Home

Husqvarna 1030 BioClip Lawn Mower User Manual

Contents

1. 850 900 1800 1900 MHz GPRS Class 10 Sensors Accelerometer Ports for serial communication UART for PC communication UART for communication with Automower Computer memory Flash Materials Circuit board English 73 11 ENVIRONMENTAL INFORMATION Data Dimensions and weight GPS communication unit 95 x 178 x 20 mm 80 grams Compatibility Husqvarna Automower 220 AC 230 ACX Solar Hybrid 265 ACX Certifications CE FCC ID ZAS GPS MODULE This unit complies with Part 15 of the FCC rules The use of the product is subject to the following two conditions 1 The unit may not cause harmful interference 2 The unit must be able to handle all interferences including interference that may Cause undesired effects The GPS communication unit includes radio devices The GPS communication unit is not for portable use The GPS communication unit is sold only for use in any of the following models Husqvarna Automower 220 AC 230 ACX Solar Hybrid and 265 ACX Husqvarna AB does not guarantee full compatibility between the Automower and other types of wireless systems such as remote controls radio transmitters hearing loops buried electric animal fencing or Similar 11 Environmental information The symbol on Husqvarna Automower or its packaging indicates that this product may not be treated as household waste It should instead be
2. sg A warning box indicates a risk of personal injury exist especially when the stated instructions are 0 WARNING not followed XXXXXX XXXXX XXXX XXXX XXXXX XXX e An information box indicates a risk of material damage exist especially when the stated IMPORTANT INFORMATION instructions are not followed The box is also used where there is a risk of user error XXXXXX XXXXX XXXX XXXX XXXXX XXX English 7 1 INTRODUCTION AND SAFETY 1 4 Safety instructions Use e This robotic lawn mower is designed to mow grass in open and level ground areas It may only be used with the equipment recommended by the manufacturer All other types of use are Incorrect The manufacturer s instructions with regard to operation maintenance and repair mustbe followed precisely e The robotic lawn mower may only be operated maintained and repaired by persons that are fully conversant with its special characteristics and Safety regulations Please read the Operator s Manual carefully and make sure you understand the instructions before using the robotic lawn mower e tis not permitted to modify the original design of Automower All modifications are made at your own risk e Check that there are no stones branches tools toys or other objects on the lawn that can damage the blades and cause the mower to Stop Start Automower according to the instructions When the main switch is in the ON position
3. Commands Day timer Timer Week timer Installation Settings English 49 6 MENU FUNCTIONS Timer override 2 1 If you set the timer on your Automower you can use this function to temporarily abandon the settings Timer override n e YES 2 1 1 a NO P Move the cursor to YES and press YES to turn Day timer 4 off the timer function e NO 2 1 2 Week timer Move the cursor to NO and press YES to turn on the timer function Day timer 2 2 Itis possible to set two different start and stop times for each day Enter the required time in hours and Reset all timers minutes and press YES to confirm the entered time e Reset all timers 2 2 1 Start time 1 To delete all set times Select the function and eri ins press YES when the cursor is on Yes Stop time 1 e Start time 1 2 2 2 Day timer e Stop time 1 2 2 3 Sa e Start time 2 2 2 4 s e Stop time 2 2 2 5 Start time 2 Week timer 2 3 Use the YES button to select deselect the days you would like Automower to mow not mow Automower Timer override will mow on the days prefixed by a checkmark e Mon 2 3 1 Day timer e Tue 2 3 2 Week timer e Wed 2 3 3 e Thu 2 3 4 e Fri 2 3 5 e Sat 2 3 6 e Sun 2 3 7 e Run all 2 3 8 The function Run all selects all the days If you would like the mower to mow every day of the week move the cursor to Run all and press YES Then press YES again to the question All ON 50 English
4. e The warnings and safety instructions in this Operator s Manual must be carefully followed if the mower is to be used safely and efficiently Automower can only start when the main switch is moved to the ON position and the correct PIN code has been entered Inspection and or maintenance must be carried out with the main switch set to OFF e Keep your hands and feet away from the rotating blades Never place your hands or feet close to or under the body when Automower Is in operation Do not ride on Automower e Noise emission to surroundings The machine s emission is specified in chapter Technical data and on label e This product conforms to the applicable EU Directives e This product contains components tested according to FCC complete system not tested e tis not permitted to dispose of this product as normal household waste when it has reached the end of its useful life Ensure that the product is recycled in accordance with local legal requirements 6 English 1 INTRODUCTION AND SAFETY 1 3 Symbols in the Operator s Manual These symbols can be found in the Operator s Manual Study them carefully so you understand their Significance e Inspection and or maintenance must be carried out with the main switch set to OFF OFF e Always wear protective gloves when working with the mower s underframe aN e Never use a high pressure washer or even running water to clean Automower
5. 4 7 Switching off Automower iisi 42 4 8 Adjusting the cutting height 0 00 0 43 5 Control panel cassie ssisescsertctsictconancceresavatitnnecties dete tetalecnticcionteals 44 SM Mes eTe uuu u u u OPS Yann ETE Oe TT 45 5 2 11 cae eee nC ee re ee 46 5 Man SWIC uu u u UU UU ll u u u Or Pv 46 6 Menu FUNCTIONS UU ccccccccccccceseeseeseeeeevnesteeenens 47 6 1 Main menu I CPD 47 6 2 Automower main menu menu overview 48 Go Commands T u LLA E A a a ARENE NEE 49 Sn 9 uuu uu E T 49 p 5 I silallali n 19 uuu u irea 51 0 b Settings d uuu ansa E rE 57 7 Garden example aaa aaa aaa 61 8 Maintenance U a 65 oA BaN oerset 65 0 2 VV MOR era sorciu e a aiei riia 66 5 9 SEIVIGG uu uuu uqu E E A E 66 8 4 After winter storage oo ccc cecseseecseseteteeseseteteesteeeeneeen 67 Diy CANN uuu a E E EERE pasan 67 8 6 Replacing the blades u aaa 68 8 7 Transport and moving scccectccccessanceessasezsexessnerssearsivecsccasearistsbanils 68 9 Trouble shooting 1uu aa teen teeee ents 69 9 1 Fault messages a uicsiiceseseceersdecdenntotscseserensanceractendedevenssarnniotaesttnses 69 9 2 Fault STRUM Uu uuu u uuu uasasesselassamasssyaqqawayakyaaskukubsaphaq 72 10 Technical data U H aaa 73 11 Environmental information 2 0 0 0 74 12 EU declaration of conformity 75 English 3 4 English 1 INTRODUCTION AND SAFETY 1 Introd
6. Area 4 and Area 5 Three values need to be stated to activate an area Follow loop out Follow loop in Corridor width Test IN Test OUT 52 English 6 MENU FUNCTIONS e Direction Specify to the right left guide 1 or guide 2 depending on which direction the area lies from the charging station The direction Is set looking from the charging station in the approach direction of the mower When a guide wire Is installed the direction can be specified as the guide wire The mower will now follow the selected guide wire instead of the boundary wire Distance Specify the number of metres along the boundary wire or guide wire from the charging Station to the place in the remote area where the mower shall start mowing Tip Use the Test OUT 3 2 5 function see page 56 to find out how far it is to the remote area The distance stated in metres will appear on the mower display Proportion Specify a value for how often of the occasions Automower leaves the charging station it Should follow the loop out to the remote area For example the value 20 means that in 20 of the occasions Automower leaves the charging station it does it in the direction to the remote area In the remaining 80 of the occasions the mower leaves the charging Station according to the setting made for its function Exit angles 3 1 If a value of 20 is specified for Area 1 and 10 for Area 2 the remaining 70 is a
7. Automower to follow close to the boundary wire by setting a low Corridor width value The boundary wire runs along a steep slope steeper than 25 When Automower follows the boundary wire that runs along a steep slope the mower will change direction and run away from the boundary wire e Numerous or large islands If Automower is permitted to follow the boundary wire it may circle an island roughly twice before it leaves the island and once again searches for the boundary wire English 33 3 INSTALLATION e The route to a remote area is long or complicated When Automower shall follow the boundary wire to or from a remote area and the route along the boundary wire to the area is long or complicated e The boundary wire runs across a long slope steeper than 10 When Automower follows the boundary wire across a Slope steeper than 10 the mower must compensate for the slope The mower then follows the boundary wire ata slower speed The risk of the mower running outside of the working area due to skidding increases e The charging station is positioned on an island When there is more than 4 metres between the charging station and the outer edge of the boundary wire it can take a long time for Automower to find the charging station when it follows the boundary wire There is a risk of the mower following th
8. Charge the battery fully before winter storage Turn the main switch to the OFF position Itis also recommended to fully charge the battery several times during the winter in order to maximise its operating life The charging station must then be connected to a 230 V wall socket via the low voltage cable and transformer with or without connecting the boundary wire Now place the mower in the charging Station with the main switch set to ON and check that the control panel cover is open The charger should be charged for about 24 hours Remove the mower from the charging station and turn OFF main switch To keep the GPS anti theft device operational during the winter the Automower must be regularly charged Store the mower standing on all four wheels in a dry area free from frost preferably in the mower s original packaging Charging station If possible store the charging station transformer and low voltage cable indoors The boundary wire can be left in the ground If the charging station is taken in you should protect the ends of the boundary wire from moisture by placing them for example in a tin with grease If indoor storage Is not possible the boundary wire should remain connected The charging station Should remain connected to the mains supply 8 3 Service Leave your Automower to a dealer for service prior to winter storage This is essential in order to keep the mower in a good condition Service usually in
