio T V technician for help Unauthorized changes or modification to this system can void the user s authority to operate this equipment CE mark for European Harmonized Standards CE mark which is attached to our company s products of AC mains operated apparatus unti
140. eter can be especially useful for drum programs since it lets the samples ring out naturally regardless of how long you hold down the note The way that this works depends on settings in both the Program and the Drum Kit as described below To enable Hold 1 2 Access the PROG 1 Ed Basic Prog Basic page Voice Assign make sure that the Hold check box is checked Once you ve turned on Hold for the Program the function is controlled on a note by note basis according to settings within the Drum Kit Access the GLOBAL 4 DKit Voice Mixer page GLOBAL d Dit Voice Mixer Note off Receive Crum Kit 32 User3 OFUMKit3s2 LLELLLELLELLLELLELLLALLELLLELLELLLELLELLLELLELLLELLELLLELLELLLELLELLLELLELE Cd ElAzsigna Level H 66 L 68 Hel SWU L H 061 Enable Hote on ParmChed S1 127 LIJEnable Hote Of Bees 52 127 sihgle Trig For each key set the Enable Note Off Receive parameter as desired If this check box is unchecked the key will be held If it is checked the key will not be held If you turn off Hold in the Program no keys will be held regardless of their Enable Note Off Receive setting 109 Using Drum Kits Controlling effects for each key A drum kit lets you set the insert effect and master effect send for each key 1 Access the PROG 8 Ed InsertFX BUS page 2 Make sure that the Use DKit Setting check box is checked When Use DKit Setting
141. f each timbre 1 Access the COMBI 0 Play Mixer page This page shows the pan and volume settings for the programs assigned to timbres 1 8 Bass Ladd ieResaeCeb ace ob a TeCHb A TECRE Ace BB 3 Bas sl ee 8 12 7 BE eee E 2 Use the ClickPoint PE A Y to highlight the Pan of the timbre whose pan setting you want to adjust and use the VALUE dial etc to adjust the setting A setting of C064 is center L001 is far left and R127 is far right With a setting of RND the stereo location will change randomly between left and right each time a note is played REALTIME CONTROLS 1 2 3 4 SELECT Adjusting the volume Here s how to adjust the volume of each timbre 1 Access the COMBI 0 Play Mixer page 2 Use the ClickPoint lt A Y to highlight the Volume of the timbre whose volume setting you want to adjust and use the VALUE dial etc to adjust the setting Adjusting the volume while preserving the volume balance between timbres 1 Press the UTILITY button to access the utility menu 2 Use the ClickPoint A Y to select Hold Balance and press the ClickPoint center The upper right of the display will indicate Hold Bal Mixer Volume wg H92 Drum 3 When you change the Volume value of any timbre the volume of all timbres will also change to preserve the volume balance at the time you checked the Hold Balance setting 4 T
142. f you select a stereo input type effect the input will be monaural 3 In MFX1 On Off and MFX2 On Off switch each master effect on off If this is Off the output of the master effect will be muted 4 In Return 1 and Return 2 adjust the output level of each master effect For each effect the W value of W D Wet Dry is the effect output level This is multiplied by the return value Rtn 127 is x1 0 to determine the actual master effect output level 5 Specify the routing of master effects 1 and 2 If the MFX Chain check box is checked MFX1 and MFX2 will be connected in series The settings described below are valid if this check box is checked Chain Direction specifies the direction in which MFX1 and MFX2 will be connected Chain Signal specifies whether the signal sent from one master effect to the other will be stereo or only Lor R Chain Level specifies the level at which the signal is sent from one master effect to the other master effect Send1 Send2 L RBUS AUDIO OUTPUT stereo MAIN L MONO R M MEX Chain abated Returnl 2 V mono Send1 Send2 L R BUS AUDIO OUTPUT stereo MAIN L MONO R Return1 2 mO stereo Master MEX Chain Effects Chain Signal Chain Direction Stere LR Mix MFX1 MFX2 Send1 Send2 L R BUS AUDIO OUTPUT stereo MAIN L MONO R _ Master MEA Chala Effects
143. face or MIDI connectors The microX supports Windows XP and Macintosh OS X 10 3 or later microX Plug In Editor supports edit ing from within your DAW software The microX Editor is a stand alone program that lets you edit the microX from your Macintosh or Windows computer On the other hand the microX Plug In Editor lets you edit the microX as a plug in instrument from within a host application such as DAW Dig ital Audio Workstation software It supports VST Audio Units and RTAS formats Both editors are included with your microx Front and rear panel Front and rear panel Front panel PROGRAM PAGE PAGE A B c D E GM p SLOWSYNTH FASTSYNTH LEAD SYNTH MOTIONSYNTH KEYBOARD GUITAR COMBINATION B c CATEGORY J I I VOLUME PROGRAM SLOW SYNTH FASTSYNTH LEAD SYNTH MOTION SYNTH COMBINATION A B C KEYBOARD GUITAR CATEGORY 10 MULTI GLOBAL COMPARE EXIT CANCEL MENU OK UTILITY Y OCTAVE A ALIIACHA o L lt SYNTHESIZER CONTROLLER R I I I SeKV I I OIO IS II IIII II III I IOIIIIIII I K IIuIIW I II II IIIIIIIIS I III IIAIAIAMGII IIPI S REALTIME CONTROLS 2 3 4 A PF CUTOFF RESONANCE HPF EG INTENSITY EG RELEASE 1 2 3 4 CATEGORY AUDITION ARP ON OFF CONTROLLER O O e FAN SELECT 2 gt C O C O
144. g etc to combine up to eight pro grams together with the effects and the two arpeg giators in order to create complex sounds that could not be produced by a program You can also create combis that include external tone genera tors Effects that can creatively manipu late the sound or generate subtle ambience The microX s effects can be used in many ways ranging from manipulating the sound dramati cally to creating spacious reverberation p 9 High quality sound featuring the HI synthesis system 4 channel audio outputs In addition to the MAIN OUTPUT L MONO and R main stereo audio outputs microX provides two individual audio outputs for a total of four channels of audio output The sound from each oscillator drum timbre track or insert effect can be routed freely to any output Multi mode plays multiple tracks of data from an external sequencer In Multi mode the microX can operate as a 16 track MIDI multi timbral sound module receiving multiple tracks of performance data from an exter nal sequencer or similar device Since you can use the effects and the two arpeggiators as well the microX will also function as a more advanced sound module You can create save and recall numerous Multi sets in the microX and it also supports GM Gen eral MIDI System Level 1 making it easy to use as a sound module for a desktop music system Dual polyphonic arpeggiator Five preset arpeggio patterns UP DOWN
145. g you should choose when using the microX as a master keyboard In this case when you switch multi sets on the microX tracks whose Status is EXT or BTH will transmit program changes and other MIDI messages to set up your external MIDI sound module Making settings in Global mode Here s how to set parameters in Global mode 1 Press the GLOBAL button the button will light to enter Global mode 2 Press the MENU OK button to access the page menu 33 Setup Global PAGE MERU category Name Arpeggio Patternj Ext Control 3 Use the ClickPoint lt 4 A Y to select a page and press the ClickPoint center e Local Control On MIDI Filter Exclusive Convert Position Choose MIDI if you want to make these settings The GLOBAL 1 MIDI page will appear GLOBAL 1 HIpl HIDI Local Control on FID Chane A HIDI Filter Hote Receive All Hl Enable Program Charge MIDI Clock Auto EIRT FIBank m Combi Convert Position PreMiol 8 fterT IL al Control or E Exc Tusgiue Ctr Change e Multi Mode Choose System if you want to make these settings One of the GLOBAL 0 System pages will appear Use the PAGE PAGE buttons to select the Preference page Preference Multi Mode System Preference Hemory Protect Multi Mode Bank Map Gh CIArp UsrPat Power On Mode Reset Mutti O Est Control Page Menu Style icon LCD Contrast 36 I Fet 4 Use the ClickPoint
146. ghlight Drum Kit Use the VALUE dial to select a drum kit 50 FROG 1 Ed Basic OSC 1 Drum kit 0401 Drum Kit Pe TENE a aj Lena tE iTrahspose 88 ii rat i TURE 808 eerie i Delay BEBE ms orca aiti es E Y Standard Kit 1 5 Specify the basic pitch of the oscillator For a drum kit set Octave to 0 8 Using LFOs and Envelopes EGs Using LFOs Each Oscillator has two LFOs LFO1 and LFO2 You can use these LFOs to modulate many differ ent Program parameters including e Pitch vibrato PROG 2 Ed Pitch OSC1 LFO Intensity and the same parameter of the OSC2 LFO e Filter wah effect PROG 4 Ed Filter1 LFO Mod Intensity to A and to B and the same parameters for PROG 5 Ed Filter2 e Volume auto tremolo PROG 6 Ed Amp1 2 Mod LFO1 Mod Intensity and the same parameters for LFO2 Mod In addition to the uses described above you can use an LFO as a source for Alternate Modulation and Effect Dynamic Modulation to modulate a wide range of parameters By assigning an LFO to Pan AMS PROG 6 Ed Amp1 2 Level Pan you can create an auto pan effect Basic LFO settings Note Depending on the program you ve selected you may be unable to hear the result of the following edits If so increase the value of one of the Intensity parameters listed above so that you can hear the result For example in order to use OSC1 LFO1 to modu
147. has been completed Then turn the power of the microX off and on again and repeat this procedure from step 1 2 Use the VALUE dial to adjust the LCD contrast 3 Press the MENU OK button The LCD contrast setting will be memorized Note Other global settings will also be memorized at this time The power is turned on but the display does not display normally or an error message is displayed There is no sound when you play the keyboard and the microX does not function normally L This type of problem may occur if a data writ ing operation to internal memory was not com pleted correctly for example if the power of the microX was turned off while a program or other data was being written If this occurs use the following procedure to initialize the microX s internal memory 1 Turn off the power 2 Hold down the ENTER button and the 0 button and turn on the power The microX will be initialized and the factory preload data will be written into internal memory While the data is being written the display will indicate Now writing into internal memory Audio output No sound LI Are connections made correctly to your amp mixer or headphones LI Is your amp or mixer turned on L Is Local Control turned on In GLOBAL 1 MIDI check the Local Control On check box PG p 82 LI Is the VOLUME knob raised p 12 LI If there is no sound from the INDIVIDUAL OUTPUT 1 2 jacks make sure th
148. he sostenuto effect Turn the soft pedal effect on off Arpeggiator on off Select programs or combinations up down Tap tempo Aftertouch transmission The functions of controllers such as the joystick or knobs 1 4 PG p 164 MIDI related settings 1 MIDI Assignable Pedal You can specify the function of an assignable pedal such as the optional XVP 10 EXP VEL pedal or EXP 2 foot controller connected to the ASSIGNABLE PEDAL jack e This is set by Foot Pedal Assign You can choose from the following functions Master volume Alternate modulation source Effect dynamic modulation source Portamento pitch change speed Volume The pan following an insert effect Pan Expression Send levels to the master effects Aftertouch transmission Duplicate the function of another controller such as the joystick or knobs 1 4 PG p 165 Note You can use this as a source for alternate modulation or effect dynamic modulation and use it to control program parameters or effect parameters In this case set Foot SW Assign to Foot SW CC 82 and Foot Pedal Assign to Foot Pedal CC 04 MIDI related settings 1 MIDI GLOBAL 1 HIpl FID Chane EW MIIDI Filter Mote FBeceiue All PF Enable Program Change MID Clock Auto EIRT FIBanE Wlcombi PFIAfterT Ctr Change FIESC sive HIDI MIDI Channel Convert Position Premio FlLocal Control oF MIDI Setup MIDI Filter Here you can make MIDI rel
149. his page you can also make BUS Select settings Use the ClickPoint to choose All OSCs and use the VALUE dial etc to make a selection Insert Effect BUS Select Send2 MFX2 IFX On Off Pan CC 8 Send1 MFX1 oc 2 Ea dlfinzertEx az rnan a SST omp essar CB64 LAR 51 127 52 127 CAN 302 Fe jit Compressor E l setup II IF BUS Select IFX On Insert Effect 82 PROG 9 Master FX r sal L R BUS Post IFX ii AUDIO OUTPUT Send1 2 MAIN L MONO R AUDIO OUTPUT INDIVIDUAL 1 2 C PROG 9 Master FX Send1 Send2 L R BUS ost IFX F AUDIO OUTPUT si 12 MAIN L MONO R gt AUDIO OUTPUT INDIVIDUAL 1 2 In Insert Effect select the desired insert effect You can press the CATEGORY button and choose an effect from six categories In IFX On Off turn the insert effect on off If this is set to Off the result will be the same as if 00 No Effect is selected The input sound will be output without change Note You can use the Utility Copy Insert Effect to copy effect settings from another program etc Set the Pan CC 8 BUS Select S1 Send1 MFX1 and S2 Send2 MFX2 parameters that follow the insert effect Pan CC 8 Set the pan This is valid only if BUS Select is set to L R BUS Select Specify the output destination Normally you will set this to L R If you want to output the sound fr
150. ic pitch of the multisample use the Octave parameter in the PROG 1 Ed Basic OSC1 or OSC2 page Varying the pitch according to key board position Pitch Slope On keyboard instruments such as piano or organ the pitch will rise as you play toward the right side of the keyboard and fall as you play toward the left You can use the Pitch Slope setting to specify how this will occur With positive settings the pitch will rise as you play toward the right side of the keyboard With negative settings the pitch will fall as you play toward the right side of the keyboard Normally you will leave this set to 1 0 Modulating the pitch PROG Z Ed Pitch OSC 1 Fitch Slope Pitch Fitch Slope EARS Joc te 82 AMS OFT Fibburi 163 06 JS 02 lnitensity BB BD osti Mosito ote Mozelo EG Pitch bend The JS X and JS X settings specify the amount of pitch change in semitones that will occur when MIDI pitch bend messages are received or when the joystick is moved to left or right A setting of 12 allows the pitch to be con trolled a maximum of one octave upward a set ting of 12 allows the pitch to be controlled a maximum of one octave downward Ribbon 16 specifies the amount of pitch change in units of a semitone that will occur when CC 16 is received or when you operate the ribbon controller of a connected TRITON Extreme or similar device Portamento Portamento
151. ied to each timbre track The master effects are used to apply overall spa tial processing and the master EQ is used to make overall adjustments in tone These settings are made in Combination mode independently for each combination and in Multi mode for each multi set the entire mode COMBI 8 Ed InsertFX e BUS and master effect send level settings for each timbre e Insert Effect routing selection and settings COMBI 9 Ed MasterFX e Master Effect selection and settings e Master EQ settings MULTI 8 InsertFX e BUS and master effect send level settings for each track e Insert Effect routing selection and settings MULTI 9 MasterFX Master Effect selection and settings e Master EQ settings Sen Timbre 1 Track 1 Insert Effect Timbre 2 Track 2 e Timbre 8 Track 16 Return Master Effect 1 2 L MONO R Effect types You can choose from 89 types of full digital effects for each effect The effects are categorized as fol lows Categories of the 89 effect types Efecto Effect types 01 15 Filter and dynamics effects such as EQ and compressor 16 31 Pitch and phase modulation effects such as chorus and phaser 32 40 Other modulation and pitch shift effects such as rotary speaker and pitch shifter 41 51 Early reflection and delay effects 52 57 Reverb effects 58 89 Mono and mono chain effects in which two mono effects are connected in series Here we will describe
152. iler com puter or to a second microX unit PG p 83 The following data can be transmitted via MIDI data dump to an external data filer or similar device e Programs combinations multi sets global set tings user drum kits user arpeggio patterns external control sets Using the microX Editor Plug In Edi tor control plug in software to save data You can use the microX Editor Plug In Editor control plug in to save microX data For more details see Editor Plug In Editor Manual PDF 117 Appendices About the Edit Buffer About the memory in Program Com bination and Multi modes When you select a program combination or multi set in PROG 0 Play COMBI 0 Play and MULTI 0 Play the data of the selected program combina tion or multi set is called into the microX s edit buffer When you edit the parameters in pages such as 0 Play your editing will modify the data in the edit buffer If you wish to save this modified data into internal memory you must perform the Write operation When you perform the Write operation the data in the edit buffer is written to the specified pro gram number combination number or Multi set number of the specified bank If you select another program combination or Multi set number without writing the data of the newly selected program combination or multi set number will be called into the edit buffer and your changes will be lost
153. ing INDIVIDUAL OUTPUT 1 and 2 If desired you can connect these two individual independent outputs They are unbalanced phone output jacks These jacks allow you to send the microX s sounds to external equipment independent of the MAIN OUTPUT L MONO and R jacks This can be con venient when recording or when using a complex live performance setup 1 Connect the INDIVIDUAL OUTPUT 1 and 2 jacks to the input jacks of your mixer etc Note The VOLUME knob does not affect the volume of jacks 1 and 2 Note The sound will be sent from these jacks if you set BUS Select to 1 2 or 1 2 Powered monitors Power switch Headphones i PHONES micro gt lt 25 Setup Headphones PHONES Powered monitors ll lll 1 When using headphones plug them into the headphones Jack located on the front panel Use the VOLUME knob to adjust the volume of the headphones The microX s headphone jack carries the same signal as the MAIN OUTPUT L MONO and R output jacks Note If you want to monitor the INDIVIDUAL OUTPUT 1 and 2 jacks in addition to the main outputs an external mixer may be required 26 Connecting a damper pedal foot switch or foot pedal
154. ing even after you take your hand off the keyboard or stop playing when you take your hand off the keyboard e Use the ClickPoint to select the Latch check box and press the center Checked The arpeggio will continue playing even after you remove your hand from the keyboard Unchecked The arpeggio will stop playing when you remove your hand from the keyboard Synchronizing the arpeggiator to your keyboard timing or to the tempo Key Sync Key Sync specifies whether the arpeggio pat tern will begin the moment you play the key board or always follow the tempo in synchronization with the MIDI clock e Use the ClickPoint to select the Key Sync check box and press the center 94 Checked When you take your hands completely off of the keyboard the arpeggio pattern will immediately start over from the beginning in sync with the first key you press This setting is suitable when you want the arpeggio to start from the beginning of the measure as you are playing in realtime Unchecked The arpeggio will always be synchronized to the MIDI clock tempo Selecting whether to hear the arpeggi ated notes the notes you physically play on the keyboard or both Key board Use the ClickPoint to select the Keyboard check box and press the center Checked The notes you play on the keyboard and the notes played by the arpeggiator will both sound Unchecked Only the arpeggiated notes will sound