9. Set date Move the cursor to Set time and press YES Now Time and date enter the correcttime and finish with YES Time format e Set date 4 3 2 4 3 Move the cursor to Set date and press YES Now enter the correct date and finish with YES Time format 4 3 3 Move the cursor to Time format and press YES Move the cursor to the required time format e 12h e 24h Finish by pressing YES e Date format 4 3 4 Move the cursor to Date format and press YES Move the cursor to the required date format YY MM DD year month day MM DD YY month day year DD MM YY day month year Finish by pressing YES Date format Sounds A number of audio messages are used to indicate what Automower is currently doing Sound Significance 5 beeps over 2 seconds Starting blade disc One long beep Blade disc blocked S hort click sound A button on the keypad has been pressed Muffled long beep Incorrect input The mower is removed from the charging station manually while charging Is in progress Short double beep A change to the setting has been made The mower is placed in the charging station manually 60 English 7 GARDEN EXAMPLE 7 Garden example Proposed installation and settings The behaviour of the mower is controlled by the settings that are made Adapting the mower s garden settings according to the shape of the garden makes it easier for Husqvarna Automower to freq
10. If the PIN code mower is moved outside the preset protection area you will be alerted immediately via SMS New SMS are sent with updated location details as the Automower is moved Time lock For more information on how you use this feature and which preparations are required before you A can activate this function see 3 9 Activate the GPS anti theft protection area on page 37 and OFF 4 3 Using GPS communication on page 39 To e Activate GPS anti theft protection area Place the mower at the central point for the required protection area see 3 9 Activate the GPS anti theft protection area on page 37 Place the cursor at GPS and press YES Select ON to activate and press YES Await a confirmation SMS that the new central point has been activated Deactivate the GPS anti theft protection area Place the cursor at GPS and press YES Then select NO and press YES English 59 6 MENU FUNCTIONS Language 4 2 Using this function you can change the language i selection you made when Automower was first security Started To select the language Move the cursor to Language Language and press YES Now move the cursor to the required language and press YES Time and date 4 2 Time and date 4 3 Using this function you can change the time and date Security You can also change the format selections you made Set time when Automower was first started via this function Language e Set time 4 3 1
11. Slope steeper than 10 when there is an obstacle that Automower can be permitted to collide with for example a fence or a dense hedge Automower can mow areas inside the working area that slope up to 35 cm per distance metre 35 Areas that slope more must be demarcated by the boundary wire When any part of the working area s boundary slopes more than 10 cm per distance metre 10 the boundary wire must be routed about 40 cm in on flat ground before the Slope starts English 27 3 INSTALLATION Laying out the boundary wire Run the boundary wire around the working area but wait before connecting the wire to the charging Station IMPORTANT INFORMATION y N So A Extra wire must not be placed in coils outside the boundary wire This can disrupt Automower Tip Use the supplied measurement gauge as a guide when you lay out the boundary wire This helps you to easily set the correct distance between the boundary wire and the boundary obstacle If you intend to staple down the boundary wire Tip Mow the lawn where the wire is to be laid using a normal lawn mower or a trimmer It will then be easier to lay the wire close to the ground and the risk of the mower cutting the wire off is reduced e Make sure to lay the boundary wire tight to the ground and secure the staples close together with approximately 75 cm between each staple The wire must generally lie cl
12. create a secondary area when the working area is made up of two areas that are joined by a passage where the distance between the boundary wires Is less than 80 cm Run the boundary wire then around the secondary area so that it forms an island outside of the main area Automower must be moved manually between the main and secondary areas Use the MAN operating mode when Automower shall mow a secondary area Instead of creating an island with the existing boundary wire a secondary area generator can ideally be used A secondary area generator can be purchased as an accessory Contact your dealer for further information 0 ip sss Q 2 2 XZ EEE _ English 25 3 INSTALLATION Passages when mowing Long narrow passages and areas narrower than 1 5 2 metres should be avoided When Automower mows there is a risk that it runs around in the passage or area for a too long a period The lawn will then look flattened Passages when searching for the charging station The distance between the boundary wires ina passage must be at least 3 metres in order for Automower to follow the boundary wire through the passage without the need of changing the mower s default settings When the distance Is less than 3 metres there are two options available that permit Automower to run through the passage 1 Install a guide wire Atle When the distance between the b
13. example bushes Automower circles an island roughly twice which can take a long time and create tracks Search method 3 Follow guide wire Automower runs irregularly until it reaches the guide wire The mower then follows the guide wire in to the charging station The guide wire is an extra wire that is laid from the charging station out towards a remote part of the working area or through a narrow passage and Is then connected to the boundary wire Up to two guide wires can be installed for 265 ACX For more information see 3 8 Installation of the guide wire on page 33 This search method is best for an installation that has numerous or large islands narrow passages or steep Slopes The advantage of this search method is that the search times are generally short The disadvantage Is that the mower can leave tracks in the grass along the length of the guide wire GON VN lt D on _ English 15 2 PRESENTATION 2 4 More than one Automower in a garden If you install more than one Automower in the same area of lawn each mower must have its own PIN code A complete installation including charging station is required for each mower The boundary wires for the different installations can be routed next to each other Contact your dealer for further information 2 5 One Automower in several gardens One Automower can easily be used for more than one garden where each garden
14. frequently contact your dealer Fault message Left wheel motor blocked Cause Grass or other object has wrapped around the drive wheel Action Check the drive wheel and remove the grass or other object Right wheel motor blocked Grass or other object has wrapped around the drive wheel Check the drive wheel and remove the grass or other object Blade disc blocked Grass or other object has wrapped around the blade disc Check the blade disc and remove the grass or other object No loop signal The transformer is not connected to the mains supply or its miniature circuit breaker has tripped Check the wall socket connection and whether the miniature circuit breaker has tripped Reset the miniature circuit breaker by removing the transformer s power cord from the wall socket wait 10 seconds and then reconnect the power cord in the wall socket again The boundary wire is not connected to the charging station Check the signal given by the LED in the charging station If it flashes it may be that the boundary wire is not connected Check that the boundary wire s connectors are properly connected to the charging station Boundary wire broken Check the signal given by the LED in the charging station If it flashes the loop may be damaged Repair the break on the wire using the original coupler The connection between Automower and the charging station has been lo
15. has its own charging Station and boundary wire The mower can then have the same PIN code for all gardens Contact your dealer for further information 2 6 GPS communication unit Automower GPS communication unit contains two main functions 1 The SMS feature allows you to communicate with the Automower via SMS In this way one can alter settings as well as start and stop the mower remotely and as required The mower sends an SMS if it should stop working 2 GPS anti theft protection offers increased protection and control of the Automower If the mower is moved outside the preset protection area anSMS alert message is sent New SMS are sent with updated location details as the Automower is moved The movement can be followed using an online map service by entering the positioning data provided in the SMS 16 English 3 INSTALLATION 3 Installation This chapter describes how you install Husqvarna Automower Before starting the installation read the previous chapter 2 Presentation Read the whole of this chapter too before starting the installation How the installation is made also affects how well Automower will work It is therefore important to plan the installation carefully Planning is simplified if you make a sketch of the working area including all obstacles This makes it easier to see the ideal positions for the charging Station boundary wire and guide wire if used Draw on the sketch how t
16. in the same position until the GPS unit confirms the central point by sending an SMS containing the text Circular geofence On followed by the GPS coordinates for the central point Automower has now an activated circular protection area with a radius of 100 metres from the central point If the mower is moved outside the protection area an alarm is triggered and the GPS communication unit sends an SMS alert message to the designated phone numbers If required the radius can be increased see 4 3 Using GPS communication on page 39 You can deactivate the GPS anti theft protection at any time by going to the mower s Security menu entering your PIN code and deactivating the GPS 4 1 4 This may be of use when the mower for instance must be transported to your dealer for a winter service English 37 4 USE 4 Use 4 1 Charging a discharged battery When the Automower is new or for some other reason has not been charged for a long time the battery is flat and needs to be charged before starting Charging takes between 1 and 2 hours 1 Place Automower in the charging station Insert the mower as far as possible Good contact is made when both the charging strips on the mower touch the centre of the contact strips on the charging station 2 Open the control panel cover 3 Setthe main switch to the ON position Information about the charging process is shown on the display during
17. mower follows the boundary wire varies depending on how the working area appears You should perform some tests to find the highest possible Corridor width Use the Test IN 3 2 4 function to try different values Test IN 3 2 4 The Test IN 3 2 4 function is used to test how Automower finds its way into the charging Station Follow loop out CP Al nis lan TAN IN Follow loop in Boundary corridor Corridor width Guide 1 corridor Guide 2 corridor Follow loop out Follow loop in Narridar nith Corridor width Test IN English 55 6 MENU FUNCTIONS When the function is selected the mower will immediately follow the boundary wire guide 1 or guide 2 depending on which one it finds first in to the charging station If there is a passage and the mower can not run through it the Corridor width value is set too high When Test IN is activated the mower runs at the greatest distance from the wire that the selected corridor width permits The adjacent picture shows how Automower negotiates a passage when a value of 8 Is set for the Corridor width but not when a value of 10 Is set IMPORTANT INFORMATION When Test IN 3 2 4 is used the house icon on the display will come on and the mower will remain in the charging station Press the Home button to return to operations e Test OUT 3 2 5 The Test OUT 3 2 5 function is used to try different charge exit settin
18. number of user 2 Spon2 nnnannnnnnnn Optional not required nnnnnnnnn phone number incl country code Set phone number of user 3 Spon3 nnnnnnnannnn Optional not required nnnnnnnnn phone number incl country code Set phone number of user 4 Spon4 nnnnnnnnnnn Optional not required tnnnnnnnnn phone number incl country code Set phone number of user 5 Sond nnnnnnnannnn Optional not required nnnnnnnnn phone number incl country code Remove a phone number Dpnx x number for which users from 2 5 will be removed Read position and status of the Reg central point Read position of the mower Rpos E nglish 2 Italian 3 German 4 French 5 Spanish 6 Swedish 7 P ortuguese 8 Dutch 9 Danish 10 Norwegian 11 Finnish 12 Polish 13 Czech 14 Slovenian 4 4 Starting Automower 1 Press the STOP button to open the control panel cover 2 Setthe main switch to the ON position ON 3 Enterthe PIN code A The default setting for the theft prevention function Time lock 4 1 2 on Automower is Vv active The function requires the PIN code to be Stated each time the main switch is moved to the OFF ON position when this is not done correctly the mower will stop mowing after the set number of days and will not start again until the correct PIN code has been entered The function can be deactivated or changed as required For more information about Time lock 4 1 2 see page
19. start the mower for the first time see page 32 2 Move the main switch to the OFF position if you intend to carry the mower 3 Carry the mower by the handle at the rear under the mower Carry the mower with the blade disc away from the body Maintenance AN WARNING M When the mower is turned upside down the main switch must always be setto the OFF position OFF The main switch should be set to the OFF position during all work on the mower s underframe such as cleaning or replacing the blades InspectAutomower each week and replace any damaged or worn parts Check especially that the blades and blade disc are not damaged Replace all blades and screws at the same time if necessary so that the rotating parts are balanced see 8 Maintenance on page 65 English 9 2 PRESENTATION 2 Presentation This chapter contains information you should be aware of when planning the installation An installation of Husqvarna Automower includes four main components Automower an automatic lawn mower that mows the lawn by moving in essentially an irregular pattern The mower is powered by a maintenance free battery Charging station where your Automower returns when the charge level in the battery becomes too low The charging station has three functions To send control signals along the boundary wire To send out signals so Automower finds the charging station To charge Aut
20. the automatic operating mode Select the function and press YES when the cursor is on Yes e Show latest faults 1 2 to show the list of saved fault messages Browse with the arrow buttons The list can contain up to 20 fault messages and each message is shown with the date and time e Make factory settings 1 3 to restore all settings to their original values All except the selected language and PIN code are reset Select the function enter your PIN code and press YES when the cursor is on Yes 6 4 Timer 2 The lawn should not be cut too often to obtain the best mowing result Consequently it is important to limit the Operating time using the timer function if the working area is less than the mower s working capacity When Automower is allowed to mow too much the lawn may appear flattened Besides the mower is subjected to unnecessary wear The timer function is also an ideal means to control during which periods Automower should not mow for example when the children are playing in the garden When you set the timer assume that Automower 260 ACX mows about 250 m per hour e Timer override 2 1 to temporarily disconnect the timer function e Day timer 2 2 to set the start and stop times e Week timer 2 3 to select which days of the week Automower should mow Charge then AUTO Show latest faults Commands Make factory sett 1 Timer Installation Settings Timer override
21. the entire charging process WARNING i u Read the safety instructions before LLI you start your Automower WARNING Keep your hands and feet away from the rotating blades Never put your hands or feet close to or under the body when the motor is running 38 English 4 USE 4 2 Using the timer The lawn should not be cut too often to obtain the best mowing result Use the timer function see 6 4 Timer 2 on page 49 to avoid a downtrodden lawn and to get the maximum life from your Automower For example the quality of your lawn will improve if it is mown every other day instead of 12 hours each day In addition the grass benefits from resting completely during at least a three day period once a month 4 3 Using GPS communication A SIM card is required to use the device This is normally purchased by the end user and fitted then in Automower by the dealer together with the GPS communication unit The SIM card assembly and installation are normally not included in the price of the GPS unit or the mower When the SIM card is installed the administrator s phone number must be entered before the GPS communication unit can be used for the first time Enter the required administrator s phone number by sending an SMS to Automower with the command Spon followed by the phone number e g Son 46701234567 The GPS unit confirms the new administrator phone number by sending an SMS back with the message Set ph
22. time The following Is requested Language time format correct time date format date and four digit PIN code All combinations except 0000 are permitted When you have chosen a PIN code with Automower placed in the charging station the mower and charging station are then linked to each other 32 English 3 INSTALLATION 3 8 Installation of the guide wire The guide wire is an extra wire that is laid from the charging station out towards a remote part of the working area or through a narrow passage and is then connected to the boundary wire The same wire used for the boundary wire is also used for the guide wire Up to two guide wires can be installed for 265 ACX In Similarity to the boundary wire the guide wire can either be stapled down or buried When a guide wire is installed Automower can also be set to follow the guide wire out from the charging Station using the function Follow loop out 3 2 1 see page 52 Need of a guide wire The guide wire may be necessary in installations where the search methods Irregular and Follow boundary wire are not adequate for the mower to quickly and easily find the charging station A few examples of installations where a guide wire is recommended follow below Narrow passages In passages where the distance between the boundary wires is less than 3 metres it is recommended to install a guide wire through the passage This is a better solution than allowing
23. 2 into the lower left hand hole on the charging station and catch it in the upper hole Secure a connector on the guide wire Connect guide 2 to the contact pin on the charging station marked guide 2 4 Route the cable straight under the charging Station plate 5 Route the guide wire atleast 2 metres straight out from the front edge of the charging plate aximum distance English 35 3 INSTALLATION If you shall install the guide wire through a passage e Automower follows the guide wire on the same Side of the wire both to and from the charging Station This means that in towards the charging Station the guide wire is on the right side of the mower and away from the charging station the guide wire is on the left side of the mower In the passage the guide wire must be placed so that the mower has as much space to run as possible The distance between the boundary wire and the guide wire must however be at least 40 cm see the picture above The same minimum distance 40 cm also applies between the guide wire and the guide wire in the passage Avoid laying the wire at sharp angles This can make it difficult for the mower to follow the guide wire 6 Run the guide wire to the spot on the boundary wire where you want to make the connection 7 Lift out the boundary wire 8 Cutoff the boundary wire using a pair of wire cutters 9 Connect the guide wire to the boundary wire with the