155. ings in COMBI 2 Ed Tim bre Param Pitch Transpose Detune BPM Adjust These parameters adjust the pitch of the timbre Ina layer type combination you can set two or more timbres to the same program and create a richer sound by using Transpose to shift their pitch apart by an octave or by using Detune to create a slight difference in pitch between the two Insplit type combinations you can use Trans pose to shift the pitch in semitone units of the programs specified for each key zone If you wish to change the playback pitch of a drum program use Detune If you change the Transpose setting the relationship between notes and drum sounds will change Adjusting the BPM of multisamples If you re using a phrase or rhythm loop multisam ple in the program of a timbre you can adjust its BPM You can use the utility menu Detune BPM Adjust to call up a new BPM value This changes the BPM by adjusting the playback pitch For more details see Detune BPM Adjust PG p 41 Specifying the range of pitch change controlled by the joystick X X This is specified by the Bend Range You can specify the range in semitone units With the PRG setting the pitch bend range will be as specified by the program a ase tte You can make these settings in COMBI 2 Ed Tim bre Param Other Delay You can set some Timbres so that they don t sound immediately at no
156. ion see p 91 Saving your edits Once you ve tweaked the sound to perfection you ll want to save your work To save your edits amp Be aware that if you modify the sound of a program or write it to a different bank or number and then use a combination that uses the modified program the combination will sound different 1 Press the UTILITY button to access the utility menu 2 Use the ClickPoint to select Write Program and then press the ClickPoint center The Write Program dialog box will appear Write Program Agee Gt Kombat Category 12 Motions ynith To ABBA Kombat Cancel Note If the display indicates Memory Protected the program memory protect is turned on Go to GLOBAL 0 System Preference page and uncheck the Memory Protect Program setting p 88 Optionally you can also select a new location or change the Program s name If you want to change the bank and number of the writing destination use the ClickPoint to select the program name located at the right of the To and use the VALUE dial to select the desired writing destination Note You can t save in banks G or g d If you want to change the name use the Click Point to select the text button 4 and then press the ClickPoint center to open the text edit dialog box You can give the Program a descriptive name using the on display keyboard p 114 After entering the name press MENU O
157. ion to a lil SDT A E E A N 12 What you can do in Multi mode 73 Usime CO OC u u u wean 74 Altering Programs to fit within a Multi set 74 Layers Splits and Velocity Switches 15 ESC e A A E A E A 75 Paving VOUT Edise 75 Cont lvia NIIDI uq awwasaqusctaaesscasasqayqausqas iis Effects settings 79 Effects in each made uuu u aus aaahe 79 PUCCI eien E sees 79 Effect settings for a program 81 Effect settings in combination and Multi 84 Dynamic modulation and BPM MIDI Sync 85 Saving edited efiect settings uu wisa ss 86 Bypassing the insert effect or the master CO a A a ua 86 Global Mode 87 How Global mode is structured 87 Sys eniselnp Syst siisi 87 MIDI related settings 1 MIDI 89 Creating user scales 2 User Scale 89 Setting category names J CODI INIT n a 90 Saving the global settings 90 Drum kit 4 DKit Arpeggiator 5 Arp Pattern External Control 6 Ext Controlsettings 90 Arpeggiator settings 91 Arpeggiator features in POC TA MOdE esri E 91 The arpeggiator in Combination and Multi MOIES spe aun a 95 Creating a user arpeggio pattern 99 Savino a USEE arped Oepie 104 Synchronizing the arpeggiator
158. k setting specifies the track that is played by the microX s keyboard and controlled by its controllers Data on the MIDI Channel of the Control Track will play the microX s internal tone generator according its track settings pro gram level etc if the track s Status is INT or BTH and will also play any other tracks on the same MIDI channel whose Status is INT or BTH If the Status is EXT EX2 or BTH these mes sages will be transmitted on the MIDI channel specified by the track MIDI filter settings Each MIDI filter item specifies whether the corre sponding MIDI message will be transmitted and received The message can be transmitted and received if the check box is checked p 64 MIDI filter settings 71 Using and Editing Multi sets Copying the settings of a combination to a multi set You can copy the settings of a combination to a multi set If you have a favorite combination this function provides a convenient way to copy those sounds to the tracks of a multi set Note Set the global MIDI channel GLOBAL 1 MIDI MIDI Channel to 01 1 Select a multi set p 69 Selecting a multi set 2 Choose the Copy From Combi utility A dialog box will appear Copy from Combination Combi With Effects Ta Tracki to IAUtO adjust Arpeggio setting 3 Use the Combi field to select the combination that you want to copy 4 If you
159. l Control Off message sent from the editor when you start up microX Plug In Editor MIDI IN MIDI OUT MIDI IN MIDI OUT USB USB USB USB Trigger 80 SECHIOn Sequencer or computer Echo Back on 1 This connection isbroken when you turn Local Control off MIDI Filter Exclusive setting If you want the microX to transmit and receive system exclusive data you must check the GLO BAL 1 MIDI page MIDI Filter Exclusive check box Check this box if the microX is connected to your computer and you want to edit the microX from your computer or bi directionally You must also check this box if you re using the microX Editor Plug In Editor By default the MIDI Filter Exclusive setting is checked The Convert Position setting On the microX the parameters Key Transpose and Velocity Curve GLOBAL 0 System Basic page allow you to transpose the pitch adjust the velocity sensitivity The Convert Position setting GLOBAL 1 MIDI page specifies the point at which these settings affect the data from the keyboard and the data sent or received via MIDI IN USB or MIDI OUT USB e When controlling an external MIDI tone gener ator from the microX select Pre MIDI The above listed settings will affect the MIDI data that is transmitted Incoming MIDI data will be handled with settings equivalent to Key Transpose 0 and Velocity Curve 4 e When controlling the microX
160. l December 31 1996 means it conforms to EMC Directive 89 336 EEC and CE mark Directive 93 68 EEC And CE mark which is attached after January 1 1997 means it conforms to EMC Directive 89 336 EEC CE mark Directive 93 68 EEC and Low Voltage Directive 73 23 EEC Also CE mark which is attached to our company s products of Battery operated apparatus means it conforms to EMC Directive 89 336 EEC and CE mark Directive 93 68 EEC Apple Mac and Audio Units are trademarks of Apple Computer Inc registered in the US and other coun tries Windows XP is a registered trademark of Microsoft Cor poration in the U S and other counties VST is a trademark of Steinberg Media Technologies GmbH RTAS is a registered trademark of Avid Technology Inc or its subsidiaries or divisions All other product and company names are trademarks or registered trademarks of their respective holders About this manual The owner s manuals and how to use them The microX come with the following owner s manuals e Operation Guide e Parameter Guide included in the CD ROM Operation Guide Please read this first It explains the names and functions of each part of the microX how to make connections basic operation an overview of each mode and how to edit sounds This guide also explains the arpeggiator function effects and drum kits The Operation Guide also contains troubleshoot ing information and suppl
161. l decrease 24 dB in one octave i e as the frequency doubles A 12 dB oct filter would decrease the gain 12 dB in one octave The 24 dB oct filter produces a steeper cut Low Pass Level Frequency High pass filter This type of filter passes the high frequency range and cuts the low frequency range Use this when you wish to make the sound thinner However if the cutoff frequency Frequency is raised exces sively high the volume will become very low High Pass Level 12dB oct Resonance When Resonance is set to a higher value the overtones in the region of the cutoff frequency will be boosted as shown in the diagram below giving a distinctive character to the sound When resonance is applied Low Pass Low resonance value lt value High resonance When this is set to 0 there is no emphasis and fre quencies beyond the cutoff will simply diminish smoothly At medium settings the resonance will alter the timbre of the filter making it sound more nasal or more extreme At very high settings the resonance can be heard as a separate whistling pitch To make the resonance track the keyboard pitch see 4 2a Keyboard Track PG p 17 Selecting a filter to modify the tone Here s how to select a filter type and adjust the Frequency cutoff frequency and Resonance resonance level 1 Use Type to select a filter type Low Pass Resonance This is a 24
162. l scale To do so use the Copy Scale utility 2 Press the MULTI button to enter Multi mode 3 Press the MENU OK button choose Track Param from the PAGE MENU and then press the PAGE button to access the 2 Track Param Other page MULTI 2 Track Param Other Use Frog s Scale El ksub EjrFzub Eq kcub Fd POORER BOGE DDD ORE aAA gaha Boe ABDA OFRG PRG iO PRG PRG ID PRG CJPRG CIPRG HHIDL 2 MID de ost lose 46 JIFteh 2 Fteh 45 0thr 2 othr 1 Global Mode 4 If you want the Track to use the scale saved with its individual Program check the track s Use Prog s Scale check box Tracks that are not checked will use the scale specified by Scale Type Multi s Scale 5 Set Type Multi s Scale to select the scale for the currently selected song Setting category names 3 Category Name Program Combination Category The Category Name pages let you assign names to the Program and Combination categories amp PG p 86 90 Saving the global settings When you ve finished editing in the Global mode you ll need to write save your settings amp The edits you perform will be lost when the power is turned off unless you save them 1 Select one of the GLOBAL 0 System 3 Category Name pages 2 Press the UTILITY button to access the utility menu and choose Write Global Setting 3 To write save your settings p
163. late filter 1 you should increase the PROG 4 Ed Filter1 LFO Mod LFO1 Intensity to A or Inten sity to B value 1 Access the PROG 3 Ed LFOs OSC1 LFO page PROG 3 Ed LFOs Wavertor m UELLE O5C1 LFO1 Waveform Josiurew cree IZLF91 a U S 2 Select the Waveform parameter 3 Use the VALUE dial etc to select the desired LFO waveform The display shows a graphic of the waveform Using Alternate Modulation There are a number of waveforms to choose from Each are suited to different applications Triangle and Sine are the classic LFO shapes for vibrato tremolo panning and filter wah effects Square is useful for gated filter and amp effects and creates a police siren effect when modulating pitch The Guitar waveform is designed especially for guitar vibrato since it bends only upwards from the base value Saw and Exponential Saw Down are good for rhythmic filter and amp effects Random 1 S H creates the classic sample and hold effect which is great for modulating a resonant filter 4 After looking at the different waveforms select Triangle 5 Use the Frequency parameter to set the speed of the LFO 6 Use the Fade and Dly Delay settings to control the way the LFO sounds at the beginning of the note For more information on LFOs see PROG 3 Ed LFOs PG p 14 All of these parameters control the way that the LFO itself w
164. lation etc Move the joystick up down or left right Y Y X X to control r p 40 Various program parameters and effect parame ters will determine what is controlled by the joy stick 13 OCTAVE OCTAVE V A buttons These buttons change the pitch range assigned to the keyboard over a 3 octave range in one octave steps p 41 14 Headphone jack This 1 8 mini stereo phone jack carries the same signal as the MAIN OUTPUT L MONO R jacks The headphone volume is controlled by the VOL UME knob 13 Introduction Rear panel 1 AUDIO OUTPUT Connect these outputs to the input jacks of your amp or mixer In addition to the MAIN OUTPUT L MONO and R main stereo audio outputs the microX provides two individual audio outputs p 25 MAIN OUTPUT L MONO R jack INDIVIDUAL OUTPUT 1 2 jack 2 PEDALS You can connect a damper pedal foot switch and foot pedal to these jacks This gives you a broader range of functions and effects to control p 26 ASSIGNABLE PEDAL jack ASSIGNABLE SWITCH jack DAMPER jack 3 MIDI MIDI lets you connect microX to computers or other MIDI devices for sending and receiving notes controller gestures sound settings and so on p 35 MIDI IN connector MIDI OUT connector 4 USB USB connector for connecting to computer You can connect your computer to this connector Using a single USB cable your microX can send and receive MIDI i
165. le if you set Velocity SW L gt H to 100 playing the keyboard softly will sound the Low multisample and playing strongly will sound the High multisample 6 Adjust the Level for High and Low multisamples to set their volume balance Note If you do not wish to use this function set the Velocity SW L H value to 001 Only the High multisample will sound Reverse check box Reverse lets you play the selected multisample backwards without looping This can produce interesting results for sound effects or other unusual timbres Normally you will not check this Using oscillators 1 and 2 to create a detuned sound You can use a double program i e a program whose Oscillator Mode is Double to create a detuned sound as follows 1 Make the same multisample and EG settings etc for OSC1 and OSC2 It will be convenient to use the Utility Copy Oscillator to make the oscillator settings match each other 2 Specify the playback pitch for OSC1 and OSC2 The playback pitch can be set independently By using the same multisample with slightly different Tune settings you can detune the oscillators to produce a richer sound Generally speaking people hear flat notes as sounding sour or out of tune more easily than they do sharp notes So when detuning two oscillators it may sound more musical to tune one oscillator up in pitch and leave the other oscillator close to
166. light change in pitch that occurs when a string is plucked or at the attack of a brass or vocal sound you can use the EG to create a subtle change in pitch at the attack PROG 2 Ed Pitch L SPE Aso T A 99 D499 Pitch EG Start Level 66 5 8 A i Time AMS Sh 1 20 i456 5 6 A Bod 393 Ast D _oze1_Mostivoll_ este Mostro EG Using Filters Using Filters The filters allows you to diminish or emphasize specified frequency areas of the sound The tone of the sound will depend significantly on the filter settings microX provides Filterl for OSC1 and Filter2 for OSC2 For each of these filters you can select from two types Low Pass Resonance or Low Pass amp High Pass Filter2 can be used if Mode Oscilla tor Mode is set to Double Level Overtones included in the original multi sample Frequency pitch bh VW Filter characteristics This area of overtones j will be diminished Overtones after passing through the filter Level Frequency pitch Filter Types This selects the parts of the sound which will be affected by the filter as described below Low pass filter This is the most common type of filter which passes the low frequency range and cuts the high frequency range When the overtones of the high range are cut a bright sound will become darker more mellow 24 dB oct and 12 dB oct see the steepness of the cut 24 dB oct means that the gain wil
167. ll change accordingly With the default settings you can control the fol lowing parameters LPF Fc Adjusts the low pass filter cutoff frequency of program OSC 1 2 This will affect the brightness of the sound 67 Playing and Editing Combinations Reso HP Adjusts the resonance level of the low pass filter or the cutoff frequency of the high pass filter for program OSC 1 2 The parameter that is controlled will depend on the filter type specified for the program F EG Int Adjusts the filter EG intensity the depth of the filter EG for program OSC1 2 A EG A Adjusts the EG attack times of the pro gram OSC 1 2 filter and amp To maximize the result of this adjustment the Amp EG sustain level attack level start level modulation and attack time modulation will also be adjusted at the same time A EG D Adjusts the EG decay time and slope time of the program OSC 1 2 filter and amp A EG R Adjusts the EG release time of the pro gram OSC 1 2 filter and amp 68 Effects Effects are covered in their own section of the manuals so we won t go into too much detail here p 79 Insert Effect You can make settings for the insert effect in the COMBI 8 Ed InsertFX page The output of each timbre can be sent to the insert effect You can use any type of effects from distor tions and compressors to choruses and reverbs The Insert Effect can be routed to the main out puts or to any of the individual outp
168. ll not be written saved Assigning a program to a track and setting the volume and pan Adjusting the pan stereo position Here s how to adjust the pan of each track 1 Access the MULTI 0 Play Mixer page This page shows the pan and volume settings for the programs assigned to tracks 1 16 Mixer Pan 000 Poap Ballade d 120 Drum Eaz 4 agita E slow Eq quita E nuita E Strin CARATE EdT LAdA FHD PASE CABATEC CAET 126a o HIF gl 116a HJE al age ee ete Crt Freg 2liPreg tell Mint ees a ECT 2 Use the ClickPoint to highlight the Pan of the track whose pan setting you want to adjust and use the VALUE dial etc to adjust the setting A setting of C064 is center L001 is far left and R127 is far right With a setting of RND the stereo location will change randomly between left and right each time a note is played Adjusting the volume Here s how to adjust the volume of each track 1 Access the MULTI 0 Play Mixer page 2 Use the ClickPoint to highlight the Volume of the track whose volume setting you want to adjust and use the VALUE dial etc to adjust the setting Status and MIDI channel MULTI 2 Track Param MIDI Status Eass Fine Kauna Fisun guita guita strin ETH ETH ETH ETH ETH 85 1 Ba se w Br Status ETH ER iG m e ripa 056 2 Jost 36 IFten 2 Ften iello thra thre Tal Baise Standard it 1 Status This specifies the MIDI stat