24. 2 minutes Guide 2 2 minutes and boundary wire 11 minutes Corridor width Guide 1 10 Area 4000 m2 Two guide wires are recommended Timer Operating time of 24 hours per day Exit angles 90 270 Follow loop out Area 1 Direction Guide 1 Distance 30 m and Proportion 15 Area 2 Direction Guide 2 Distance 30 m and Proportion 30 Search method Irregular Follow guide wire in and Follow boundary wire in Delay Guide 1 2 minutes Guide 2 2 minutes and boundary wire 11 minutes Corridor width Guide 1 6 Guide 2 6 Area 4500 mz Two guide wires are recommended Timer Operating time of 24 hours per day Exit angles 90 270 Follow loop out Area 1 Direction Guide 1 Distance 40 m and Proportion 20 Area 2 Direction Guide 2 Distance 30 m and Proportion 40 Search method Irregular Follow guide wire in and Follow boundary wire in Delay Guide 1 2 minutes Guide 2 2 minutes and boundary wire 11 minutes Corridor width Guide 1 10 Guide 2 10 and boundary wire 10 64 English 8 MAINTENANCE 8 Maintenance Check and clean Husqvarna Automower regularly and replace worn parts if necessary to improve operating reliability and to ensure a longer service life For further information on cleaning see 8 5 Cleaning on page 67 During the initial period Automower is used the blade disc skid plate and blades should be checked once a week If th
25. 58 4 Close the cover The message Starting is shown on the display 5 beeps are heard over 2 seconds when the blade disc Starts English 41 4 USE 4 5 Stopping Automower 1 Press the STOP button Automower stops the blade motor stops and the control panel cover opens 4 6 Restart Restart within 20 seconds 1 Close the control panel cover Automower starts automatically Restart after more than 20 seconds If more than 20 seconds has elapsed since the last time the STOP button or the keypad was pressed It is not possible to start Automower by just closing the cover To start 1 Press the YES button 2 Close the control panel cover 4 7 Switching off Automower 1 Press the STOP button 2 Setthe main switch to the OFF position Always switch off Automower using the main switch if you intend to perform maintenance or move the mower outside of the working area OFF 42 English 4 USE 4 8 Adjusting the cutting height The cutting height can be varied from MIN 2 cm to MAX 6 cm If the grass is long itis appropriate to let Automower Start mowing at the MAX cutting height Once the grass is shorter you can gradually lower the cutting height To adjust the cutting height 1 Press the STOP button to stop the mower 2 Open the cutting height adjustment cover Press down the catch button and then open the cover 3 Turn the knob to
26. 6 MENU FUNCTIONS 6 5 Installation 3 From this option in the main menu you access the driving settings Exit angles 3 1 to set how far Automower should reverse out of the charging station before it turns and in what direction the mower should leave the charging Station Follow loop 3 2 to guide the mower to easily reach a remote area of the garden to make it easier to find the charging station and to determine at what distance the mower shall follow the loop Installation shape 3 3 to tell Automower which type of garden you have Advanced 3 4 to check that the loop is intact or exactly where in the lawn the wire is buried and to adjust the distance over the boundary wire that Automower Shall run For examples of garden settings see 7 Garden example on page 61 Exit angles 3 1 Normally Automower leaves the charging station in a direction within the exit sector 90 270 where 90 is called the Start angle and 270 is called the End angle By setting the start and end angles you can set the direction in which Automower is to leave the charging station Reversing distance 3 1 1 Specify the number of centimetres you want Automower to reverse before it turns to drive out of the charging station The default reversing distance is 60 cm Start angle 1 3 1 2 Specify in degrees where you want the sector sector 1 to start End angle 1 3 1 3 Specify in degrees where yo
27. HUSQVARNA AUTOMOWER 265 ACX OPERATOR S MANUAL TABLE OF CONTENTS 1 Introduction and safety 20 00 00 5 Tes AP UMP OCUNC NOUN uuu lll dee EEEE EEI een 5 1 2 Symbols on Automower9 n 6 1 3 Symbols in the Operator s Manual a aT 7 1 4 Safety instructions a 8 2 Presentation H Iaa 10 2 1 Automower what s What aaen 11 2 2 Function of Automower UUU aaa 12 2 9 Search Method sxsececsisecairettececencenceriislessecousisisesssisestniivcddaccersinseieet 15 2 4 More than one Automower in a garden ooo 16 2 5 One Automower in several gardens a 16 2 6 GPS COMMUNICATION unit UU aaa aa 16 3 Installation aaa 17 3 1 Preparations cote tecc a renectayeecectapsiruarscierdrenecseneesteeeceracqumicwnnee 17 3 2 Installation of the charging station aaa 18 3 3 Charging the batery U UU LLL usa aa 22 3 4 Installation of the boundary wire sses 23 3 5 Connecting the boundary Wire oo cece cette 30 3 6 Checking the installation 00 0 32 3 7 Linking Automower to the charging station 0 0 00 32 3 8 Installation of the guide wire ooo eee 33 3 9 Activate the GPS anti theft protection area oo 37 T USGS uu uuu aE EE EE 38 4 1 Charging a discharged battery U a 38 4 2 Using the timer aiiis 39 4 3 Using GPS COMMUNICATION oon 39 4 4 Starting Automower o oo arsu 41 4 5 Stopping Automower sessies 42 AO E SU iL u TE EEA NEE 42
28. Installation Language e Language 4 2 Settings Time and date to select the menu language e Time and date 4 3 to set the current time and day as well as the required time and date format English 57 6 MENU FUNCTIONS Security 4 1 PIN code 4 1 1 Via this function you can change your PIN code at any time To change the PIN code Move the cursor to PIN code and press YES Place Automower in the charging station Enter the new PIN code and press YES Enter the same code again to confirm and press YES When the PIN code has been changed the message PIN code changed is displayed for a few seconds The Security menu will then appear again Time lock 4 1 2 This function partly involves Automower Stopping to mow after a predetermined number of days and not continuing until the correct PIN code has been entered and partly that the PIN code must be entered when the main switch is set to the ON position The default setting on PIN code Security Language Time lock Time and date Alarm 4 1 PIN code Number of days Time lock OFF Automower is 30 days but can be changed as required IMPORTANT INFORMATION Time lock is the most important theft prevention function Accordingly it is recommended to have this activated To e Activate Move the cursor to Time lock and press YES Now move the cursor to Number of days and press YES Specify how many days you would like A
29. Rwt hh hours mm minutes see 4 2 Using the timer on page 39 for more information on timer functions Enter on off for all the days of the week Monday to Sunday e g Swt On Off On Off On Off Off results in Automower mowing Monday Wednesday and Friday It will not mow on the other days GPS anti theft protection See 3 9 Activate the GPS anti theft protection area on page 37 for information on how to begin using the GPS anti theft protection The following SMS can be used to change settings and read status on the GPS unit Note that there is always a space between the command code and command value For example there is a space between SPN1 and the administrator s phone number Remarks Enter the name of the mower Commands Sid XXXXXXXX Remarks Max of 13 characters Used to differentiate if you have more than one Automower Blanks are not permitted Set the time Stm YY MM DD hh mm YY year MM month DD day hh hours mm minutes area Set language SI x x language selection for incoming SMS Set the size of the protection Scgr nnn nnn radius from central point in metres factory setting is 100 Valid values are 50 100 200 300 500 700 1000 1500 2000 3000 4000 40 English 4 USE Remarks Commands Remarks Enter the administrator s phone Spon nnnnnnannnnn Required for operation nnnnnnnnn number phone number incl country code Set phone
30. are mode cutting The mower must have been operational for more than 6 hours in order for Automower to start square mode cutting 14 English 2 PRESENTATION 2 3 Search method Automower can be set to search for the charging Station in three different ways Using the setting options the three search methods can be combined to optimise the search for the charging station The required search method or methods depends on the Shape of the garden Search method 1 Irregular Automower runs irregularly until it finds the charging Station This search method is best for an installation that has an open lawn and no narrow passages narrower than about 3 metres The advantage of this search method Is that there Is no risk of leaving tracks in the grass after the mower The disadvantage is that the search times can be Somewhat longer Search method 2 Follow boundary wire Automower runs irregularly until it reaches the boundary wire The mower then follows the boundary wire in to the charging station This search method is best for an installation that has an open lawn with wide passages wider than about 3 metres and no or only a small island The advantage of this search method is that the search times are generally short The disadvantage Is that tracks can be formed to a certain extent in the grass behind the mower Problems can also arise if there are narrow passages or a large number of islands for
31. arging Station to switch off e The battery status shows the remaining battery charge The keypad consists of five groups of buttons Short cuts program selection numbers and the main Switch 44 English 5 CONTROL PANEL 5 1 Shortcuts 1 Home e Sends the mower to the charging station Where it stays until the button is pressed a lt 1 again The house icon is lit on the right hand side of the display when the button is pressed When the battery is fully charged the mower will MAN remain in the charging station and show the 4 2 message Waiting AUTO When the Test IN 3 2 4 function see page 55 is selected Automower will once it reaches the charging station remain there until the Home button is pressed again e Move the cursor in the menu structure back to the main page 2 Operating mode The selected operating mode is shown on the right hand side of the display as AUTO respective MAN Press the button to choose between AUTO the normal automatic operating mode where Automower mows and charges continuously e MAN When cutting secondary areas the MAN setting must be used If MAN is selected and the mower starts when it is out on the lawn it will mow until the battery runs out It will then stop and the Needs manual charging message will appear The mower must then be moved manually to the charging station and then started manually after charging If the mower charges i
32. cludes the following e Thorough cleaning of body chassis blade disc Skid plate and all other moving parts e Testing of the mower s function and components e Checking of wear components such as mower blades and bearings e Testing of the mower s battery capacity as well as a recommendation of change if necessary e Relubrication of both chassis halves of the mower in order to maintain moisture and wetness resistance If necessary the dealer can also load Automower with new software possibly including newly added features 66 English 8 MAINTENANCE 8 4 After winter storage During a service the dealer can clean the mower thoroughly test its function and components as well as replace wear parts If necessary If the charging or contact strips appear to be burnt clean them using fine grade emery cloth Check that the mower s time and date are correct 8 5 Cleaning Itis important to keep Automower clean Large grass accumulations reduce the performance of the cutter and greatly impair its ability to manage slopes Itis recommended to clean using a brush and a Spray with water IMPORTANT INFORMATION Never use a high pressure washer or even running water to clean the Automower Solvent must never be used when cleaning Underframe and blade disc 1 Setthe main switch to the OFF position Y 2 Wear protective gloves OFF 3 Lift Automower onto its side 4 Clean the blade disc an
33. d centrally in the working area so that Automower can easily find the charging Station and quickly reach all parts of the working area Itis a good idea to place the charging station in the Shadow The battery is spared if itis charged in the lowest possible ambient temperature The charging station must be positioned on relatively level ground The height difference must not differ more than 5 cm between the front and rear of the charging station Max 5cm T T The charging station must not be positioned so that its plate bends Consider the distance to a wall socket when choosing the position The charging station should be connected to a 230V wall socket via the low voltage cable and transformer The supplied low voltage cable is 20 metres long Tip It is possible to let the low voltage cable cross the working area It must then be either stapled down or buried In some cases there is a better positioning option for the charging station than close to a house wall or by the closest wall socket IMPORTANT INFORMATION The low voltage cable must not under any circumstances be shortened or extended The transformer must be placed where it is well ventilated and is not exposed to direct sunlight It is also beneficial if the transformer can be placed under a roof IMPORTANT INFORMATION The mains cable on the transformer must not be replaced In those cases the mains cable has been damaged th
34. d underframe using e g a dish brush At the same time check that the blade disc rotates freely in relation to the motor support directly above Check also that the skid plate rotates freely in relation to the blade disc If long blades of grass or other objects work their way in this can brake the blade disc and or skid plate Even a slight braking effect leads to a higher consumption of energy and longer mowing times and at the worst will prevent the mower from being able to mow a large lawn If more thorough cleaning Is necessary the skid plate and possibly the blade disc must be dismantled If necessary contact your dealer Chassis Clean the underside of the chassis Brush or wipe with a damp cloth Wheels Clean around the front and rear wheels and around the front wheel suspension English 67 8 MAINTENANCE Body Use a damp soft sponge or cloth to clean the body If the body is very dirty it may be necessary to use a soap solution or washing up liquid Take special care to keep the two ultrasonic sensors clean from dust and dirt at all times When the sensors are covered in dirt i e the sensors are not functioning the mower will run at a much lower speed than normal in order to avoid hard collisions The low speed could mean that the mower does not have time to finish mowing the designated area 8 6 Replacing the blades AN WARNING Always use originalblades and screws when replacing On
35. e Staples Connector for the loop wire Screws for securing the charging station Measurement gauge for help when installing the boundary wire Solderless coupler for the loop wire Operator s Manual English 11 2 PRESENTATION 2 2 Function of Automower Capacity Automower is recommended for lawns up to 6000 m 20 How large an area is mown depends primarily on the condition of the blades and the type of grass growth rate and humidity The shape of the garden is also Significant If the garden mainly consists of open lawns Automower can mow more per hour than if the garden consists of several small lawns separated by trees flower beds and passages How long Automower mows and recharges can vary depending on among others the ambient temperature Up to around 25 C a fully charged Automower will mow for approx 80 minutes depending on the age of the battery and how thick the grass is Then the mower will charge for approx 40 minutes Above 25 C both the mowing and charging times gradually drop Mowing technique The mowing system used by Automower is based on an effective and energy efficient principle Unlike normal lawn mowers Automower cuts the grass instead of striking it off We recommend you allow Automower to mainly mow in dry weather to obtain the best possible result Automower can even mow in the rain however wet grass easily collects on the mower and the risk of Slipping
36. e 1 Distance 25 metres and Proportion 30 Search method Irregular and Follow guide wire in Delay Guide 1 2 minutes Guide 2 2 minutes and boundary wire 99 minutes Automower is never permitted to follow the boundary wire Corridor width Guide 1 6 Area 6000 m2 Rectangular garden with the charging station placed by an island A large part of the boundary wire is routed ona slope that is steeper than 10 Guide wire recommended Timer Operating time of 24 hours per day Exit angles 90 270 Search method Irregular and Follow guide wire in Delay Guide 1 2 minutes Guide 2 2 minutes and boundary wire 99 minutes Automower Is never permitted to follow the boundary wire Corridor width 19 Area 3000 m There is a number of islands No guide wire is required Timer Operating time of 15 hours per day Exit angles 90 270 Search method Irregular Delay Guide 1 2 minutes Guide 2 2 minutes and boundary wire 11 minutes Corridor width Boundary wire 10 English 63 7 GARDEN EXAMPLE Proposals for installation and settings Area 1 000 m2 There is one small island Guide wire recommended through the passage Timer Operating time of 5 hours per day Exit angles 70 190 Follow loop out Direction Guide 1 Distance 20 m and Proportion 25 Search method Irregular Follow guide wire in and Follow boundary wire in Delay Guide 1
37. e amount of wear during this period has been low the inspection interval can be increased It is important that the blade disc rotates easily In addition the skid plate should rotate easily in relation to the blade disc The edges of the blades should not be damaged The service life of the blades depends on e Operating time and size of the working area e Type of grass Type of soil e The presence of objects such as cones windfalls toys tools stones roots and the like The service life can vary greatly but is normally 2 4 weeks of operation over areas larger than 1 000 m2 and longer in smaller areas To replace the blades see 8 6 Replacing the blades on page 68 IMPORTANT INFORMATION Working with dull blades gives a poorer mowing result The edges of the grass are not cut clean and more energy is needed resulting in Automower not mowing such a large area 8 1 Battery The battery is maintenance free but has a limited life Span of 1 4 years Battery life is dependent on the length of the season and how many hours per day Automower is used A long season or many hours of use per day means that the battery must be replaced more regularly IMPORTANT INFORMATION Charge the battery fully at the end of the season before winter storage English 65 8 MAINTENANCE 8 2 Winter storage Automower Automower must be carefully cleaned before winter Storage see 8 5 Cleaning on page 67
38. e outer edge of the working area 2 3 turns before it changes direction and Starts to follow the loop at another spot Placement and connection of the guide wire In the text below the guide wires are called guide 1 and guide 2 as is the case on the rear of the charging Station 1 Check that the charging station has the best placement The guide wire together with the part of the boundary wire that makes up the return to the charging station is known as the guide loop The current in the guide loop always goes to the left in the connection between the guide wire and the boundary wire The adjoining picture shows what is considered a guide loop The picture is also a good example of an ideal position for the charging station to give the Shortest possible guide loop 34 English 3 INSTALLATION The longer the guide wire the closer the mower follows the guide wire If the guide wire is longer then 300 metres the mower may find it difficult to follow the wire This varies depending on the design of the garden and installation 2 Lift up the cover on the charging station 3 If you intend to install guide 1 e Insert the end of guide 1 into the lower right hand hole on the charging station and catch it in the upper hole Secure a connector on the guide wire Connect guide 1 to the contact pin on the charging station marked guide 1 If you intend to install guide 2 e Insert the end of guide
39. e transformer must be discarded and replaced by a new one It is recommended to use an earth fault breaker when connecting the transformer to the wall socket English 19 3 INSTALLATION The transformer shall be mounted on a vertical Surface for example a house wall Mount the transformer with screws in the two attachment points Securing screws are not included Choose screws Suitable for the wall material Mount the transformer at a height such that there is no risk the transformer can become submerged in water minimum 30 cm from the ground The transformer must never be placed on the ground Do not put the charging station in a corner or pocket in the working area Avoid placing the charging station in a narrow passage narrower than about 3 metres Do not position the charging station so that the mower can come closer than 3 metres behind the charging Station for example on a narrow point The mower will not then find the charging station 20 English 3 INSTALLATION Installation and connecting the charging station 1 Position the charging station in a suitable spot 2 Attach the charging station to the ground using the supplied screws 3 Ensure the screws are secured all the way down in the countersink IMPORTANT INFORMATION It is not permitted to make new holes in the plate Only the existing holes may be used to secure the plate to the ground 4 Con