169. ller settings 7 Ed Arp Ctrls e Select the BUS and master effect send level for the oscillator output e Insert Effect routing selection and settings l e Master Effect selection and settings R RETE Master EQ settings For details on how to access each mode page and the utility commands and how to edit values see Basic operations p 19 8 Ed InsertFX Comparing original and edited sounds When you re in the process of editing a sound pressing the COMPARE button will recall the saved version of the sound as it was before you started editing To indicate that you are listening to the saved version the button s LED will light up Pressing COMPARE button again returns you to the version you are editing and the LED will go out again If you edit while the COMPARE LED is lit the button will again go dark and your previous edits will be lost 47 Playing and Editing Programs Basic oscillator settings Program type setting single dou ble drum kit Here you can specify the type of program whether to use one oscillator two oscillators or a drum kit Use the PROG 1 Ed Basic Prog Basic Oscillator Mode to specify the program type PROG 1 Ed Basic Prog Basic Oscillator Mode Oscillator Mode Cisingle Trigger FlLegato Priority Last Voice Assign Mode Poly Hold Single Programs have one oscillator and Double Programs have two oscillators Each oscillator incl
170. loaded with 384 Combinations You can also save any combi nations that you create Combinations are organized into three banks as shown in the following table Combination banks Prog Bank Poe Explanation With the factory settings these banks contain a wide variety of preloaded combinations that use 000 for multiple programs effects A B C 127 preloaded and arpeggio patterns combination 128 programs can be written orrewritten to each bank A C for a total of 384 You can t write save data in these banks Selecting by Category You can select Combinations from within a cate gory such as keyboard synthesizer bass and drums When shipped from the factory the preloaded Combinations are organized into 16 categories For details on how to do this refer to Using CATEGORY and the PROGRAM COMBINA TION buttons to select p 38 58 Using a footswitch to select Combi nations You can assign a footswitch to step through Com binations one by one either going up 0 1 2 3 etc or going down 3 2 1 etc This lets you change Combinations without using your hands great for quick Combination changes in live performance situations For details on how to do this refer to Using a footswitch to select Programs 1 p 39 Using MIDI program changesto select combinations You can select combinations in the COMBI 0 Play page or switch the programs of timbres by send ing MIDI pr
171. locity that were specified for each individual step will be ignored and all notes of the arpeggio will sound according to the settings in PROG 7 Ed Arp Ctrls Be sure to verify the settings of the program Note Before you set Gt Gate move the REALTIME CONTROLS C mode ARP GATE knob to the center position 12 o clock Note Before you set Vel Velocity move the REALTIME CONTROLS C mode ARP VELOCITY knob to the center position 12 o clock PROG Ed Brp Ctrls Setup Pattern Wise Bs tagger Octave 1 Gate z Sort Okey Syne Reso F Velocity Step IFlLatch Fl Keyboard SWRI 0608 artue d Eene vt 13 To change the user arpeggio pattern name use the Utility Rename Arpeggio Pattern p 114 14 If you wish to save the edited user arpeggio pattern to internal memory be sure to Write the user arpeggio pattern p 104 If you turn off the power without writing the edited contents will be lost 15 If you wish to save the state of the program at the same time return to Program mode and write the program t p 45 101 Arpeggiator settings Other examples of creating a user arpeggio pattern Melody pattern 1 Set Step Step No to 01 and press the center of the ClickPoint 2 Select Tone 0 and press the center of the ClickPoint 3 Use the ClickPoint gt to change Step to 02 and enter Tone 0 4 In the same way change
172. lti set For more information see Specifying the func tion of the ASSIGNABLE Switch and ASSIGN ABLE Pedal p 88 Assignable Foot Pedal This lets you use a continuous controller pedal such as the Korg EXP 2 foot controller or Korg XVP 10 EXP VOL pedal as an assignable control ler Like the Assignable Foot Switch described above the Foot Pedal can be used for many different functions including e Master Volume e Channel Volume Pan or Expression e Assignable sound modulation as several dif ferent AMS or Dmod sources e Effects Send level control e Duplication of many front panel controls including the modulation Joystick Real Time Knobs Functions above will always operate as specified by the GLOBAL 0 System Foot page regardless of the currently selected program combination or multi set For more information see Specifying the func tion of the ASSIGNABLE Switch and ASSIGN ABLE Pedal p 88 42 External control You can use the REALTIME CONTROLS 1 2 3 and 4 knobs to transmit MIDI messages This can be used to control a KORG Legacy Collection software synthesizer or DAW program running on your computer or to control an external MIDI device You can assign three control changes to each knob and switch between them using the SELECT but ton giving you a total of twelve different control changes These twelve assignments four knobs x three sets are one set and the
173. microX provides 64 such sets p 111 EXT CONTROLLER button This switches the external function on off If this is on the button will light and the realtime control functions will be disabled When this is on you can use the SELECT button to select the MIDI messages assigned to the scene and use the REALTIME CONTROLS 1 2 3 and 4 knobs to send messages to your external MIDI device When the external function is on the REALTIME CONTROLS 1 2 3 and 4 knobs operate independently and are not affected by the settings of Program Combination or Multi mode Sending MIDI information from the various controllers When you operate a controller of the microX the corresponding or specified control change will be transmitted via MIDI Pitch bend messages are transmitted only when you operate the joystick In Program mode these messages are transmitted on the global MIDI channel For details on the MIDI messages transmitted when you operate an microX controller and on the AMS Alternate Modulation Source and DMS Dynamic Modulation Source corresponding to the MIDI messages see MIDI transmission when the X50 microX s controllers are operated PG p 166 Simple program editing Simple program editing You can edit any of the Programs shipped with microX or you can start with an initialized Pro gram to create sounds from scratch On the microX you can use the eight sliders in the Pe
174. microx Driver Information Name KORG USB MIDI Driver for Windows XP Version 1 07 02 Date 11 28 2005 2005 KORG INC 4 If a warning dialog box regarding digital signature authentication appears during the installation click Continue to continue the installation Hardware Installation The software you are installing for this hardware KORG microX has not passed Windows Logo testing to verify its compatibility with Windows XP Tell me why this testing is important gt Continuing your installation of this software may impair or destabilize the correct operation of your system either immediately or in the future Microsoft strongly recommends that you stop this installation now and contact the hardware vendor for software that has passed Windows Logo testing Compt STOP naan 5 Driver installation has been completed Click Finish to exit the installer If you are asked whether you want to restart Windows now choose Yes to restart 30 Note For details on installation and setup and on uninstallation see the Installation manual HTML on your computer To view the Installation manual click from your taskbar s Start All Programs KORG KORG USB MIDI Driver Tools Installation manual About the microX and driver ports KEYBOARD port Applications on your computer use this port to receive MIDI messages from the microX data from the keyboard and contr
175. mp Bx LoDamp 8 Ez Tine s 1 Level 2e liL ul Hod 4788 Src PWR 1 RBS P Times 1 Level 28 Spread CFR 418 FSWHS2 458 FSD rus T eN SB SB Off 3 Set the realtime controller function to C mode and rotate REALTIME CONTROLS knob 4 TEMPO Move the joystick up Operate the knob the delay time will change 4 Turn on the ARP ON OFF button to start the arpeggiator Select an arpeggio pattern as desired Move the joystick up When you rotate REALTIME CONTROLS knob 4 the delay 86 time will change in synchronization to any changes you make in the arpeggiator tempo If you rotate the REALTIME CONTROLS knob 4 to change the tempo while the delay is sounding noise may occur in the delay sound This is because the delay sound becomes discontinuous and is nota malfunction W For some effects you can synchronize the LFO frequency to the tempo Set the effect parameters BPM MIDI Sync to On and BPM to MIDI For details see PG p 160 Saving edited effect settings Effect parameters that you edit in Program mode are saved when you write the program Similarly effect parameters that you edit in Combination mode or Multi mode are saved when you write the combination or multi set p 45 61 75 Bypassing the insert effect or the master effects Normally you will switch the effects on off indi vidually for each program combination or multi set However you also have the opti
176. n which the reverberation decays Different effect types let you simulate a broad range of reverbera tion and you can also edit the parameters to make detailed changes to the character of the sound Dry sound i reflections Reverb sound Time lt gt Pre Delay Effects that combine two mono effects connected in series These connect two mono effects in series They include a four band parametric equalizer con nected in series with some other effect e g exciter chorus delay or a compressor connected with another effect of the types listed above Effect settings for a program Effect settings for a program Routing The structure of the insert effect master effects and master EQ is the same in each mode How ever the routing will determine how the oscillator output of the program is sent to the insert effect and the master effects As an example here s how to specify the routing and make effect settings in Program mode 1 Access the PROG 8 Ed InsertFX BUS page 2 Set BUS Select All OSCs to specify where the oscillator output will be sent L R The output will be sent to MAIN OUTPUT L MONO and R See diagram below Note After passing through the master EQ the sound will be sent to MAIN OUTPUT L MONO and R PROG Ed InsertFi BUS BUS Select BUS Select GUS Select AT OSTs AFA Send 0SC1 Sendi 6356 i OSC2 Sendi 838 Send BER Senda 034 ET ra J j
177. name Parameter name Category number and name Tab name empo Bank COME OFF la Combination Combi Select number i Bank A Category 13 Comples SE J 092 Combi Select 000 Groory Monsters combination ETRE e ee ero SE ITIS number and Knob Mod 1 Fnob Mod 2i Knob Mod S Briob Mod name cont Frog M Mis Tar n U Arp E Tab Control assign list 2 Make sure that Combi Select combination number and name is selected If this is not selected use the ClickPoint A Y to highlight the Combi Select indication 3 Turn the VALUE dial to select the combination you want to play 4 Press a COMBINATION A C button to switch banks When you select a different Bank the button s LED will light and the selected bank will appear on the left side of the display For example to select bank B press the COMBINATION B button The B button will light and the name Bank B will appear in the left of the display Combinations are organized into banks of 128 Select the desired bank and then select a combination number within that bank Playing programs and combinations 5 Play the keyboard to hear the combination you selected While playing the keyboard use the joystick and realtime controllers to modify the sound The result will differ depending on the combination so play the keyboard while operating these controllers to hear what they do You can use the OCTAVE A buttons to change the pitch in
178. nformation directly to and from a computer without requiring a MIDI interface p 32 14 What is USB USB stands for Universal Serial Bus and is an interface for transferring data between a com puter a keyboard and or peripheral devices Note The USB connector of the microX is only able to transmit and receive MIDI data 5 Power supply Be sure to see Turning the power on off p 23 and follow the correct procedure described there Power switch This switch turns the power on off AC adapter connector Connect this to the included AC adapter amp Connections must be made with the power turned off Please be aware that careless operation may damage your speaker system or cause malfunctions Cable hook Use this to secure the cable of the included AC adapter After connecting the AC adapter fasten the cable around the hook located on the microX s rear panel so that the cable will not be pulled out inadvertently Leave enough slack on the plug end so that you can disconnect it if you want to amp Be careful not to bend the base of the plug any more than necessary Objects in the Display and their functions Objects in the Display and their functions a Current page d Edit cell e Check box Fisort ted D Key Sync C Keuboard Min i J Arp E c Parameters b Tab a Current page This indicates the current page within the selected mode From the left this area shows the mode n
179. ng a page Using the page menu to move In Combination Program Global and Multi modes you can press the MENU OK button to view a list of the pages that make up that mode 1 Press the MENU OK button The page menu will appear The page in which you were when you pressed the MENU OK button will be highlighted as an indication PT 9 Combination PAGE MENU Tone Adjust MIDI Filter 4 MIDI Filter Velocity Zone ArprConttols Inzert Effect Haster Effect 19 Introduction 2 Use the ClickPoint lt 4 A Y to select the page you want to view 3 When you ve made your selection press the center of the ClickPoint You will jump to the selected page and that page will appear As an example here try selecting Key Zone The 5 Ed Key Zone page will appear Note The page that appears will be the page of the tab you selected most recently Note If you set the Global mode setting Page Menu Style to List you can move by selecting pages and tabs as shown in the following illustration The display shown in step 2 is for when Page Menu Style Icon Play 1 Edit Tone Adjust Program 2 Edit Timbre Par an Mixer 3 Edit HIDI Filter 1 h 4 Edit MIDI Filter2 peda ea ArPeggiator B Est Control Using the MENU OK button PAGE PAGE buttons to move e Hold down the MENU OK button and press the PAGE PAGE button In Combination mode you
180. nique character to the sound Adjusting the cutoff frequency of the high pass filter will modify the thickness of the sound from which the low frequency range has been filtered out 6 Turn knob 3 EG INTENSITY to adjust filter EG intensity the depth at which the filter EG is applied Rotating the knob will affect the depth of the filter EG Normally rotating the knob toward the left will make the filter EG apply less deeply and rotating it toward the right will make the filter EG apply more deeply Since the filter EG will operate based on the cutoff frequency of the filter knobs 1 and 3 will work together to control the tonal changes produced by the filter 7 Turn knob 4 EG RELEASE to adjust EG release times of the filter and amp This will determine the time from note off until the sound disappears When you adjust the knob the release times of the filter EG and the amp EG will change Normally rotating the knob toward the left will shorten the release time and rotating it toward the right will lengthen the release time 8 Press the REALTIME CONTROLS SELECT button to light the B LED located at the right of the button In B mode effective functions for each of the preloaded programs and combinations are assigned to the knobs This lets you use the knobs to control volume portamento time pan filter and amp EG pitch LFO master effect send levels and other parameters Turn each knob to hear the result Note The
181. nsmitting or received control change messages see MIDI transmission when the X50 microX s controllers are operated PG p 166 For more about MIDI in general see MIDI applications PG p 171 77 Using and Editing Multi sets 78 Effects settings The effect section of the microX provides one insert effect two master effects one master EO stereo 3 band EQ and a mixer that controls the routing of these components Effects in each mode Program mode In Program mode the insert effect can be used as part of the sound creating process in the same way that the output sound of the oscillator OSC is processed by the filter and amp to create the final sound Then the master effects can be used to apply spatial type effects such as reverb The ste reo 3 band master EQ located immediately before the MAIN OUTPUT L MONO and R outputs is used to make final adjustments in tone These set tings can be made independently for each pro gram PROG 8 Ed InsertFX e Select the BUS and master effect send level for the oscillator output e Insert Effect routing selection and settings PROG 9 Ed MasterFX Master Effect selection and settings e Master EQ settings Sena Master Effect 1 2 Return OUTPUT Oscillator _Filter_ Amplifier gt Insert Effect_ Master EQ mono R Combination mode Multi mode In Combination mode and Multi mode the insert effect can be appl
182. o defeat this setting press Hold Balance once again and press the ClickPoint center REALTIME CONTROLS 1 2 3 4 SELECT Just as in Program mode you can use the realtime controller 1 4 knobs and SELECT button in Combination mode to modify sounds and effects or to control the arpeggiator See REALTIME CONTROLS 1 2 3 4 SELECT p 43 The REALTIME CONTROLS 1 4 knobs can transmit MIDI messages as specified by the exter nal control setup to your external MIDI equip ment If you turn the EXT CONTROLLER button on lit these knobs will be switched to the external control function and will be disconnected from the internal sound generator For more about external control see External control settings p 111 Note The REALTIME CONTROLS A mode and B mode can control timbres of the same channel as the global MIDI channel Saving your edits Once you ve tweaked the sound to perfection you ll want to save your work To save your edits 1 Press the UTILITY button to access the utility menu 2 Use the ClickPoint to select Write Combination and then press the ClickPoint center The Write Combination dialog box will appear Write Combination Agee WR Groovy Monsters Category 13 Complex amp SE Tao ABBA Groovy Monsters Cancel Note If the display indicates Memory Protected the combination memory protect is turned on Go to GLOBAL 0 Sy
183. oard the Oscillator s Octave setting needs to be 0 8 All Drum Kit Programs should have this setting already If you re unsure you can check this yourself 1 Access the Program mode PROG 1 Ed Basic OSC1 page 2 Check that the Octave parameter near the top of the page is set to 0 8 With a setting other than 0 8 the relationship between the keys and the Drum Kit sound map will be incorrect Check the memory protect setting When you wish to edit a user drum kit first turn off memory protect by unchecking the Memory Protect Drum Kit check box in the GLOBAL 0 System Preference page 107 Using Drum Kits Saving and comparing data e The edits you make in Global mode will be lost when the power is turned off so you need to write save your edits if you want to keep these changes Four types of data are handled in Global mode user drumkit settings GLO BAL 4 arpeggiator settings GLOBAL 5 external control settings GLOBAL 6 and all other global settings GLOBAL 0 3 You can save each type of data into its own memory area e Note that Compare can t be used in Global mode If you want to edit a user drum kit or user arpeggio pattern you should first use Copy Drum Kit or Copy Arpeggio Pattern to copy the drum kit or user arpeggio pattern you want to edit into a vacant number and then edit the copy Caution when a drum kit is used by more than one program