40. ea too large Try limiting the working area or extending the working time see 6 4 Timer 2 on page 49 Dull blades Replace all the blades and screws so that the rotating parts are balanced Long grass in relation to the set cutting height Increase the cutting height and then successively lower The mower seems to work more atthe top of a slope than at the bottom Change the Garden shape 3 3 setting to Open Accumulation of grass by the blade disc or around the motor shaft Check that the skid plate and blade disc rotate easily If not the skid plate and perhaps the blade disc must be removed and the grass and foreign objects removed See 8 5 Cleaning on page 6 7 Automower runs at the wrong time The clock on Automower needs to be set Set the clock see Time and date 4 3 on page 60 The start and stop times for mowing are incorrect Adjust the start and stop time settings for mowing see 6 4 Timer 2 on page 49 Automower vibrates Damaged knives lead to imbalance in the cutting system Inspect the blades and screws and replace them if necessary Many knives in the same position lead to imbalance in the cutting system Check that only one knife is fitted at each screw Automower runs but the blade disc does not rotate Automower is looking for the charging Station No action The blade disc does not rotate when the mower is searching f
41. glish 75 ORIGINAL INSTRUCTIONS AUTOMOWER is a trademark owned by Husqvarna AB Copyright 2012 HUSQVARNA All rights reserved 115 42 52 26
42. gs and to find out how far it is from the charging station to a remote area Follow loop in Follow loop out To test the settings for Follow loop out 3 2 1 Corridor width Set Proportion to 100 for the most remote oe area to be tested and 0 for the other areas Place Automower in the charging station and select Test OUT 3 2 5 The mower will now leave the charging station directly according to the stated direction and start mowing after the Stated distance Reset the Proportion values when testing Is finished To find out the distance from the charging station to a remote area e State a distance that easily exceeds the true distance The maximum distance that can be Stated is 500 metres Set Proportion to 100 for the areas where the distance Is to be measured and 0 for the other areas Place Automower in the charging station and select Test OUT 3 2 5 The mower will now leave the charging Station directly according to the stated direction The distance will be shown on the display Stated in metres as the mower runs Stop the mower after the required distance and read the distance Enter the number of metres shown in Distance for the area in question Reset the Proportion values when testing is finished 56 English 6 MENU FUNCTIONS Installation shape 3 3 Automower can be set according to three garden shapes Open Normal and Complex Exit angles Open This setting affects how Automo
43. he boundary wire and the guide wire if used should be routed Carry out the installation in the following steps 3 1 Preparations 3 2 Installation of the charging station 3 3 Charging the battery 3 4 Installation of the boundary wire 3 5 Connecting the boundary wire 3 6 Checking the installation 3 7 Linking Automower to the charging station 3 8 Installation of the guide wire To carry out a complete start up of Automower the charging station must be in position and connected the boundary wire connected and the mower connected to the charging station If you would like to Start the mower without having completed the full boundary installation you can connect a temporary Short loop around the mower 3 1 Preparations 1 Ifthe lawn in the proposed working area is taller than 10 cm mow it using a normal lawn mower Then collect the clippings 2 Read carefully through all the steps before the installation 3 Check that all parts for the installation are included The numbers in brackets refer to the detail diagram 2 1 Automower what s what on page 11 Operator s Manual 27 e Automower e Charging station 16 e Transformer 20 Low voltage cable 21 English 17 3 INSTALLATION Screws for the charging station 24 e Measurement gauge 25 Connector for the loop wire 23 e Solderless coupler for the loop wire 26 Contact your dealer to purchase the following ins
44. heels from driving into the ditch or up onto the verge If the working area borders against a flat path or the like that lies level with the lawn it is possible to allow Automower to run a little over the path The boundary wire should then be laid 10 cm from the edge of the path When the working area is divided by a flat slab path that is level with the lawn itis possible to allow Automower to run over the path It can be an advantage to lay the boundary wire under the slabs The boundary wire can also be laid in the joint between the slabs Note Automower must never run over a gravel path or similar material which can damage the blades IMPORTANT INFORMATION If the working area is adjacent to water bodies slopes or precipices the boundary wire should be supplemented with a fence or the like The height must then be at least 15 cm This will prevent Automower from ending up outside the working area under any circumstances 24 English 3 INSTALLATION When Automower searches for the charging station or follows the loop according to the function Follow loop 3 2 See page 52 it runs along the side of the boundary wire ata specific distance The Corridor width 3 2 3 function determines the distance from the boundary wire that the mower shall run It is recommended to state as high a Corridor width value as possible A high Corridor width value reduces the risk of tracks forming Fo
45. help of a solderless coupler Insert the ends of the boundary wire in the right respective left hand holes on the connector Insert the end of the guide wire in the centre hole Press down the button on the connector fully 10 Staple down bury the connector in the lawn IMPORTANT INFORMATION The function of the guide wire varies depending on how the working area appears Itis therefore recommended to test the installation with the help of the function Test IN 3 2 4 see page 56 36 English 3 INSTALLATION 3 9 Activate the GPS anti theft protection area Before the anti theft protection area can be activated a SIM card must be installed and the administrator s phone number must be entered into the GPS communication unit see 4 3 Using GPS communication on page 39 1 Place Automowers atthe centre of the required protection area often in the middle of the lawn Automower is going to mow Avoid placing Automower under trees roofs or close to a house as this weakens the GPS signal Set the main switch to the ON position Go to the mower s Security 4 1 menu enter your PIN code and press YES Place the cursor on GPS 4 1 4 and press YES Select ON to activate and press YES Make sure that Alarm 4 1 3 and Time lock 4 1 2 are activated for total functionality The GPS unit now automatically indexes the position as the central point This can take up to 15 minutes Leave the mower
46. here Is information to the right of specific rows This information indicates which selection has been made for the function Main menu Commands Timer Installation Settings Daytimer gt Reset all timers Start Time 1 Stop Time 1 Start Time 2 Stop Time 2 PIN code Time lock Alarm GPS English 47 6 MENU FUNCTIONS In menu menu overview 6 2 Automower ma ajep Jas YIM ul doo no doo JEUUOJ OUI uul JAS SdD Ue Nid ajbue j jbue SIP pug ues buISI n y zeping pno eT 14H uol iodoigd uE SI uoll5 JIG G Pay Baly Pay pealy Z e ly JOPIJIO9 JOPUIOD Jopluioo2 Zgeapinp pmn5 Alepunog Aejap Aejap Aejap Z eping aping Arepunog siku LINO WEL NI1S 10pPHI09 MO O4 MOJOJ JIAA doo jsed aAug y2 49 lle ung 42S ny L on ung uy pam uow Zou Swi uels uels Z oul SIOUII dojs yjejesoy YO Ou 900 BWJON xa duoy u do Woes OLNV deys doo saj6ue JOU JOU OPLUBAO Ajojoe sln Udy AWINIAS p S5uPpApy uonejelsSu MO O XA yoo Fa 1 pi YE W s jej moys abuey uonejjelsul JOU spuewwop nNu W ueu PMowo Ny 48 English 6 MENU FUNCTIONS 6 3 Commands 1 This option in the main menu allows you to access the following functions on Automower e Charge then AUTO 1 1 in order for Automower to drive immediately to the charging station charge the battery and then return to
47. hods can be combined so one part of the boundary wire is stapled down and the remainder is buried Best position for the boundary wire The boundary wire should be laid so it Forms a loop around the working area for Automower Only an original boundary wire must be used This is tinned and has a high quality insulation to withstand the dampness in the ground e Maintains a maximum distance of 35 metres from Automower in the entire working area e Ideally not longer than 500 metres For installations where a longer boundary wire of up to 800 metres is required we recommend a Signal amplifier 522 42 58 01 which is available as an accessory e The boundary wire is laid at different distances from obstacles depending on what the working area borders The picture below shows how the boundary wire should be routed around the working area and around obstacles English 23 3 INSTALLATION Boundaries for the working area Ifa high obstacle for example a wall or fence borders the working area the boundary wire should be laid 40 cm from the obstacle This will prevent Automower from colliding with the obstacle and reduce body wear If the working area borders against a small ditch for example a flower bed or a small elevation e g a low verge 3 5 cm the boundary wire should be laid 35 cm inside the working area This prevents the w
48. how the mower will leave the charging station see 6 5 Installation 3 on page 51 Automower is equipped with ultrasonic sensors that effectively sensor both fixed and moving obstacles that the mower is subjected to When faced with an obstacle the mower slows down to avoid unnecessarily hard collisions When Automower body hits an obstacle the mower reverses and selects a new direction Two additional sensors one on the front and one on the back of the Automower will sense when the mower is approaching the boundary wire Automower overruns the wire by up to 27 centimetres before it turns The overrun length can be set see Drive past wire 3 4 2 on page 57 The STOP button on the top of Automower is mainly used to stop the mower when it s running When the STOP button is pressed a cover opens behind which there Is a control panel The STOP button remains depressed until the cover is closed again This acts as Start inhibitor English 13 2 PRESENTATION The control panel on the top of Automower is where you manage all the mower settings The main switch is also located on the control panel Open the control panel cover by pressing down the STOP button When the main switch is turned ON for the first time a Start up sequence begins which includes selection of the language time format date format and four digit PIN code plus setting of the time and date see page 32 The selected PIN code mu