184. oard in Global mode the instrument will sound in the state of the mode in which you were If you moved from Multi mode to Global mode playing the keyboard will sound the program and arpeggiator of the track that matches the global MIDI channel GLOBAL 1 Memory structure for the arpeggio patterns The microX has 251 arpeggio pattern memory areas divided into preset arpeggio patterns and user arpeggio patterns as follows Preset arpeggio patterns There are five patterns UP DOWN ALT1 ALT2 and RANDOM The operation of these patterns is fixed and can not be edited User arpeggio patterns There are 251 patterns U000 U250 which can develop chords or phrases in a wide variety of ways based on the pitches that you play on the keyboard or the timing at which you play them In GLOBAL 5 Arp Pattern you can modify these user arpeggio patterns or create a new user arpeg gio pattern from an initialized condition Edited user arpeggio patterns can be written to internal memory areas U000 U250 Changing the memory protect set ting When you wish to edit a user arpeggio pattern first turn off memory protect by unchecking the Memory Protect Arp UsrPat check box in the GLOBAL 0 System Preference page Saving and comparing data e The edits you perform in Global mode will be preserved until you turn off the power is turned off but will be lost when the power is turned off Four types of data are handled in
185. ogram change messages from your external MIDI device DAW software or other sequencer or MIDI controller to the microX If you ve installed the included microX Plug In Editor into your DAW program as a plug in you can easily select microX programs or combinations from a list within your DAW software For more details see Editor Plug In Editor Manual PDP Switching combinations via MIDI The combination will change when the microX receives a program change on a channel that matches the global MIDI channel However this is affected by the GLOBAL 1 MIDI Combi Combination Change setting This set ting must be checked If this setting is unchecked the combination will not change instead the pro gram will change for the timbre of the matching channel With the factory settings the global MIDI channel is set to channel 1 If you want to change this set ting see MIDI channel setting p 39 Switching the program of a timbre via MIDI The MIDI channel of a timbre is specified by the COMBI 2 Ed Track Param MIDI MIDI Chan nel setting When a program change message on a MIDI channel that matched the timbre s channel is received the program will change for timbres whose Status is INT However program changes for timbres are affected by the COMBI 3 Ed MIDI Filter1 1 page Program Change set ting Using Controllers The Status setting is located in the COMBI 2
186. ollers SOUND port Applications on your computer use this port to send MIDI messages to the microX s internal sound generator making it produce sound Setting up the microX Editor Plug In Editor For details on setting up and using the microX Editor Plug In Editor see Editor Plug In Editor Manual PDF About the microX external control tem plates See microX External Control Template List PDF for details on the control change CC set tings assigned by the preloaded external control templates and the application settings to which they correspond Connecting a computer Mac OS X Installing the KORG USB MIDI driver and editor software Installing the KORG USB MIDI Driver Note Use the KORG USB MIDI Driver if you are connecting the microX via USB to a computer that satisfies the conditions listed in KORG USB MIDI Driver operating requirements p 27 1 Insert the included CD ROM into your CD ROM drive 2 In the CD ROM navigate to the KORG USB MIDI Driver folder and double click KORG USB MIDI Driver pkg to start up the installer 3 Depending on the version of your operating system a confirmation dialog box may appear at this point If so enter your password and click OK When the installer starts up the following screen will appear Click Continue e800 Install KORG USB MIDI Driver for Mac OS X Welcome to the KORG USB MIDI Driver for Mac OS X Installer
187. om INDIVIDUAL OUTPUT 1 and or 2 set this to 1 2 or 1 2 Send1 MFX1 Send2 MFX2 Set the send level to the master effects For this example set these to 127 Effect settings for a program 5 Move to the IFX page and set the parameters of the effect that you selected for the insert effect PROG Ed InsertFi IFA 5t Compressor TS Pre E Trim 188 ity Loe B BdE HiED 2 606 z Off For details on the parameters of each effect see PG p 104 Selecting master effects and chain settings The input level of the master effect is determined by the send level 1 and 2 settings routing step 3 or insert effect step 4 If send levels 1 and 2 are 0 no master effects will be applied Send level 1 is for MEFX1 and send level 2 is for MFX2 1 Access the PROG 9 Ed MasterFX Setup page MFX1 On Off Master Effect1 Return1 MFX2 On Off Master Effect 2 Return2 Api 9 EM up Master Five 1 00 Ee oe Me tri re Master EW Aoin dE Gy 4 Sto Detay sal ce a A MFE Chain ianat CE Hik Dik ction MFS 1 MFAS Livell Bas zs p JEEE MFX Chain Chain Signal Chain Direction Master EQ Low Fd High Chain Level 2 In Master Effect 1 and Master Effect 2 select the type of each master effect You can press the CATEGORY button and choose an effect from six categories Note The input output of the master effect is mono in stereo out Even i
188. on of bypass ing the insert effect or master effects for the entire microX if you don t want to use them For example this can be useful when you re using an outboard effect such as reverb chorus or com pressor to create an effect that you would other wise create using the microX s master effects or when you re using a plug in effect on your com puter to process the sound of the microX together with other sound sources 1 Press the GLOBAL button to enter Global mode 2 Access the GLOBAL 0 System Basic page Basic MPM off Basic iFm 5U Auto Arp Master Tune 08 dd paHz1 OIF off iE Program EMF Off i Combi key Transpoce 00 Velocity Curue d Normali TH I OCTAVE Keysi a FE Ze Progr Combis Multis Octave bazie M Frer I Feot 3 Check the IFX Off check box if you want to bypass the insert effect Check the MFX1 Off dialog box if you want to bypass master effect 1 or the MFX2 Off dialog box if you want to bypass master effect 2 Global Mode How Global mode is struc tured In Global mode you can make overall settings that apply to the entire microX such as master tuning key transpose effect global switch global MIDI channel and system clock In addition you can create user drum kits arpeg giator and scales make settings for the damper pedal and assignable foot switches pedals and specify category names for programs and combi nations Global mode p
189. on of your operating system a confirmation dialog box may appear at this point If so enter your password and click OK 9 When the installation has been successfully completed click Close to exit the installer About the microX and driver ports KEYBOARD port Applications on your computer use this port to receive MIDI messages from the microX data from the keyboard and controllers SOUND port Applications on your computer use this port to send MIDI messages to the microX s internal sound generator making it produce sound Installing the microX Editor Plug In Edi tor To install the software in Mac OS X proceed as fol lows 1 Insert the included CD ROM into your CD ROM drive 2 In the CD ROM navigate to the microX Editor folder and double click microX Editor Installer pkg to start up the installer 3 Follow the on screen instructions to install application See Installing the KORG USB MIDI Driver 4 When the installation has been successfully completed click Restart Note If you re using Mac OS X the plug in version will also be installed in the appropriate folder Setting up the microX Editor Plug In Editor For details on setting up and using the microX Editor Plug In Editor see Editor Plug In Editor Manual PDF Installing the microX External Control Temperate To install the software in Mac OS X proceed as fol lows 1 Insert the included CD ROM into you
190. on the Ed LFOs page You can use the utility menu s Copy Oscillator command to copy these parameters from one Oscillator to another You can even copy parame ters from an Oscillator in a different Program This command is useful when you want to set both Oscillators to the same settings or when you want to duplicate settings you ve used before Assigning a drum kit What is a drum kit If you want to use a drum kit in a program set the Oscillator Mode to Drums Then choose one of the 40 user drum kits or nine GM compatible drum kits for the program to use A drum program uses a drum kit for its oscilla tor A drum kit consists of multiple drum instru ment samples placed across the keyboard There are 929 drum instrument samples p 48 Multi samples and Drum Kits In Global mode you can create or edit a drum kit itself You can assign up to two drum samples High and Low to each note of the keyboard and switch between these drum samples by velocity You can also specify the effects and the routing to the audio output jacks p 108 Editing Drum Kits Selecting a drum kit 1 Access the PROG 1 Ed Basic Prog Basic page 2 Set Oscillator Mode to Drums PROG 1 Ed Basic Prog Basic 0scillator Mode Oscillator Mode Voice Assign Mode Poly O single Trigger r Hold Legato Priority Last 3 Access the PROG 1 Ed Basic OSC1 page 4 Use the ClickPoint lt Y to hi
191. onnecting the AC adapter ocd STANDBY DC 12V 0N 4 Cable hook Power switch _ 1 Power connector AC adapter S Be careful not to bend this portion excessively when you A 2 wrap the cable PlugintoanAC M through the cable outlet hook q 3 Power cable Turning the power on 1 Turn the microX s VOLUME knob toward the left If you have connected powered monitor speakers or a stereo amp turn down the volume of these devices 2 Press the rear panel Power switch to turn on the power The display will show the model name software version The following graphic shows the factory set display The version number is subject to change without notice Y3rTC TC ae SB HTHESIZER r CONTROLLER Version 1 6 8 3 Turn on your powered monitors or stereo amp 4 Turn the microX s VOLUME knob to an appropriate position and adjust the volume of your powered monitor speakers or stereo amp Note The state of microX when the power is turned on will depend on the setting of Power On Mode GLOBAL 0 System Preference page p 88 23 Setup Turning the power off amp After you ve finished editing be sure to write save your changes If you edit a program and then select a different program or turn off the power the changes you made will be lost The same is true for a combination or multi set The settings you edit in Global mode are remembered as long as the
192. oot SW RZzigh Foot Sh Foot Pedal Assign Ott Damper Polarity C KORG Standard Foot SW Polarity C 2 KORG Standard Ipu j Erer M Feot J j 2 Return to the PROG 8 Ed InsertFX IFX page and set the C Fb C Delay Feedback Source to SW1 82 3 Set Amount to 30 PROG i Ed InsertFi IFA LCR BPM Dela EFt 128 iTimedver gt LBS F Times Leret 26 HiDarmp 0 LoDamp B C Bz d Times 1 Leuel 2 ihly Plod 188 Sre MWAH i F Bz Times 1 Level 26 Spread FE 118 EEA Se iD 20 56 Off 4 Move the joystick up Press the foot switch the feedback level will increase and the delay sound will continue for an extended time The Amount setting determines the feedback level when the foot switch is pressed If you set Amount to 10 and press the foot switch the feedback level will be 0 Using the BPM MIDI Sync function to synchronize the delay time to arpeggiator tempo changes The BPM MIDI Sync function lets you synchro nize the delay time to the tempo of the arpeggio 1 In the PROG 8 Ed InsertFX IFX page set BPM to MIDI 2 For L C and R set L C R Bs and Times as desired For this example set L C R Bs to Jand Times to 1 so that the effect will be easily understandable The delay time will repeat at an interval of a 8th note PROG f Ed InsertFa IFA LCR BPH Dela BPH U Timeduer gt LBS Times 1 Level z HiDa
193. or just slightly below normal pitch Using velocity to switch between oscil lator 1 and 2 DSC 1 Velocity zone Bottom 6a1 Top 127 OSC2 Velocity Zone Bottom EE Top 127 Here you can specify the range of velocities that will sound oscillators 1 and 2 In the example shown above the velocity ranges are as follows e OSC1 will sound for all velocity values e OSC2 will sound only for strongly played notes 64 and above e You can use Velocity Multisample Switching in addition to this High Multisample Low Multisample For this example set OSC1 in Velocity SW L gt H to 32 and OSC2 to 96 The settings are shown as vertical lines in the velocity zone display In this example the multisamples will sound over four levels Velocity values 001 031 sound only the OSC1 Low multisample Velocity values 032 063 sound only the OSC1 High multisample Velocity values 064 095 sound the OSC1 High multisample and the OSC2 Low multisample Velocity values 096 127 sound the OSC1 High multisample and the OSC2 High multisample 49 Playing and Editing Programs Copying settings between OSC1 amp OSC2 Many of the Program parameters can be set differ ently for OSC1 and OSC2 These include all of the parameters on All of the tabs on the Ed Pitch page except for the Pitch EG All of the tabs on the Ed Filter page All of the tabs on the Ed Amp page e All of the tabs
194. orks In order for the LFO to actually affect the sound you can use the dedicated LFO routings on the Filter Pitch and Amp pages or use the LFOs as AMS sources for a wide variety of parameters Frequency Modulation AMS can be used to vary the LFO speed This lets you change the LFO speed by operating a control ler or by the EG or Keyboard Track settings PG p 14 MIDI Tempo Sync If MIDI Tempo Sync is checked the Fre quency setting will be ignored and the LFO will synchronize to the system tempo as set by the TEMPO knob or external MIDI clocks This lets you produce vibrato wah auto pan or tremolo effects that lock to arpeggiator or external MIDI sequencers EGs Envelope Generators An envelope creates a modulation signal by mov ing from one level to another over a specified time and then moving to another level over another period of time and so on Each program includes three EGs one for Pitch one for the Filter and one for the Amp These pro duce time varying changes in pitch tone and vol ume respectively They can also be used to modulate a number of other Program parameters via AMS note on Attack Level note off Y Y Release Level Ti Release Time Decay Time Attack Time Slope Time Start Level Using Alternate Modulation AMS Alternate Modulation Source refers to any of the assignable modulation sources in microX including e Built in physical con
195. ou synchronize the tempo with an external MIDI device In this case you won t be able to adjust the tempo on the microx Adjusting the length of the arpeggiated notes ARP GATE 1 Press the REALTIME CONTROLS SELECT button to make the right C LED light 2 Rotate the 1 ARP GATE knob to adjust the duration of the arpeggiated notes Rotating the knob toward the left will shorten the notes and rotating it toward the right will lengthen the notes At the center position 12 o clock the note length will be as specified by the program parameter Gate 7 Ed Arp Ctrls Setup page Note You can control the effect by simultaneously adjusting the REALTIME CONTROLS A mode 4 EG RELEASE knob Adjusting the level of the arpeggiated notes ARP VELOCITY 1 Press the REALTIME CONTROLS SELECT button to make the right C LED light 2 Rotate the 2 ARP VELOCITY knob to adjust the strength or level of the arpeggiated notes 92 Rotating the knob toward the left will make the notes weaker and rotating the knob toward the right will make the notes stronger At the center position 12 o clock the velocity will be as specified by the program parameter Velocity 7 Ed Arp Ctrls Setup page Note You can control the tone effectively by simultaneously adjusting the REALTIME CONTROLS A mode 1 LPF CUTOFF 2 RESONANCE HPF and 3 EG INTENSITY knobs Changing the length of the
196. our computer meets the requirements there may be cases in which the software does not operate correctly because of the computer you are using 121 Appendices Specifications and options Specifications Operating temperature 0 40 C do not allow condensation HI Hyper Integrated Synthesis System Synthesis types HI Hyper Integrated Synthesis System Sound Engine Maximum polyphony a E 31 voices 62 oscillators Waveform memory 64 Mbyte PCM ROM 642 multisamples 929 drumsamples Single OSC1 only Double OSC1 amp OSC2 Two level velocity switching per oscillator Filters 24 dB octave LPF with resonance 12 dB octave LPF HPF Two envelope generators Filter amp Amp two LFOs and two key tracking Modulation generators Filter amp Amp for each voice In addition pitch EG and alternate modulation AMS functions Number of timbres Maximum 8 timbres key and velocity splits layers crossfading Tone Adjust Combinations master keyboard function allows program settings to be modified control from external MIDI functionality devices Maximum 16 tracks key and velocity splits layers crossfading Tone Adjust Number of tracks master 2 wan keyboard functionality allows program settings to be modified control from external MIDI Drum Kits Drum sample assignments two level velocity switching available The number of 384 combinations 384 preloaded 640 programs 640 preloaded em Multi sets 128 multi sets 16 pr
197. parameters and is used to synchronize the LFO speed of modulation type effects or the delay time etc of delay type effects to the tempo of the arpeggiator or an external sequencer Using dynamic modulation to con trol effects in realtime These examples show how you can use dynamic modulation to control an effect parameter in real time 1 As described in the procedure for Effect settings for a program p 81 set IFX to 49 LCR BPM Delay Verify that a delay sound is being output Then continue on to set the items described below FROG Ed InsertFi Setup insert Effect i CENS gR gt CAB LAR 51 127 52 127 CAT 0562 IFA ELER EFM belo Moving the joystick to vary the delay level via Dmod 1 Access the PROG 8 Ed InsertFX IFX page 2 Set InLvl Mod to 100 3 Set Src to JS Y 1 The joystick will control the input level to the effect When you set Src to JS Y 1 the level of delayed signal will be set to zero and will eradually increase as you push up on the joystick PROG Ed InsertFa IFA LCR EPH Dela BPI 128 ITimeDnuer gt LBs F Timet 3 Level 28 tHilamp B LODamp 8 Level 26 iliLu1 Mod 4188 Src Bee Level 28 Spread s F rD SB S TT r Pressing a foot switch to vary the feed back level via Dmod 1 In the GLOBAL 0 System Foot page set Foot SW Assign to Foot SW CC 82 85 Effects settings Foot Foot SW assign F
198. parameters can be edited from either page e Select an arpeggio pattern and make settings e Select an external control set Select a program for each timbre and set status pan and level e Use Tone Adjust to adjust parameters Biyura Bapa MIDI OSC Pitch Delay and Scale settings for each timbre 3 Ed MIDI Filter e MIDI message transmission reception 4 Fd MIDIFilter2 filter settings for each timbre 1 Ed Tone Adjust 5 Ed Key Zone Key zone settings for each timbre 6 Ed Vel Zone Velocity zone settings for each timbre e Arpeggiator settings Same as the 0 Play 7 Ed Arp Ctrls parameters can be edited from either page Controller settings BUS and master effect send level settings for each timbre e Insert Effect routing selection and settings e Master Effect selection and settings ho Master EQ settings For details on how to access each mode page and the utility commands and how to edit values see Basic operations amp p 19 8 Ed InsertFX Comparing original and edited sounds When you re in the process of editing a sound pressing the COMPARE button will recall the saved version of the sound as it was before you started editing To indicate that you are listening to the saved version the button s LED will light up Pressing COMPARE button again returns you to the version you are editing and the LED will go out again If you edit while the CO
199. pendently specify whether A and B will operate step 6 The arpeggiator in Combination and Multi modes e Select an arpeggio pattern and set parameters independently for A and B step 7 e Make Scan Zone page settings so that you can use keyboard range or playing velocity to switch between normal playing and arpeggi ated playing or to switch between arpeggiators A and B step 8 Make settings for timbres that will be silent when the arpeggiator is Off and will sound only when the arpeggiator is On step 10 Arpeggiator on off Each time you press the ARP ON OFF button the arpeggiator will be switched on or off When on the ARP ON OFF button will light The selected arpeggio pattern will begin when you play the keyboard The on off setting is saved when the combination is written into memory Note If Assign is Off or Arpeggiator Run is not checked the arpeggiator will not operate even if this key is on Arpeggiator settings 1 Select COMBI 0 Play Prog page Select programs for the timbres that you wish to use For this example select any desired program for timbres 1 4 2 Select COMBI 2 Ed TimbreParam MIDI page For the timbres that you will be using set Status to INT and set MIDI Channel to Gch or to the global MIDI channel set in GLOBAL 1 MIDI MIDI Channel For this example set timbres 1 4 to a Status of INT and timbres 5 8 to a Status of Off Set
200. power is on but will be lost when you turn off the power 1 Turn the microX s VOLUME knob toward the left Also turn the volume of your powered monitor speakers or stereo amp down to zero 2 Turn off the power of your powered monitor or stereo amp 3 Press the rear panel Power switch to turn off the power amp Never turn off the power while data is being written into internal memory If the power is turned off while processing is being performed memory write operations will not be completed correctly If this occurs microX will automatically initialize its internal memory so that it will operate correctly This is not a malfunction While data is being written the display will indicate Now writing into internal memory Data is written into internal memory by the following operations e Writing updating a Program Combination Multi Global Setting Drum Kit Arpeggio Pat terns or External Control Setup e Loading a Preload data for Program Combina tion Multi Global Setting Drum Kit Arpeggio Patterns or External Control Setup Receiving a MIDI data dump for Program Combination Multi Global Setting Drum Kit data Arpeggio Patterns or External Control Setup 24 Connections Connections amp Connections must be made with the power turned off Please be aware that careless operation may damage your speaker system or cause malfunctions Basic connections Connect the audio ca
201. powered on the microX here s how to perform basic operations such as selecting modes and pages 1 Selecting modes In order to use a particular function on the microX you must first select the appropriate mode Press one of the front panel mode buttons to enter the corresponding mode PROGRAM A GM button Program mode COMBINATION A C button Combination mode MULTI button Multi mode GLOBAL button Global mode e When you press one of the PROGRAM A GM buttons or COMBINATION A C but tons you will enter the selected mode and the corresponding bank will also be selected as well as a program or combination within that bank amp For example if you re editing a program in Program mode and you press a different PROGRAM A GM button the program will change and the settings you had been editing will disappear The same is true for Combination mode and the settings you had been editing will disappear if you press a different COMBINATION A C button e For the GLOBAL button or MULTI button pressing that button once again will take you back to the mode and page in which you had previously been Note For example suppose you re editing a program in Program mode and you press the GLOBAL button to enter Global mode When you ve finished editing the Global settings and are ready to resume editing the program press the GLOBAL button once again to return to Program mode If you re
202. quencer or DAW software but in this section of the manual we ll explain how to make these settings from the microX itself However making these settings in the microX does not automatically make these set tings a part of the sequence itself These settings can be transferred to your MIDI sequencer by sending a data dump from the microX if your MIDI sequencer can receive exclu sive messages or by using the included microX Plug In Editor software to read this data from the microX Then you can send these settings from your sequencer back to the microX when needed Selecting a multi set Selecting multi sets from the front panel 1 Press a MULTI button The button will light You will enter Multi mode Notice that the upper line of the display indicates MULTI 0 Play mode name page number and name The Multi Mode setting This setting is located in GLOBAL 0 System Pref erence page Multi Mode and you can change it to suit the way in which you re using the microxX for Ext Seq Choose this if you re using the microX as a multi timbral sound module When you switch multi sets on the microxX program changes and other MIDI messages will not be transmitted even by tracks whose Status is EXT or BTH for Master Choose this if you re using the microX as a master keyboard In this case when you switch multi sets on the microX program changes and other MIDI messages will be transmitted f
203. r RTAS as desired For example if you want to install the stand alone version click Install Stand alone version Then follow the on screen directions to perform the installation and click Close when the installation has been successfully completed If you want to install a plug in version click in the Installer screen to select the format of plug in that you want to install and perform the installation Connecting a computer 42 KORG microX Editor Plug In Editor Installer Exit Setup e When you e finished installing the applica tion s you want click Exit installer to exit the installer 6 When all the selected applications have been installed click Finish to exit the installer gt KORG Application Installer KORG KORG microX Application Installer All applications have been installed Please click Finish 2005 KORG INC The first time you connect the microX to the USB port of your computer the standard USB MIDI driver provided by Windows will be installed automatically If you want to use the KORG USB MIDI Driver for Windows XP please re install the driver manually using the procedure described below Setting up the KORG USB MIDI Driver 1 Before you perform the procedure below you must finish installing KORG USB MIDI Driver Tools into your computer Then restart the operating system of your computer and power on the microxX p 23 Note The driver must be in
204. r CD ROM drive 2 In the microX External Control folder on the CD ROM double click microX External Control pke to start up the installer 31 Setup 3 Follow the on screen instructions to install application See Installing the KORG USB MIDI Driver p 31 4 When the installation has been successfully completed click Close to exit the installer About the microX external control tem plates See microX External Control Template List PDF for details on the control change CC set tings assigned by the preloaded external control templates and the application settings to which they correspond Connecting via the microX s USB connector and setting up USB connector for connecting to com puter If you connect the microX s USB connector to your computer you ll be able to send and receive note data and other performance information and sound settings between your computer and the microX as MIDI messages Note The USB connector of the microX is only able to transmit and receive MIDI data Note Use the KORG USB MIDI Driver if you re connecting the microX via USB to a computer that meets the requirements described in KORG USB MIDI Driver operating requirements 1 Using a USB cable connect the USB connector of the microX to the USB connector of your computer Make sure that the plug is oriented correctly and push it all the way into the connector Computer
205. r Multi set make sure that Arpeggiator Run is checked and that an arpeggiator is selected for Assign 1 p 96 L Is the GLOBAL 1 MIDI MIDI Clock parame ter set to Internal PG p 81 Drum Kits The drum sample s pitch does not change L You have left the Assign check box unchecked and want to play the drum sample at the adjacent right a semitone lower but the pitch does not change If you have selected a drum program in Pro gram mode and then want to edit the drum kit in Global mode go to the PROG 2 Ed Pitch OSC1 page and set Pitch Slope to 1 0 before you enter Global mode Audition No sound when the AUDITION button is turned on LI The Audition function is available only in Pro gram mode Troubleshooting LI If no sound is played when you turn on the AUDITION button in Program mode make sure that the PROG 1 Ed Basic Audition page parameter Audition Riff has not been turned Off PG p 9 MIDI USB This instrument does not respond to incoming MIDI data LI Are all MIDI cables connected correctly p 32 35 LI Is the MIDI data being received on the channel on which it is being transmitted PG p 81 This instrument does not respond cor rectly to incoming MIDI data L Are the GLOBAL 1 MIDI page MIDI Filter set tings Enable Program Change Bank Combi Ctrl Change AfterT and Exelu sire each checked PG p 82
206. r Plug In Editor software e Send a MIDI data dump to a MIDI data filer or similar device Writing data into the microX Data areas that you can write You can write data into the following data areas For the procedure see the page given e Programs Programs 0 127 in banks A E p 45 e Combinations Combinations 0 127 in banks A C p 61 e Multi sets 000 127 p 75 e Global settings pages 0 3 p 87 Drum kit 00 INT 40 User p 110 e Arpeggio patterns U000 U250 p 104 e External control sets 00 63 p 112 You can t write to the following data areas e Program banks G 001 128 g d 001 128 e Preset drum kits 40 GM 48 GM e Preset arpeggio patterns Preset 0 Preset 4 e Program audition riffs 000 383 When the microX is shipped the writable areas already contain data This data is referred to as the preloaded data The preloaded data is also stored inside the microX and can be reloaded using the Load Preload Data operation p 113 The non writable areas contain preset data This data cannot be rewritten Modes and pages in which you can write data You can write the following items of data in the corresponding pages GLOBAL 4 Utility Write Drum Kits Arpeggio ss GLOBAL 5 Utility Write Arpeggio Patterns External control GLOBAL 6 Utility Write Ext Control Setups MIDI data dump You can save data by transmitting it as MIDI exclusive data to a connected MIDI data f
207. rams one at a time each time you press the foot switch If you want this setting to be remembered even after you turn off the power be sure to write the changes you made r p 45 7 Use the PROGRAM A GM buttons to enter PROG 0 Play and press the foot switch the program will change Note This setting applies to selecting Combinations as well Using MIDI program change mes sages to select programs By sending MIDI program change messages along with MIDI bank select messages to the microX from an external MIDI device a MIDI sequencer such as a DAW program or a MIDI controller etc you can select any program in the seven banks You can also install the included microX Plug In Editor into your DAW program as a plug in and easily select microX programs or combinations from a list within your DAW For more details see Editor Plug In Editor Manual PDF MIDI channel setting In order to play the microX via MIDI the transmit ting device MIDI sequencer or computer and receiving device the microX must be set to the matching MIDI channel In Program mode the microX receives data on the global MIDI channel 1 Make sure that the microX and your external MIDI device or computer are connected correctly For details on connections see p 27 2 Press the GLOBAL button to enter Global mode 3 Press the MENU button to access the PAGE MENU 4 Use the ClickPoint lt 4 A V to sel
208. ration with Bank Map set to GM For details on the KORG mapping PG p 78 Using Controllers The microX provides realtime controllers such as a joystick and OCTAVE V A buttons that let you make your performances more expressive These controls let you modify the tone pitch vol ume effects etc in realtime while you play For example a piano sound can be played realisti cally using only the keyboard but your perfor mance will be more expressive if you connect a damper pedal If you re playing guitar or wind instrument sounds you can use the joystick to control the pitch or to apply vibrato Note In the pages that follow our explanation will center on the dedicated functionality of each controller However you can also use these controllers as sources for alternate modulation or effect dynamic modulation giving you a much wider range of possible uses than we describe here For details on these capabilities see Using Alternate Modulation p 51 and PG p151 40 Keyboard Velocity How hard you play the keyboard affects the expres siveness of the sound You can adjust the volume level setting so that playing the keyboard softly will produce a soft sound and playing hard will pro duce a loud sound In addition you can also adjust the brightness of the sound and the envelope set tings such as attack rate and release time Using Velocity Switch in Combination Play mode and M
209. re If you want to save these parameters return to the previous mode and write the data Note You ll need to turn off the memory protect setting for user arpeggio patterns In the GLOBAL 0 System Preference page uncheck the Memory Protect Arp UsrPat box p 88 1 Press the UTILITY button to access the utility menu and choose Write Arpeggio Patterns 2 To write save your settings press the MENU OK button A dialog box will ask you to confirm that you want to write the arpeggio patterns 3 Press the MENU OK button to write your settings or press the EXIT CANCEL button if you decide not to write The arpeggio patterns will be written saved Synchronizing the arpeggiator Synchronizing the arpeggiator The note timing of the arpeggiator will differ depending on the state of the arpeggiator Key Sync check box If this is checked the arpeggiator will immedi ately start playing from the beginning from the first note on you play after all the keys had been previously released If this is unchecked the arpeggiator will operate in synchronization with the internal or external MIDI clock The paragraphs below explain how synchroniza tion occurs when the Key Sync check box is unchecked However synchronization with Song Start and with the MIDI realtime command Start message are exceptions to this Synchronization between arpeggia tors A and B In Combination and Multi
210. ress the MENU OK button A dialog box will ask you to confirm that you want to write the settings 4 Press the MENU OK button to write your settings or press the EXIT CANCEL button if you decide not to write The global settings will be written saved Drum kit 4 DKit Arpeggiator 5 Arp Pattern External Control 6 Ext Con trol settings Here you can make drum kit arpeggiator and external control settings See the corresponding page listed below p 107 Using Drum Kits p 91 Arpeggiator settings p 111 External control settings Arpeggiator settings The arpeggiator is a function that automatically generates arpeggios playing the notes of the chord individually with a constant tempo Most arpeggiators produce an arpeggio when you play a chord on the keyboard The chord you play on the keyboard is sounded as an arpeggio individual notes In addition to this the microX s arpeggiator is a polyphonic arpeggiator that is able to produce a variety of chordal transformations or phrases based on the pitch or timing of the notes you play on the keyboard These functions let you use the arpeggiator to play a wide range of patterns including drum or bass phrases and guitar or keyboard backing riffs It is also effective to use the arpeggiator as part of the sound creating pro cess when creating subtly moving pads synth sounds or sound effects In Program mode you can
211. rformance Editor display and the realtime con troller knobs and switches of the front panel to make simple changes to a program without hav ing to enter the editing pages that contain the detailed editing parameters Performance Edit By using the eight sliders of the Performance Edi tor you can make overall adjustments to the sound When you move a slider multiple program parameters are adjusted simultaneously meaning that you can edit multiple parameters by adjusting a single slider 1 In Program mode PROG 0 Play page select the program that you want to edit 2 Press the PAGE button or PAGE button to access the PROG 0 Play Perform Edit page Perf 000 Kombat Farformaneg Editor tetang Stretch Wst Bal Level Attock Decay IFE Eal MFH Eol IEF Ju ir NET 3 Use the ClickPoint lt 4 Y to select the performance editor parameter you want to adjust 4 Use the VALUE dial etc to adjust the value p 20 Octave Indicates the octave setting Pitch Stretch Simultaneously adjusts the transpose and tune settings of the oscillator This allows you to produce a variety of tonal changes without losing the character of the original sound This is particularly effective for acoustic type programs such as guitar bass or piano Select various programs and try this out OSC Balance Adjusts the level balance between oscillators 1 and 2 Note For programs whose Mode Oscillator