49. ion the contact strips in the charging correctly in the charging station Station Charging station The contact between the charging Place Automower in the charging blocked strips and contact strips may be poor station and check that the charging strips and contact strips make good contact An object is obstructing Automower Remove the object 70 English 9 TROUBLE SHOOTING Fault message Cause Action Stuck in charging An object is preventing Automower Remove the object station from reversing out of the charging Station Upside down Automower leans too much or has Turn the mower the right way up turned over Needs manual charging Automower is set in MAN operating mode This behaviour is normal no action required Check ultrasonic Debris dust or similar has clogged the ultrasonic sensor Clean the two ultrasonic sensors on the mower s body Automower has collided at too great a speed a number of times Place boundary wire around obstacles not discovered by the ultrasonic English 71 9 TROUBLE SHOOTING 9 2 Fault symptom If your Automower does not work correctly follow the trouble shooting guide below If the fault persists contact your dealer Symptom Uneven mowing results Cause Automower works too few hours per day Action Increase the mowing time see 6 4 Timer 2 on page 49 Working ar
50. left ata Suitable recycling centre to recycle its electronic components and batteries Contact your dealer for a disassembly of the batteries By ensuring this product is disposed of correctly you will help prevent potential negative consequences for the environment and human health which could otherwise be caused by inappropriate waste handling of this product For more detailed information about recycling of this product please contact your local council office your household waste disposal service or the shop where you purchased the product 74 English 12 EU DECLARATION OF CONFORMITY 12 EU declaration of conformity EU Declaration of Conformity only applies to Europe Husqvarna AB SE 561 82 Huskvarna Sweden hereby declares that robotic lawnmower Husqvarna Automower 265 ACX from 2012 s serial numbers and onwards the year is clearly stated in plain text on the rating plate with subsequent serial number complies with the requirements of the COUNCIL S DIRECTIVE e Directive relating to machinery 2006 42 EC e Directive relating to electromagnetic compatibility 2004 108 EC and applicable supplements The following standards have been applied EN 61000 6 3 and EN 61000 6 1 Huskvarna October 1 2011 lt Christer Gustavsson Development Manager robotic lawnmowers Authorized representative for Husqvarna AB and responsible for technical documentation Serial number Personal code Dealer En
51. llocated to the selection under Exit angles 3 1 Follow loop in 3 2 2 This function is used to control how Automower searches for the charging station Automower always starts the search for the charging station in an irregular search method In some gardens this is not sufficient for the mower to quickly find the charging station The search can then be optimised using the Follow loop in function When the mower still can not find the charging Station after a specific period of irregular searching it also starts to search for the guide wires and after a further period also the boundary wire to follow one of them into the charging station instead This time is stated in minutes and delays searching for guide 1 guide 2 and the boundary wire The delay time can be adapted to the shape of the garden in the Follow loop in function Direction Distance Proportion Exit angles Follow loop Installation shape Advanced Direction Distance Proportion Right Left Guide 1 Guide 2 Follow loop out Follow loop in Corridor width Test IN Test OUT 3 2 2 English 53 6 MENU FUNCTIONS Automower has a default delay setting of 2 minutes for guide 1 and guide 2 and 11 minutes Follow loop out for the boundary wire A delay of 99 minutes Boundary delay means that the function is deactivated Follow loop in If both search methods are to be activated it is Guide 1 delay p
52. ly replacing the blades and reusing the screw can result in the screw wearing during mowing and shearing off The blades can then be thrown out and cause serious injury On Automower five blades are screwed onto the blade disc All five blades and screws must be replaced atthe same time to ensure the cutting system is balanced There are several different types of mower blades to choose from as accessories with different features Use Husqvarna AB approved blades only Please contact your dealer for more information To replace the blades 1 Setthe main switch to the OFF position Wear protective gloves O T Ti 2 3 Turn Automower upside down 4 Rotate the skid plate so that its hole aligns with the screw for the blade 5 Unscrew the blade Use a Straight slot or cross tip screwdriver 6 Pry apartthe skid plate and blade disc a little and remove the blade and screw 7 Screw tight the new blade 8 7 Transport and moving Secure the machine during transport It is important that the Automower does not move around while being transported e g between different grass areas There is an Automower bag 522 91 66 01 designed especially to facilitate transport Please contact your dealer for more information 68 English 9 TROUBLE SHOOTING 9 Trouble shooting 9 1 Fault messages A number of fault messages are listed below that can be shown on Husqvarna Automower If the same fault occurs
53. make sure you keep your hands and feet away from the rotating blades Never put your hands and feet under the mower Never lift up Automower or carry it around when the main switch is in the ON position e Do notlet persons who do not know how Automower works and behaves use the mower Never use Automower if persons especially children or pets are in the immediate vicinity Do not put anything on top of Automower or its charging station e Do notallow Automower to be used with a defective blade disc or body Neither should it be used with defective blades screws nuts or cables e Do notuse Automower if the main switch does not work e Always switch off Automower using the main Switch when you do not intend to use the mower Automower can only start when the main switch is moved to the ON position and the correct PIN code has been entered e Automower must never be used at the same time as a sprinkler In this case use the timer function see 6 4 Timer 2 on page 49 so the mower and Sprinkler never run simultaneously 8 English 1 INTRODUCTION AND SAFETY Transport The original packaging should be used when transporting Automower over long distances To safely move from or within the working area 1 Press the STOP button to stop the mower If the anti theft alarm See page 59 Is activated enter the first digit of the PIN code Y ou select the four digit PIN code when you
54. n the MAN mode it will fully charge move about 20 cm out of the charging station and then stop This indicates that itis charged and ready to start mowing If the main working area has to be cut after charging itis appropriate to switch the operation mode to Auto before placing the mower in the charging station Select English 45 5 CONTROL PANEL 3 Cancel Press to go back one step in the menu structure or to interrupt an ongoing input 4 YES Press to confirm an entry or selection Press to start the mower if more than 20 seconds has elapsed since you last pressed a button and you want to close the control panel cover 5 Arrow up and arrow down Press any of the arrow buttons to move the cursor between menus or different selections 5 2 Numbers 6 Used in the menu structure to enter settings for example PIN code time or exit direction Also used to specify a number series as a shortcut to the different menus See more about number series in Number series on page 47 5 3 Main switch 7 Setthe main switch in the ON position to start Automower Set the main switch in the OFF position when you are not using the mower or if you want to work on the blade disc When the main switch Is set in the OFF position the motors on the mower cannot start When the main switch is turned ON for the first time a start up sequence begins which includes selection of the language time format date fo
55. nect the low voltage cable to the charging Station Only use original cable and transformer 5 Connect the low voltage cable to the transformer The connectors may be slightly difficult to connect as they are moisture proof 6 Connect the transformer s power cord to a 230V wall socket It is preferable to use an earth fault breaker as recommended IMPORTANT INFORMATION Do not tread or walk on the charging station plate English 21 3 INSTALLATION 3 3 Charging the battery Automower is supplied with an uncharged battery As soon as the charging station is connected itis possible to charge the mower 1 Setthe main switch to the ON position 2 Place Automower in the charging station to charge the battery while you are laying the boundary wire From an uncharged state the battery takes about 1 to 2 hours until it is fully charged IMPORTANT INFORMATION Automower cannot be used before the installation is complete 22 English 3 INSTALLATION 3 4 Installation of the boundary wire The boundary wire can be installed in one of the following ways e Securing the wire to the ground with staples It is preferable to staple down the boundary cable if you want to make adjustments to the boundary wire during the first few weeks of operation Bury the wire It is preferable to bury the boundary wire if you want to dethatch or aerate the lawn If necessary both met
56. nector grip 4 Press the connector together using a pair of pliers Press until you hear a click 5 Cutoff any surplus boundary wire Cut 1 2 cm above respective connectors 6 Press the connector onto the contact pin marked A on the charging station IMPORTANT INFORMATION The right hand connector should be connected on the right hand contact pin on the charging station and vice versa English 31 3 INSTALLATION 7 Refit the cover on the charging station Ensure the three guides on the charging station enter the right holes in the cover 3 6 Checking the installation Check the loop signal by looking to see what indication the green LED on the charging station is giving e Steady light the signal is okay Flashing once every other second break in the loop and no signal found Flashing twice every other second weak signal This may be due to the boundary wire exceeding 500 metres or that the cable is damaged If the mower works itis nota problem In case of operational disturbance we recommend a Signal amplifier 522 42 58 01 which is available as an accessory This allows a boundary wire of up to 800 metres 3 7 Linking Automower to the charging station 1 Open the control panel cover by pressing the STOP button 2 Place Automower in the charging station 3 Setthe main switch to the ON position A start up sequence begins when Automower is Started for the first