212. ro grams Each one is convenient in a different way Selecting programs from the front panel Using Program Select to select a program Turn the VALUE dial Press the center of the ClickPoint to high light the field then use Y to select a program and press the center to finalize your selection Use the PROGRAM A GM buttons to select a program bank Selecting programs by program category You can select programs by categories such as piano or drums amp p 38 Selecting programs by using a foot switch You can change programs even while both hands are busy playing on the keyboard convenient for live applications Selecting programs by receiving MIDI pro gram changes You can switch programs from an external MIDI sequencer or an external MIDI controller See below for details Selecting programs from the front panel 1 Press a PROGRAM A GM button The button will light You will enter Program mode and the bank you specified will be selected Notice that the upper line of the display indicates PROG 0 Play mode name page number and name receiving MIDI messages from multiple tracks of your MIDI sequencer or other DAW program This section of the manual takes a quick look at playing Programs including tours of the front panel controllers and basic editing techniques The bank number you specified is shown below PROG 0 Play Mode name Page number
213. rogram toa track and setting the volume and pan Selecting a track program from the microX 1 Access the MULTI 0 Play Program page This page shows all 8 Tracks at once including their Program assignments volume pan play mute solo and more d 128 in irh O EE Kit fi ete ETH ie aig a die LEW Ctr 2 Use the ClickPoint to highlight Program Select and use the VALUE dial etc to select a program You can use either of the following methods to select a program e Turn the VALUE dial e Press the center of the ClickPoint to highlight the field then use A Y to select a program and press the center to finalize your selection e Selecting by Category p 38 Checking the sound of a track Playing the microX s keyboard to hear the sound 1 Use the Control Track setting to choose the track that will respond to the microX s keyboard Hulti Control Track Control Track AE 000 Pop Ballade tate gt Hrt cE e Knob Mod 1 Krob Mod 2 Knob Mod s Knob Mod a i Frea alpro del Hina rusd er Entet 70 If Status p 71 Status and MIDI channel is INT or BTH you can play the microX s keyboard and operate its controllers to hear the microX s internal tone generator with the settings program and level etc of the track you specified as the Control Track Any other tracks that have a matching MIDI channel will also sound at this time If
214. rom tracks whose Status is EXT or BTH allowing you to set up your external sound module in this Way Modename Page number and name Parameter name Category number 7 empo and name Tab name p enero H T Multi Select Wt PUT Select Track i Control Track T81 DFums J 128 Multi Select AILLI ME Stel iF ta multi set knob EAR CITIES Knob oem TTE numberand iBnob Mod 1 Knob Mod z 5nob Mod 3 5nob Mod 4 same Mutti_M Frog 2 Prog 46 Mi 2 isde Tab Control assign list 2 Make sure that Multi Select multi set number and name is selected 3 Use the VALUE dial etc to select the multi set you want to play el PROGRAM PAGE PAGE A B c D E GM A __ SLOWSYNTH FASTSYNTH LEADSYNTH MOTION SYNTH KEYBOARD GUITAR A COMBINATION 3 CATEGORY A B e OOO BASS SE DRUMS EXIT CANCEL D soos MULTI GLOBAL COMPARE UTILITY You can use either of the following methods to select a program e Turn the VALUE dial e Press the center of the ClickPoint to highlight the field then use A Y to select a multi set and press the center to finalize your selection 69 Using and Editing Multi sets Other ways to select a multi set You can t use a foot switch connected to the ASSIGNABLE SWITCH jack to change multi sets For details on how to select a multi set via MIDI see p 77 Assigning a p
215. rom the menu that appears choose Initialize Steps to open the dialog box Initialize Steps TYPE Cancel 5 If you set Type to Empty the pattern will be initialized to an empty state without any tones If you select Full all tones will be occupied In this example choose Empty and press the MENU OK button The pattern will be initialized 99 Arpeggiator settings Editing a user arpeggio pattern in Program mode If you enter this mode from the Program mode your editing will apply to the arpeggio pattern specified for the selected program 1 In Program mode select a program for which the arpeggio pattern you wish to edit is selected or a program that you wish to use as a basis for editing the arpeggio pattern 2 Press the ARP ON OFF button to turn the arpeggiator on the button will light Even if you moved to Global mode from a program in which the arpeggiator was turned off you can use the ARP ON OFF button to turn it on 3 Access the GLOBAL 5 Arp Pattern Setup page Type AS Played iC lFimed Mote Tore t on f i Octave Motion Up ppr Trappen fey Pied 4 In Pattern select the arpeggio pattern that you wish to edit For this example select an empty user arpeggio pattern If a blank pattern is selected playing the keyboard will not start an arpeggio Note Although preset arpeggio patterns Preset 0 Preset 4 can be selected they cannot be edited 5 In
216. rone on on the settings are called in internal memory into the memory area Internal Memory Arpeggio External Global Setting Control Sets Troubleshooting Troubleshooting If you experience problems see the relevant item and take the appropriate measures Power supply Power does not turn on L Is the AC adapter connected to an outlet p 23 C Is the Power switch turned on Turn on the rear panel Power switch p 23 Display The power is turned on but nothing is shown in the display The microX functions normally when you play the keyboard or perform other oper ations LI Due to changes in the surrounding tempera ture the display may on rare occasions be diffi cult or impossible to read If this occurs perform the following procedure 1 While holding down the EXIT CANCEL button press the UTILITY button The GLOBAL button will blink and the Global mode Update Global Setting dialog box will appear Ke if you are unable to read the display or if the Update Global Setting dialog box does not appear check whether the GLOBAL button is blinking If the GLOBAL button is lit or dark the microX may be writing data that was received from an external connected MIDI device or may be responding to a request for output If so make sure that the microX is not writing data from an external connected MIDI device or transmitting data in response to a request or that any such operation
217. rpeggiator A multi set can use two arpeggiators dual poly phonic arpeggiators You can select the arpeggio pattern specify the range in which the arpeggio is generated and specify the region of notes keys or velocities that will trigger the arpeggiator Overview of editing pages The following pages let you edit a multi set in detail e Select a multi set and play the microX s keyboard e Receive and play performance data from 0 Play an external MIDI sequencer Select a program for each track and specify its pan and level e Select an external control set 2 Track Param MIDI OSC Pitch Delay and Scale settings for each timbre 3 MIDI Filterl MIDI message transmission reception 4 MIDI Filter2 filter settings for each track 5 Key Zone e Key zone settings for each track 6 Vel Zone e Velocity zone settings for each track e Arpeggiator settings 7 Arp Ctrls e Controller settings BUS and master effect send level settings for each track e Insert Effect routing selection and settings e Master Effect selection and settings Ponies e Master EQ settings For details on how to access each mode page and the utility commands and how to edit values see Basic operations p 19 8 InsertFX 74 Comparing original and edited sounds When you re in the process of editing a sound pressing the COMPARE button will recall the saved version of the sound as it was before you star
218. s The microX allows you to load individual banks programs or combinations Multi set drum kits arpeggio patterns and external controls can also be loaded individually or as a group This is convenient when you want to restore just one item from the factory preload data or when you want to rearrange combinations in a specific order for live performance amp When rearranging programs you need to be aware that if you write them to another bank or number any combination that had used the program formerly occupying the writing destination will sound differently For example if you want to load combination A000 into C127 proceed as follows 1 Access the dialog box as described in steps 1 4 above Load Freload Data Bind Combination single Rank s ABBE Groovy Monsters To Hoan M C 127 Init Combination 2 Choose Kind and use the VALUE dial etc to select Combination 3 Use the ClickPoint Y to move down and use the VALUE dial to select Single 4 In the same way select combination A000 as the copy source 5 In the same way select combination C127 as the load destination To 6 Press the MENU OK button A dialog box will ask you to confirm the operation 7 Press the MENU OK button once again The data will be loaded and the preloaded combination A000 will be copied into C127 113 Other functions Assigning a name Rename You can modify the name of any
219. s Controls COMBI 7 Ed Arp Ctrls Controls MULTI 7 Arp Ctrls Controls The default assignments for knobs 1 4 are Knob Mod 1 CC 17 Knob Mod 2 CC 19 Knob Mod 3 CC 20 and Knob Mod 4 CC 21 respectively For a complete list of the possible assignments see Knobs 1 4 B Assign PG p 162 Here s an example of how to set up knob 1 to control a Program s filter and amp EG attack time 1 Press the PROG button to enter Program mode 2 Access PROG 7 Ed Arp Ctrls Controls Press the MENU OK button use the ClickPoint to select Arp Controls and then press the center 3 Choose Knob 1 B Knob B Assign and use the VALUE dial etc to select F A Attack CC 73 4 Press the REALTIME CONTROLS SELECT button to select B mode and turn knob 1 to control the EG attack for the filter and amp Note If you wish to keep these settings after the power is turned off you must save the Program Combination or Multi set Adjusting the display con trast You can change the display contrast by adjusting the GLOBAL 0 System Preference page LCD Contrast setting Note If you wish to keep these settings after the power is turned off you must save the Global mode Tap tempo control A tap tempo control function is available in Pro gram Combination and Multi modes In each mode while the arpeggiator is playing you can press the foot switch when Foot SW Assign is
220. s such as por tamento and transpose Effects The output of each timbre is sent to the insert effect the master effects and the master EQ You can use the mixer section to freely specify how the audio signals will be routed There is one insert effect and two master effects and for each of these you can choose one of 89 effect types The master EQ is a stereo three band EQ Note The effect settings created and saved with a program in Program mode are not used in Combination mode Effect settings are made independently for the combination Arpeggiator A combination can use two arpeggiators dual polyphonic arpeggiators You can select the arpeggio pattern specify the range in which the arpeggio is generated and specify the region of notes keys or velocities that will trigger the arpeggiator Controller Setup 7 5 Arpeggiator 7 1 4 Master Effect 1 2 9 1 3 MasterEQ 9 4 AUDIO OUTPUT LMONO R AUDIO OUTPUT INDIVIDUAL 1 2 1 1 9 4 etc indicate the microX on screen pages and tabs Selecting a program for each timbre Overview of editing pages In the COMBI 0 Play page you can select and play combinations select the program used by each timbre adjust the mixing and adjust the arpeggia tor setting The other pages let you modify the sound in more detailed ways Select and play combinations e Select a program for each timbre and set status pan and level Same as the 1 Ed Tone Adjust
221. s tone generator from an external MIDI device select PostMIDI The above listed settings will affect the MIDI data that is received Outgoing MIDI data will be handled with settings equivalent to Key Transpose 0 and Velocity Curve 4 The default settings are Key Transpose 00 Velocity Curve 4 Normal and Convert Posi tion PreMIDI Multi Mode setting You will normally use Multi mode when you re using the microX as a multi timbral sound module to simultaneously play multiple tracks from an external MIDI sequencer However you can also use Multi mode when you want to use the microX as a master keyboard to control an external MIDI sound module Normally you will use Combina tion mode if you re using the microX as a master keyboard Depending on which of these two situations describes your needs you can set the Multi Mode setting in the GLOBAL 0 System Prefer ence page so that the microX will operate opti mally for your situation for Ext Seq is the setting you should choose when using the microX as a multi timbral sound mod ule When you switch multi sets on the microx tracks whose Status is EXT or BTH will not transmit MIDI messages such as program changes This will avoid the undesired situation of the echo back from your external MIDI sequencer switching microX tracks of the identical channel to the same program pan and volume settings etc for Master is the settin
222. s when editing an arpeggio pattern in Multi mode If you have entered this mode from the Combina tion mode the arpeggio pattern selected by the combination will be affected by your editing 1 In Combination mode select a combination that uses the arpeggio pattern you wish to edit For this example select a combination to which arpeggiators A and B is assigned 2 Press the ARP ON OFF button to turn on the arpeggiator the button will light Even if the arpeggiator had been turned off when you moved here you can use the ARP ON OFF button to turn it on However if Arpeggiator Run A or B are not checked and if no timbres have been assigned in Assign then the arpeggiator will not operate 3 Access the GLOBAL 5 Arp Pattern Setup page GLOBAL 3 Arp Pattern Setup Arpeqgio Select Type AS Played Octave Motion Up El 4 If you moved here from Combination mode use the Arp Arpeggio Select A and B to select the arpeggiator that you wish to edit iC lFixed Mote Forgas f i ipbithe PF Bg Pippi If this is A your editing will apply to the parameters and user arpeggio pattern of arpeggiator A If this is B your editing will apply to the parameters and user arpeggio pattern of arpeggiator B 5 Switch between arpeggiators A and B and edit their respective user arpeggio patterns If you wish to stop one of the arpeggiators return to Combination mode and in COMBI 0 Play
223. some representative effects in each category Filter and dynamics control effects Equalizers 07 St Para 4EQ 08 St Graphic7EQ divide the frequency range into several bands and allow you to boost or cut the level of each band Normally they are used to correct or compensate the sound but they can also be used to simulate the frequency response that is typical of a particu lar instrument such as the resonances of a guitar or string instrument Compressors 02 St Compressor compress the dynamic range of the input signal Compression makes the sound punchier and more consistent This is particularly effective on guitar piano or drum sounds 79 Effects settings Limiters 03 St Limiter 04 Mltband Limit limit the level of the input signal to a maximum level that you specify Exciters 11 St Exct Enhcr give the sound greater clarity and definition Enhancers sharpen the out line of the sound bringing it to the front of the mix By using these appropriately you can bring out sounds that were unclear or easily lost in the mix Distortion 06 OD HiGain Wah distorts the sound This simulates the distorted sound that is typically created on a guitar by making the ampli fier distort the sound It is often used not only on guitar sounds but also on rock organ sounds Pitch phase modulation effects Chorus effects 16 St Chorus 19 St Ensemble 26 St BiphaseMod are an effective way to add spa ciousness
224. st the EG release times of the filter and amp This will determine the time from note off until the sound disappears When you adjust the knob the release times of the filter EG and the amp EG will change Normally rotating the knob toward the left will shorten the release time and rotating it toward the right will lengthen the release time Saving your edits note on Attack Level note off Y Break Level Level Y Release Level Sustain Level Time Slope Time Release Time Attack Time Start Level B mode controls You can control parameters such as volume porta mento time pan or filter and amp EG pitch LFO and master effect send levels etc The B mode function settings are made for each individual program combination or multi set You can specify the B mode functions separately for each individual program combination or multi set The B mode functions of the REALTIME CON TROLS 1 2 3 and 4 knobs can be viewed for Program mode in the 0 Play Program page for Combination mode in the 0 Play Combination page and for Multi mode in the 0 Play Multi page amp p 37 Each knob in B mode can also be used as a source for Alternate Modulation or Effect Dynamic Mod ulation to control program parameters or effect parameters allowing you to adjust the sound in a wide range of ways C mode control You can control the effect of the arpeggiator in realtime For details on operat
225. stalled for each USB port If you connect the microX to a different USB port than the one you used when installing KORG USB MIDI Driver for Windows you will need to use the same procedure to install the driver again Using a USB cable connect the USB connector of the microX to the USB connector of your computer Make sure that the plug is oriented correctly and push it all the way into the connector Windows will detect that the microX has been connected 29 Setup i Found New Hardware gt P Professional microX 19 Service Pack 2 j lt _ 2 2 03PM Then the standard driver will be installed automatically i Found New Hardware x Your new hardware is installed and ready to use P Professional 9 Service Pack 2 lt 2 03PM 3 In the task bar choose Start All Programs KORG gt KORG USB MIDI Driver Tools Install KORG USB MIDI Device to start up the setup utility The KORG USB MIDI devices currently connected to your computer will be shown in the list above The lower area will show the version of the KORG USB MIDI Driver that you will be installing Select microX in the list above and click Install Driver installation will begin KORG MIDI Driver Setup Utility 42 gt KORG MIDI Driver Setup Utility Please select the KORG USB MIDI Device which you want to install Confirm that your device is connected to the PC and click Install KORG
226. stem Preference page and uncheck the Memory Protect Combination setting p 88 3 Optionally you can also select a new location or change the Combination s name e If you want to change the bank and number of the writing destination use the ClickPoint to select the combination name located at the right of the To and use the VALUE dial to select the desired writing destination e If you want to change the name use the Click Point to select the text button WW and then press the ClickPoint center to open the text edit dialog box You can give the Combination a descriptive name using the on screen keyboard p 114 After entering the name press MENU OK button The text edit window will disappear returning you to the main Write dialog e If you want to specify the category use the ClickPoint to select Category and use the VALUE dial to specify the desired category The category you specify here can be used when selecting by category with the CATEGORY button p 58 4 In the Write Combination dialog box press the MENU OK button to write save the program 5 Amessage will ask you for confirmation If you are sure you want to write the program press the MENU OK button once again The combination will be written saved 61 Playing and Editing Combinations Detailed Editing with Combinations You can edit any of the preloaded combinations or start with an initi
227. system 9 High pass filter 53 Insert effect 82 84 Install Mac OS X 31 Windows XP 28 J Joystick 40 52 55 67 85 K Key Sync 94 L Layer 64 LFO 50 Load 113 Local Control 32 Low pass filter 53 LPF CUTOFF 44 M Master effect 83 Master EO 83 Master keyboard 33 Memory Protect 88 MIDI 14 35 75 89 Channel 39 63 Datadump 117 Filter 64 Program change 39 58 77 MIDI channel that will control effects 85 MIDI Tempo Sync 51 Index Mode 17 Combination mode 57 Global mode 87 Multi mode 69 Program mode 37 Select 19 Modulation Amp 55 Filter 54 Pitch 52 Monophony 48 Multi mode 69 Multi Mode Global 33 Multi set 69 Multisample 48 Multi timbre 33 Mute 70 N Note Number 40 O OCTAVE 41 88 Oscillator 48 Oscillator Mode 48 107 gt Page 15 Select 19 Page menu 16 Pan Drum Kit 110 Program 56 Timbre 60 Track 71 Parameter 15 Select 20 Performance Edit 43 Pitch 52 Varying the pitch according to keyboard position 52 Pitch bend 52 Pitch EG 52 Polyphony 48 Portamento 52 66 Power 23 88 Power On Mode 88 Program 37 Bank 38 Category 38 Select 37 Program mode 37 R REALTIME CONTROLS 43 B mode 115 Rename 114 Resonance 53 RESONANCE HPF 44 Restoring the factory settings 113 Reverse 49 Routing 81 82 84 S Save 21 117 Combination 61 Drum kit 110 External control 112 Multi set 75 Program 45 User arpeggio 104 Scroll bar 16 Shuffle 95
228. t terns U000 250 1 Press the PAGE button to access the PROG 0 Play Arp Play page Sort Latch FlRey Sync Keyboard eT 2 Use the ClickPoint lt 4 A Y to choose Pattern and use the VALUE dial to select an arpeggio pattern 3 Play the keyboard and try out various arpeggio patterns Quick Start Listening to the demo songs The microX contains demonstration songs Take a moment to listen to these demo songs to experience the diverse sounds and rich expres sive potential of the microx DAMPER USB PEDAL SWITCH IN OUT MAIN OUTPUT INDIVIDUAL OUTPUT ASSIGNABLE MIDI 1 2 J 3 R 1 2 L MONO e CATEGORY AUDITION ARP ON OFF PROGRAM O 41 DDD SLOWSYNTH FASTSYNTH LEAD SYNTH MOTION SYNTH KEYBOARD GUITAR COMBINATION A B c 4 2 CATEGORY COCOC BASS SE DRUMS 5 ee EXIT CANCEL Y MENU OK MULTI GLOBAL COMPARE k UTILITY 1 Hold down the CATEGORY button and press the AUDITION button The Demo Song Player page will appear Demo Sond Select Demo nstration1 Play Mode Continue to rest song O Repeat AT Press AUDITION 2 Press the AUDITION button to begin playback 3 Press the AUDITION button once again to stop playback 4 To select a song for playback use the ClickPoint A Y to select the song name Demo Song Select and use the VALUE dial to change songs 5 To exit the Demo Song Player page press the E
229. t for some combinations When you play a key on the keyboard the arpeggiator will start For other combinations you can press the ARP ON OFF button the button will light to turn on the arpeggiator amp In Combination and Multi set depending on the arpeggiator A B settings the arpeggio may not start when you press the ARP ON OFF button to turn it on p 96 Select the arpeggiator s that will run 2 As described in Arpeggio controllers p 91 and in Editing arpeggio settings that appear in the display below operate the controllers or edit the parameters to hear how the arpeggio changes 95 Arpeggiator settings Note The ARP ON OFF button and the REALTIME CONTROLS C mode 1 ARP GATE 2 ARP VELOCITY 3 ARP LENGTH and 4 TEMPO knobs are valid for both arpeggiators A and B Their state will be memorized when the combination is written Editing arpeggio settings that appear in the display You can make arpeggiator related settings in the COMBI 0 Play Arp Play A and B pages or in the COMBI 7 Ed Arp Ctrls page The 0 Play Arp Play A and B pages contain selected parameters taken from the 7 Ed Arp Ctrls Arp A and B pages that are particularly effective for editing during a performance However parameters other than Swing can be controlled as described in Arpeggio controllers p 91 With the following exceptions the display settings in the 0
230. t it affects the fil ters is controlled by the parameters described below on the Filter Mod page The Int to A and Int to B settings control the basic amount of EG modulation for filter frequen cies A and B respectively before other modula tion The Vel to A and Vel to B settings let you use velocity to scale the amount of EG modulation The AMS setting selects a AMS modulation source to scale the amount of the Filter EG applied to Filters A and B The two filters share a single AMS source with separate intensity settings FROG d Ed Filter1 Mod 1 KE0TFEK Rey Low Keyboard Track Key Low E EB High CHdA Int to A 58 B 56 Ramp Low 38 High 68 Filter EG Int to R 66 t 6B 88 AMS Off Wel to 437 to 6 488 iint to A 88 E 00 A Easic Mood Ji Hode Wifetedi EG FROG d Ed Filter1 EG Start Level L SPER A 30 6499 5 430 B 60 Thee IBA S494 Ra ie Levei Mod Time Hod AMS Ott AMS Velocity 82 Ar D S R 468 5 8 AA BA i AMS2 0F 468 7 6 0 6 5 8 B Basis l odd MhMed2 Wfottodll EG LFO modulation You can modulate the filter via LFO1 and LFO2 Among other applications LFO modulation of the filter can produce the classic auto wah effect The Ed Filter1 LFO Mod or Ed Filter2 page lets you set up the following parameters separately for each LFO Intensity to A and Intensity to B specify how much the LFO changes the tone JS Y Int
231. t your hands off of the keyboard Damper Switch vs Half Damper You can use either a standard footswitch such as the Korg PS 1 or a special half damper pedal such as the Korg DS 1H as the Damper If you use a footswitch it will work like a normal synthesizer sustain pedal notes will sustain for ever as long as the pedal is held down A half damper pedal is a special type of continu ous foot pedal normal foot pedals won t work properly for this application It offers more subtle control of sustain which can be especially useful for piano sounds 41 Playing and Editing Programs The microX will automatically sense when a half damper is connected to the rear panel DAMPER jack For proper operation you will also need to calibrate the pedal using the Half Damper Cali brate command in the Global page menu PG p 77 Assignable Foot Switch This lets you use a simple footswitch such as the Korg PS 1 as an assignable controller The foot switch can perform a wide variety of functions such as e Sound and effect modulation e Portamento on off e Program select up or down e Tap Tempo e Arpeggiator on off e Duplication of many front panel controls including the modulation Joystick Real Time Knobs Functions other than the above Sound and effect modulation will always operate as specified by the GLOBAL 0 System Foot page regardless of the currently selected program combination or mu
232. tch between different tracks in a combination just as you can in a combination For more details see Layers Splits and Velocity switches p 64 Effects Effects are covered in their own section of the manuals so we won t go into too much detail here p 79 Insert Effect You can make settings for the insert effect in the MULIT 8 InsertFX page The output of each track can be sent to the insert effect You can use any type of effects from distor tions and compressors to choruses and reverbs The Insert Effect can be routed to the main out puts or to any of the individual outputs p 84 Master Effects You can make master effect settings in the MULTI 9 MasterFX page There are two Master Effects which are accessed through Sends 1 and 2 These are best suited to effects such as reverbs and delays but you can use them with any type of effect e p 85 Master EQ You can make master EQ settings in the MULTI 9 MasterFX page The master EQ is located immediately before the MAIN OUTPUT L MONO and R outputs Use it to adjust the overall tone p 85 Saving your edits Once you ve tweaked the sound to perfection you ll want to save your work To save your edits 1 Press the UTILITY button to access the utility menu 2 Use the ClickPoint to select Write Multi and then press the ClickPoint center The Write Multi dialog box will appear Write Multi Bee W Pops Ballade To
233. te on This can create cool effects and more dramatic layers You can specify the delay for each Timbre either in milliseconds ms or in rhythmic values which sync to the system tempo If you set the Delay to Key Off the Timbre will sound when the note is released Use Program s Scale This specifies the scale for each timbre If you check Use Program s Scale the scale specified by the program will be used Timbres for which this is not checked will use the Scale setting Type Combi scale Editing Programs with Tone Adjust Using Tone Adjust you can make detailed edits to Programs within the context of the Combi You can assign six parameters to each timbre and adjust them but you can also re specify parame ters and make further adjustments Proceed as follows 1 Of the COMBI 1 Ed Tone Adjust TA1 TA3 pages access the page that you want to edit COMBI 1 Ed Tone Adjust TA1 Destination 1 Moti El Moti ElMoti FA Meti Meti Ratio ti Elmoti ne Fe LFF Fe LPF Re LEF Re LPF Pe LEF Re LPF Fe 00 00 00 00 00 too too l too Race HF aso HF azo HF az HF Resy HF Resy HF Resy HF Reso HF n 00 00 00 00 00 00 ite a ee m a 2 For each timbre use Destination 1 6 to select the parameter that you want to adjust for the program 3 Use the VALUE dial etc to adjust the value of the parameter you selected in Destination 1 6 The sound wi
234. ted editing To indicate that you are listening to the saved version the button s LED will light up Pressing COMPARE button again returns you to the version you are editing and the LED will go out again If you edit while the COMPARE LED is lit the button will again go dark and your previous edits will be lost Using Controllers Just as in other mode you can use controllers such as the joystick OCTAVE Y A buttons and REALTIME CONTROLS 1 4 to add a broad range of expression to your playing in Combina tion mode These controls let you modify the tone pitch vol ume effects etc in realtime while you play REALTIME CONTROLS 1 2 3 and 4 will also function as external controls Altering Programs to fit within a Multi set You can make adjustments to the sound of the pro gram for each track for example by changing the way it plays or by adjusting its pitch or scale You can make various changes to Programs within the context of a particular Multi set to make them fit better with other Programs or to create particu lar sonic effects These changes do not affect the original Programs or how those Programs sound in other Multi sets It is the same as for a Combina tion For more details see Altering Programs to fit within a Combination p 66 Layers Splits and Velocity Switches Layers Splits and Velocity Switches You can use keyboard regions and velocity to swi
235. th Program s 46 Befor you begin editing LLL uu 46 Basic oscillator setine Sepertos 48 Using LFOs and Envelopes EGs 50 Using Alternate Modulation 51 Contou a P L Luma eateries 32 Using TETE a tcerraterteeeeete eee 53 Usine le Amp SECU OM a u a asuapash 55 ere re cee ee amani aaa 56 Playing and Editing Combinations 57 Playing combinations 57 OCISCUTS compINANON Sieen 37 Using Controller S secies 59 Simple combination editing 60 Changing the programs within the OTD A OTN yi sperctesdc restos AE 60 Adjusting a timbre s pan and volume 60 REALTIME CONTROLS 1 2 3 4 FELEC T aumsqikaseaqasyanhaanqacpapsasaqasqtukhyaaqapayamii 61 DAVIS your COS uu u w ashaka 61 Detailed Editing with Combinations 62 Before you begin editing 62 Selecting a program for each timbre 63 Slatusand NIIDI seling Soses 63 Layers Splits and Velocity switches 64 Altering Programs to fit within a Bc ci ash avst a 0 5 irene meee errant pre rete ste ora ante eta 66 ME EE A E AEE 68 Using and Editing Multi sets 69 MIDI considerations 69 Pele CUS apulli u u u unas Ssusss 69 Assigning a program to a track and setting Me vyolume and pali uuu uu u petis 70 Copying the settings of a combinat
236. the demo songs After you ve finished reading this Quick Start section please also take a look at the full explana tions that follow Setup amp Make all your connections with the power off on all units If you don t you may damage your speaker system or damage your microX and or other equipment Please use caution 1 Connect the included AC adapter Use only the AC adapter included with the microX Do not use any other AC adapter Connecting the AC adapter STANDBY ON 4 Cable hook p itch 2 Connect the microX to your audio L Power switc monitoring system Using standard audio cables with 1 4 1 Power connector phone plugs connect the microX MAIN AC adapter OUTPUT L MONO and R output jacks to the input jacks of your mixer Be careful not to bend this portion excessively when you A wrap the cable amplified monitor speakers or audio PlugintoanAc M through the cable recording device outlet hook If you re listening through headphones connect them to the headphone jack 3 Power cable located on the left front of the microX The headphones produce the same signal as the MAIN OUTPUT L MONO and R jacks Audio output device w connections O O Powered monitors I Power switch Adjust the VOLUME slider Headphones A micro 2
237. the display The GM button operates differently from the other bank buttons Each time you press this button the bank will switch in the order of G gt g d gt G gt g d etc The programs are organized into banks of 128 except for g d Select the desired bank and then select a program number within that bank 5 Play the keyboard to hear the program you selected While playing the keyboard use the joystick and realtime controllers to modify the sound The result will differ depending on the program so play the keyboard while operating these controllers to hear what they do You can use the OCTAVE Y A buttons to change the pitch in steps of one octave For more about the controllers see Using controllers to modify the sound r p 5 You can also press the AUDITION button it will light and a riff phrase suitable for that program will play automatically Using the CATEGORY and PROGRAM COMBINATION buttons to select a cat egory The microX lets you choose programs from categories such as synthesizer bass or drums E 1 CATEGORY AUDITION ARP ON OFF CONTI PROGRAM PAGE PAGE A 3 SLOW SYNTH FAST SYNTH LEAD SYNTH MOTION SYNTH KEYBOARD GUITAR S NpasaX gt s_ l i een z CATEGORY a O COO BASS SE DRUMS EXIT CANCEL Y MENU OK MULTI GLOBAL COMPARE UTILITY 1 Press the CATEGORY button The category menu will appear Category No Sel Select
238. time con troller mode A B C and use knobs 1 4 to con trol the tone effects MIDI control changes and arpeggiator etc while you perform Specifically you can use these controllers to edit the filter cutoff frequency resonance amp and fil ter EQ volume portamento time pan pitch LFO and master effect send level etc You can also use them to modify the arpeggiator tempo gate velocity and length For more details see p 43 and p 91 1 Press the REALTIME CONTROLS SELECT button to switch the function of the realtime controllers to A mode B mode or C mode 2 Rotate the desired knob to control the sound etc The REALTIME CONTROLS 1 2 3 and 4 knob B mode functions can be viewed for Program mode in the 0 Play Program page for Combina tion mode in the 0 Play Combination page and for Multi mode in the 0 Play Multi page p 37 Note If you turn the EXT CONTROLLER button on lit these knobs will be switched to the external control function and will be disconnected from the internal sound generator The REALTIME CONTROLS 1 4 knobs will transmit MIDI messages as specified by the external control setup to your external MIDI equipment Using the pedals for control Damper Pedal Sustain The damper pedal is also sometimes called the sustain pedal It acts like the similarly named pedal on an acoustic piano when you hold down the pedal notes will continue to sustain even when you lif
239. ting system Mac OS X version 10 3 9 or later Options Expression volume pedal XVP 10 EXP VOL pedal Foot controller EXP 2 Footswitch Damper pedal DS 1H MIDI cable Appearance and specifications of this product are subject to change without notice Feb 06 123 Ox Ox Ox Ox Ox Ox Ox Ox Ox Ox d HOLIMS 318VNSISSV Wadd 318VN9ISSV se Ajuo p p usue Vx Oy ISN GS71 NdYN u w 1 dq JUSWSJOU geq gs1 GSW Aua 2q XAN LXSWN X4I SSO NO 834I 7 pu s J9 JOUOD YMS 1004 Z L YAMS Z2 6L LL PL Wp Sl01uoo awnjeay punos HOS o nu89 soS MS O UaWeLOY dwed Z JOMUOD 29 43 uoiss dx4 ued ued y4 OWN O A awi OJUGWELOY epad A A yousAor gs7 ASW 1919S ueg ZZ O Suequinu lou ie yusue1 ueo gyep JOTeEIBBaduy eq s q snn so gt x ZZL 0 A U6 O Zl 0 121 0 sk sk sk sk K K K K K ok ok K k ok x x ZZL 0 A U6 O OK K K K K k K K K K K K K Ocl 0 94 4 91 1 pezuowey 91 1 91 1 Appendices vol 9002 91EG Q eyo uolglu uu ldui IGIN 66 86 16 96 gs 9 G6 V6 Z6 16 S6 8 Z8 18 08 bueuo 6 0Z OuJU0D Z9 99 S9 v9 EL ZL LL Ol 8 Z S P Z Ze O pu d Yd jauUeYD 3luoudouolN Aay Sluoud joqg yonoy yy HO 30N UO SION MOO A DOA 8M QWNN ON POI sobessoy D ZIH
240. tput Impedance 339 36 mil Load impedance 33Q Control huts DAMPER half damper supported ASSIGNABLE SWITCH ASSIGNABLE PEDAL IN OUT us fuss DC power inlet switch Dimensions WxDxH 606 x 226 x 80 mm 2 4kg Power supply voltage de Power Consumption 10W A AC adapter Operation guide CD ROM microX Editor Plug In Editor KORG USB MIDI driver Parameter ccessories guide External Control Template Operating requirements for connection to a computer KORG USB MIDI Driver operating requirements iyu A computer with a USB port that satisfies the requirements of Microsoft Windows XP Windows Operating system Microsoft Windows XP Home Edition Professional or x64 Edition The driver for x64 Edition isa Beta version An Apple Macintosh with a USB port that satisfies the requirements of Mac OS X Macintosh Operating system Mac OS X version 10 3 or later microX Editor Plug In Editor operating requirements CPU Pentium III 1 GHz or better Memory 256 MB or more Windows COInpatei Monitor 1 024 x 768 pixels 16 bit color or better A computer with a USB port that satisfies the requirements of Microsoft Windows XP Operating system Microsoft Windows XP Home Edition or Professional Service Pack 1 or later CPU Apple G4 400 MHz or better Memory 256 MB or more Macintosh Computer Monitor 1 024 x 768 pixels 32 000 colors or better An Apple Macintosh with a USB port that satisfies the requirements of Mac OS X Opera
241. tracking AMS Alternate Modu lation Source Dmod Dynamic modulation and the joystick You can use these modulators and controllers to apply change to the basic sound of the program Take a look at the diagram entitled Program structure and corresponding pages Notice that the audio signal flows in the order of Oscillator Pitch Filter Amp Also notice how modula tors such as EG and LFO can affect these blocks As shown in figure a program consists of OSC 1 2 effects and the arpeggiator OSC 1 2 Each timbre consists of Oscillator Pitch Filter Amp EG and LFO blocks You can create more complex programs by using two oscillators together in one program using the Layer feature Note The Pitch EG is shared by OSC1 and OSC2 EFFECTS The output of OSC 1 2 is sent to the insert effect the master effects and the master EQ The mixer section lets you control the routing so you can specify where the sound will be sent Controller Setup 13 Arpeggiator 1 12 Insert Effect Insert Effect Master Effect 1 2 9 1 3 Insert Effect AUDIO OUTPUT MasterEQ 9 4 LMONO R Master Effect Individual AUDIO OUTPUT Output INDIVIDUAL 1 2 lt a Oscillator Pitch m Filter a Amplifier aaa Fffect p n T 1 1 9 4 etc indicate the microX on screen pages and tabs Before you begin editing For the one insert effect and the two master effects you can choose from
242. trollers such as the Joy stick and Real Time Knobs Incoming MIDI controllers e Modulators such as the Filter Pitch and Amp EGs or the LFOs Intensity is a parameter that sets the degree speed depth amount etc to which AMS will control the modulation A number of frequently used modulation rout ings such as using the joystick to vary the pitch are provided as additional dedicated routings separate from AMS Note that not all AMS sources may be available for some modulation destinations For details on alternate modulation and AMS see Alternate Modulation Source AMS PG p 151 Suggestions on using AMS When making settings for alternate modulation think of the effect that you wish to produce what type of modulation will be necessary to produce that effect and what parameter of the oscillator filter or amplifier needs to be controlled Next select a source AMS and set the Intensity If you proceed logically in this way you will achieve the desired effect For example if you want to control a guitar sound so that it approaches feedback when you move the joystick you might set up the joystick to modulate the filter frequency and resonance 51 Playing and Editing Programs Controlling Pitch Here you can specify how the pitch of the multi sample selected for the oscillator will change Pitch EG and LFO settings allow the pitch to var ied over time Note To specify the bas
243. turn to Program mode by pressing the PROGRAM A GM of any bank other than the bank in which you were editing the settings you had been editing will disappear For this reason we recommend that you return to Program mode by pressing the GLOBAL button once again rather than by pressing a PROGRAM A GM button The same is true for the MULTI button PROGRAM SLOW SYNTH FASTSYNTH LEADSYNTH MOTION SYNTH KEYBOARD GUITAR COMBINATION SE BASS DRUMS MULTI GLOBAL COMPARE 2 Selecting pages Each mode has a large number of parameters which are grouped into pages These are further subdivided by tabs into up to eight tab pages e Make sure that the desired mode is selected For details on selecting a mode see 1 Selecting modes above In this explanation we ll use Combination mode as an example Press the COMBINATION A C buttons Combination Combi Select Category 13 Comples 2 SE wg H92 000 Groory Monsters ITTTSREL knob 2 E et Knob S Eae Bnob 4 E FRAO Mod 1 Bro Mod 2 Krob Pod 3 Note The COMBI 0 Play page will appear This is shown in the upper left of the display In Combination Program or Multi modes i e in other than Global mode you will normally perform in this 0 Play page You can also make simple adjustments edits to the sound while you re in this page To make more detailed adjustments use page 1 COMBI 1 Ed Tone Adjust etc and following Selecti
244. udes a complete synthesis voice with velocity switched Multisamples dual filters EGs LFOs and so on Drums mode is a special variation of Single mode and uses a Drum Kit as created in Global mode instead of Multisamples Polyphony Polyphony is the number of notes that can be played simultaneously such as in a chord The polyphony depends on the program type Program type Polyphony Single Drums 62 Polyphonic monophonic playing The Voice Assign Mode selects whether the Pro gram will play polyphonically Poly or mono phonically Mono PROG 1 Ed Basic Proc Oscillator Mode Double Voice ASSign Mode Single Trigger Hold FlLegato Priority Last Basic Voice Assign Mode Euzie Mosti JL oce JD DUZone When this is set to Poly you can play both chords and melody lines When this is set to Mono only one note will sound even if you play a chord Normally you ll set this to Poly but Mono is use ful when playing sounds such as synth basses synth leads and other solo instruments Another important aspect of monophonic playing is Legato triggering When Legato is on the box is checked if anew note on the keyboard is played before the previous note is released the filter and amplifier 48 EGs will not re trigger so that you can move from note to note in a true legato fashion If the previ ous note is released before the next note is played the note will trigger normally Try switching bet
245. ugh the insert effect Selecting an insert effect and rout ing after the insert effect Insert Effect BUS Select Send2 MFX2 IFX On Off Pan CC 8 Send1 MFX1 RTE rE InsertFx fetdb inser a ED eee gt CAd LAR 51 826 52 026 ch Lr 7 FH MST Compressor 12345678 g setup M F Routing IFX On Insert Effect The Setup page displays the state of the routing and insert effect settings COMBI MULTI 8 Insert Effect P COMBI MULTI 9 Master Effect IFX Indiv Out Pan BUS Select Timbre Track 1 G BUS Select Timbre Track 2 O Bus Select Timbre Track 3 G Bus Select Timbre Track 4 BUS Sate e Timbre Track 8 BUS Select e e e Track 16 BUS Select Select from DKIT L R IFX 2 stereo 1 2 1 Off Post IFX 1 Insert Effect Pan CC 8 BUS Select BUS Select L R Select from L R 1 2 1 2 Off Send1 Send2 L R BUS AUDIO OUTPUT MAIN L MONO R Post IFX Send1 2 Chain Master Effects Return1 2 MFX2 Q stereo AUDIO OUTPUT INDIVIDUAL 1 2 Dynamic modulation and BPM MIDI Sync In this example IFX is used by 2 timbre 2 and 5 timbre 5 In the same way as for a program you can select the insert effect turn it on off and set the Pan CC 8 BUS Select S1 Send 1 MFX1 and S2 Send2 MFX2 parameters that follow the insert effect p 82 Master effects Mast
246. ulti mode you can play different Programs by changing the keyboard velocity e See PROG 6 Ed Amp1 2 Mod amp p 55 PG p 21 for information on how to change the vol ume level and envelope using key velocity e See PROG 4 Ed Hilter1 2 Basic Mod 1 p 54 PG p 16 for information on how to change the brightness and tonal color of the sound using key velocity e See PROG 2 Ed Pitch OSC1 2 PG p 10 for information on how to control the pitch change using key velocity Note Number Sounds can be programmed to change in character based on the note being played As you play higher or lower on the keyboard the note number can modulate the timbre such as becoming brighter as you play higher Envelopes may also become faster or slower the volume may change and so on Joystick You can use the joystick to vary the pitch or adjust the depth of modulation The actual result will depend on the program but these controllers are normally used to apply the following effects Y Deepen the vibrato X Lower the pitch Raise the pitch Deepen the wah effect Joystick movement in the X X axis can adjust the amount of pitch bend PROG 2 Ed Pitch OSC1 p 52 PG p 10 Using Controllers Joystick movement in the X X axis can vary the cutoff frequency PROG 4 Ed Filter1 2 Mod 2 PG p 16 Joystick movement in the Y axis can adjust the depth of vibrato PROG 2 Ed Pitch OSC 1 2 LFO p 52 PG
247. urn to the previous edits by pressing the COMPARE button again amp The Compare function is not available in Global mode 4 Selecting and executing a Utility function The utility functions provide commands that are specific to each page such Write save or Copy The available utility functions will depend on the page you select For example the utility functions in Program mode let you write save the settings or let you perform convenient editing operations such as copying settings between oscillators or effects or a Sync function that lets you edit two EGs together 1 Press the UTILITY button The utility menu will appear 2 Use the ClickPoint Y to select a command 3 Press the ClickPoint center A dialog box for the selected utility will appear Alternatively you can access the dialog box by pressing the UTILITY button once again or pressing the MENU OK button For check type commands the status of the command will simply change without any dialog box appearing 4 Use the ClickPoint lt 4 A J Y to select a parameter in the dialog box 5 To set the parameter value use the VALUE dial or the ClickPoint press the center and then use Y 6 To execute the utility command press the MENU OK button If you decide not to execute press the EXIT CANCEL button The EXIT CANCEL button is the same as Cancel Done or SE The dialog box will
248. us of the internal tone generator for each track If you want the microX s internal tone generator to sound choose the INT or BTH setting These set tings let you use your external MIDI sequencer to play the microX as a multi track sound module The BTH setting lets you control an external MIDI device at the same time that you play the internal tone generator Choose the Off setting for tracks you re not using With the Off EXT or EX2 settings the internal tone generator will not sound With the BTH EXT or EX2 settings you can play an external sound module on the MIDI channel of the Control Track MIDI data is transmitted and received on the MIDI channel that is specified separately for each track us MIDI Channel Data from Arp Operations on the microX Status hs MIDI OUTI tone MIDIOUT ooo USB ta USB Received data a EE E E P y e For more details see Status PG p 61 Bank select when Status EX2 If the Status is EX2 the LSB value and MSB value of the Bank Select MSB LSB will be enabled and the bank number you specify here will be transmitted via MIDI MIDI channel This specifies the MIDI channel that the track uses to send and receive note data If multiple tracks are set to the same MIDI channel and their Sta tus is set to INT they will all sound and be con trolled in the same way when they receive MIDI data The Control Trac
249. use one arpeggiator In Combination mode and Multi mode the microX features a Dual Polyphonic Arpeggiator that lets you simultaneously use two arpeggio pat terns You can take advantage of this in many ways such as applying separate arpeggio patterns to a drum program and a bass program or using keyboard zones or velocity splits to switch between two arpeggio patterns Preset arpeggio patterns With the factory settings this contains a variety of preloaded user arpeggio patterns You can create and write your own user arpeggio patterns U000 250 Arpeggiator features in Program mode Using the arpeggiator in Program mode 1 Press one of the PROGRAM A GM buttons The button will light Program mode is selected 1 p 37 Selecting programs As you select various programs you will notice that the ARP ON OFF button will light for some programs Play the keyboard of the microX and the arpeggio will start For other programs you can press the ARP ON OFF button the button will light to turn on the arpeggiator Arpeggios will begin sounding when you play the keyboard 2 As described in the following sections Arpeggio controllers and Editing arpeggio settings that appear in the display p 92 move the controllers or modify the parameters to change the way in which the arpeggios are played Arpeggio controllers Arpeggiaror on off ARP ON OFF Each time you press the ARP ON OFF
250. uses and reverbs The Insert Effect can be routed to the main out puts or to any of the individual outputs gt p 84 Master Effects You can make master effect settings in the PROG 9 Ed MasterFX page There are two Master Effects which are accessed through Sends 1 and 2 These are best suited to effects such as reverbs and delays but you can use them with any type of effect p 85 Master EQ You can make master EQ settings in the PROG 9 Ed MasterFX page The master EQ is located immediately before the MAIN OUTPUT L MONO and R outputs Use it to adjust the overall tone p 85 Playing and Editing Combinations What s a Combination Combinations or Combis for short let you split and layer up to 8 Programs at once A Combi is made up of 8 Timbres Each Timbre has a Program along with parameters for key and velocity zones mixer settings MIDI channel and Playing combinations Selecting combinations There are several different ways to select Combi nations Each one is convenient in a different way Selecting combinations from the front panel Using Combi Select to select a program Turn the VALUE dial Press the center of the ClickPoint to high light the field then use Y to select a program and press the center to finalize your selection Use the COMBINATION A C buttons to select a combination bank Selecting combinations by program category You can select
251. uts gt p 84 Master Effects You can make master effect settings in the COMBI 9 Ed MasterFX page There are two Master Effects which are accessed through Sends 1 and 2 These are best suited to effects such as reverbs and delays but you can use them with any type of effect p 85 Master EQ You can make master EQ settings in the COMBI 9 Ed MasterFX page The master EQ is located immediately before the MAIN OUTPUT L MONO and R outputs Use it to adjust the overall tone p 85 Using and Editing Multi sets Multi mode is great when you want the microX to simultaneously play multiple tracks of data from your external MIDI sequencer This section explains how to use the Multi mode You can use the microX as a sixteen channel multi timbral sound module It has sixteen tracks and you can assign a different sound program to each track such as track 1 playing the drums track 2 playing the bass track 3 playing the piano and so on You can make settings such as volume and pan for each of these tracks You can also use realtime con trollers to vary the sound In addition you can use the arpeggiator and syn chronize it to the tempo of your external MIDI sequencer The microX can also be used as a master keyboard to control your external MIDI sound modules MIDI considerations In Multi mode you will normally switch programs and control the volume and pan etc by sending MIDI messages from your MIDI se
252. ween Poly and Mono and listen to the results Working with Multisamples What is a multisample A sample is a digital recording of a particular instrument or waveform or other natural or artifi cially processed sound recorded at a specific pitch A multisample is a collection of similarly voiced samples used to create the same type of sound piano bass guitar strings organ across the entire keyboard as the basis of a program The oscillators of single and double programs use mul tisamples There are 624 multisamples available in this instrument You can assign up to two multisamples to each oscillator and switch between them by velocity This is called velocity multisample switching Multisamples and Drum Kits Multisamples and Drum Kits allow you to play samples in different ways e Multisamples lay out one or more samples across the keyboard For instance a very simple guitar Multisample might have six samples one for each string e As the name suggests Drum Kits are optimized for playing drum samples Selecting Multisamples If you specify a High and Low multisample for an oscillator either the High or the Low multisample will sound depending on the velocity of the note i e the strength at which you play the keyboard This function is called velocity multisample switching Note To make it easier for you to hear the result set the program type to Oscillator Mode Single 1 Access the PROG
253. x will change Use the ClickPoint lt Y to select a character Press the center once again to finalize the selection Use the ClickPoint to select the next character and enter it in the same way The function buttons shown in the lower line perform the following operations Use the ClickPoint lt 4 A Y to select a function and press the center to execute it Clear Erase all text Del Delete Delete the character at the cursor location Ins Insert Insert a space at the cursor location Cap Capital Switch between uppercase and lowercase letters Enter the remaining characters as described in step 3 Press the MENU OK button If you opened the text dialog box from the utility dialog box in step 1 you will return to the previous dialog box In that dialog box press the MENU OK button twice to execute the Rename operation If you opened the text dialog box from the GLOBAL 3 page in step 1 the Rename operation will be executed Assigning functions to REALTIME CONTROLS B mode knobs 1 4 Assigning functions to REAL TIME CONTROLS B mode knobs 1 4 Here s how you can assign functions to REAL TIME CONTROLS B mode knobs 1 4 The functions of these knobs in B mode can be separately assigned for each program combina tion and multi set You will make these settings in Knob B Assign in the following pages x Mode Page PROG 7 Ed Arp Ctrl
254. y notes with a velocity playing strength that is within the specified range Notes played with a velocity outside this range will be sounded normally without regard to the arpeg giator on off Writing saving the arpeggiator set tings Arpeggio parameters you edit in Program mode are saved along with the data when you write the program For details on how to write see Saving your edits p 45 Linking the arpeggiator to a program You can specify whether the arpeggio settings writ ten in a program will also be selected when you switch to that program or whether the existing state of the arpeggiator will be maintained With the factory settings the former setting is selected If you want to use the latter setting check Program in Auto Arp GLOBAL 0 System Basic page The arpeggiator in Combina tion and Multi modes In Combination and Multi mode the microX pro vides dual polyphonic arpeggiator functionality that lets you use two arpeggio patterns simulta neously The settings in each of these modes are made in the similar way As an example the following explanation shows how to make settings in Combination mode Using the arpeggiators as you play in Combination mode 1 Press a COMBINATION A C button The button will light You will enter Combination mode gt p 57 Selecting combinations As you select various combinations you will notice that the ARP ON OFF button will ligh
255. y strongly e Eras fg 2 trin Hoti Hoti Hoti Foti Hoti Foti 27 2 jar ee ae ed BGI Bed 65 Playing and Editing Combinations Velocity Zone Slope Similar to Key Zone Slopes as described above these let you fade in and fade out sounds gradu ally over a velocity range instead of a simple hard switch We ll assume that you are continuing to edit from the preceding example 1 Access the COMBI 6 Ed Vel Zone Vel page 2 In the case of the above example you could set the velocity zones of the two Timbres so that they partially overlap 3 Access the COMBI 6 Ed Vel Zone Slope page 4 Then set the Top Slope and Bottom Slope so that the sound changes gradually instead of changing suddenly between velocity values of 63 and 64 Moti Mati Hoti Moti Moti B B 5 The COMBI 6 Ed Vel Zone Review page shows a graphic indication of the region of velocities for which timbres 1 8 will play The region that will sound is shown as a line and the shaded area indicates the portion occupied by the slope 66 Altering Programs to fit within a Combination You can make various changes to Programs within the context of a particular Combination to make them fit better with other Programs or to create particular sonic effects These changes do not affect the original Programs or how those Pro grams sound in other Combinations Specifying how the timbre will sound COMBI 2 E

Korg microX Musical Instrument User Manual

Contents

Download Pdf Manuals

Related Search

Related Contents