57. omower battery Transformer which is connected between the charging station and a 230V wall socket The transformer is connected to the wall socket via an integrated power cord and to the charging station via a 20 m long low voltage cable The low voltage cable must not be extended The low voltage cable must not be shortened nor extended Wire laid in a loop around Automower s working area The boundary wire is laid around the edges of the lawn and around objects and plants that the mower must not run into The wire is also used for any guide wires Contact your dealer to purchase a cable with the right length 10 English 2 PRESENTATION 2 1 Automower what s what lt ee Le liemi i The numbers in the picture correspond to 1 Charging strip 2 Cutting height adjustment cover 3 Catch button to open the cutting height adjustment cover 4 Ultrasonic sensors 5 Drive wheel 6 Body 7 Stop button 8 Keypad 9 Display 10 Main switch 11 Front wheel 12 Handle 13 Chassis box with electronics battery and motors 14 Skid plate 15 16 Contact strips 18 19 20 21 22 23 24 25 26 27 Blade disc Charging station LED for operation check of the boundary wire Loop wire for the boundary wire and guide wire Transformer with power cord Low voltage cabl
58. on steep slopes is greater If there is risk for thunder the transformer should be disconnected from the power and the boundary wire and the guide wire from the charging station The blades must be in good condition to obtain the best mowing result In order to keep the blades sharp for as long as possible it is important to keep the lawn free from branches small stones and other objects Replace the blades regularly for the best mowing result It is very easy to replace the blades See 8 6 Replacing the blades 12 English 2 PRESENTATION Working method Automower automatically mows the lawn It continuously combines mowing and charging The charging station sends outa signal that Automower can sense ata distance of 6 7 metres The mower starts to search for the charging station when the battery charge becomes too low Automower does not mow when itis searching for the charging station When Automower searches for the charging station it uses one or more of three different search methods Irregular Follow boundary wire and Follow guide wire For more information about the search methods see 2 3 Search method on page 15 and Follow loop in 3 2 2 on page 53 When the battery is charged the mower reverses turns around and leaves the charging station ina randomly selected direction within the exit sector 90 270 To make it easier for Automower to reach all parts of the garden you can manually set
59. one number 1 OK This phone number is essential to operate the unit The administrator can enter a further four phone numbers for communicating with the mower see table on page 41 SMS feature In cases where an error message is displayed in the mower display the GPS communication unit sends an SMS with the same error message A number of messages are presented in chapter 9 7 Fault messages page 69 The following SMS can be sent to Automower to change settings or enquire of settings and status IMPORTANT INFORMATION Note that it is important to write the messages exactly as outlined in the tables below with spaces dots and colons in the correct manner All commands are confirmed by Automower sending back an SMS The commands that start with the letter S Set change a setting and commands beginning with an R Read read settings or status English 39 4 USE Description Commands Send the mower to the charging station Shm Start mowing Sst Set timer 1 Sti hh mm hh mm Set timer 2 St2 hh mm hh mm Set both timer 1 and timer 2 Str hh mm hh mm hh mm hh mm Set weekend timer 1 Swet1 hh mm hh mm Set weekend timer 2 Swet2 hh mm hh mm Set both weekend timer 1 and weekend timer 2 Swetr hh mm hh mm hh mm hh mm Set week timer Swt On Off On Off On Off Off Read status Rst Read timer Rtr Read weekend timer Rwetr Read week timer
60. or the charging station The mower mows for shorter periods than usual between charges Grass ora foreign object is blocking the blade disc or skid plate Dismantle and clean the skid plate and blade disc Both the mowing and charging times are shorter than usual The battery is spent Contact your dealer to replace the battery Automower starts mowing directly outside of the charging station instead of following the loop out Change corridor width and or reversing distance 72 English 10 TECHNICAL DATA 10 Technical data Data Automower 265 ACX Dimensions Length 80 cm Width 71 cm Height 31 cm Weight 12 9 kg Electrical system Battery Special Lithium lon battery 22V 8 5Ah Transformer 230V 24V Mean energy consumption at maximum use 54 kwh month with a working area of 6000 m Noise emissions Measured noise level 64 dB A Guaranteed noise level 69 dB A Mowing Mowing system Five jointed cutting mower blades Blade motor speed 1750 rpm Power consumption during cutting 60 W 20 Cutting height 2 6 cm Cutting width 32 cm Working capacity 6000 m 20 Technical Data GPS communication unitt Data GPS communication unit Power supply 18 VDC Power supply backup battery 3 8 VDC Antennas GPS and GSM on circuit board GSM frequencies
61. ose to the ground so as not to be cut off before the grass roots have grown over it Use a hammer to knock down the staples in the ground Exercise care when knocking in the Staples and make sure the wire is not under strain Avoid forming the wire in sharp bends If you intend to bury the boundary wire e Make sure to place the boundary wire at least 1 cm and a maximum of 20 cm into the ground The boundary wire must not be crossed on the path to and from an island 28 English 3 INSTALLATION Laying the boundary wire in towards the charging station The boundary wire can be routed in several different ways in towards the charging station The best 1 alternative is to route the wire completely outside the i charging station see alternative 1 The wire can also be placed under the charging station plate as shown In alternative 2 in the illustration However the wire should notbe placed outside alternative 2 because it can then be difficult for Automowers to find the charging station When connecting to the charging station the right end of the boundary wire should be guided into the right hand hole and the cable s left end in the left hand hole J oining the boundary wire If the boundary wire is not long enough and needs to be spliced Use original solderless coupler It is waterproof and gives a reliable electrical connection Insert both wire ends in the coupler Make
62. ossible for example to set 4 minutes for Guide 1 Corridor width delay and Guide 2 delay and 9 minutes for Guide 2 delay Boundary delay Automower then searches irregularly for 4 minutes and then searches for the guide wires for 5 minutes If by this time it has not found one of the guide wires the mower will now search for both the boundary wire and guide wires If itis not suitable in the installation to follow the boundary wire 99 minutes should be specified as the delay for the boundary wire Itis of course possible to specify the same delay time for both the guide wires and the boundary wire e g 5 minutes Automower then searches irregularly for 5 minutes and when it does not find the charging station it continues to search either by following the guide wires or the boundary wire depending on which one it reaches first Different delay times can also be chosen for guide 1 and guide 2 The mower does not change the search method If the mower starts to follow the boundary wire it will not switch to follow a guide wire e Corridor width 3 2 3 The Corridor width setting defines the distances from the mower s path to the boundary wire or the guide wire when following these to from the charging station The area beside the wires used by the mower is called the Corridor Corridor A low corridor width value represents a narrow corridor while a high value represents a wide corridor With a narrow corridor Autom
63. oundary wires is less than 3 metres itis recommended to install a guide wire through the passage For more information about the guide wire see 3 8 Installation of the guide wire on page 33 E ast3 m Usually the installation of the guide wire is the best solution with narrow passages The narrowest passage that Automower can run through with the help of a guide wire is 80 cm between the boundary wires 2 Change the Corridor width setting 3 2 3 When the distance between the boundary wires in a narrow passage Is more than 2 metres it Is possible for Automower to run through the passage if a low value is set for the Corridor width 3 2 3 function see page 54 However a low value involves a large risk of tracks forming along the entire boundary wire The transition between a large area and a passage Should be if possible designed like a funnel with rounded corners to make it easier for Automower to enter the passage 26 English 3 INSTALLATION Slopes The boundary wire can be laid across a slope that Slants less than 10 The boundary wire should not be laid across a slope that is steeper than 10 There is a risk of Automower finding it difficult to turn there The mower will then stop and show the fault message Outside working area The risk is at its greatest in damp weather conditions as the wheels can slip on the wet grass However the boundary wire can be laid across a
64. ower always runs close to the boundary wire respective guide wire With a wide corridor Automower varies how it runs i e close to and further from the boundary wire respective guide wire Corridor width is a relative distance and is stated on a scale from 0 to 20 The lower the Corridor width value the closer Automower follows the boundary wire and or guide wire 54 English 6 MENU FUNCTIONS Different corridor widths can be set for the boundary wire guide 1 and on guide 2 The default setting on Automower is set to a value of 19 for both the boundary wire and guide wires The higher the stated Corridor width value the less risk there is of tracks forming However a high corridor value means that Automower may find it difficult to enter passages A garden with large open areas should have a wide Corridor i e a high Corridor width value A garden with passages should have a narrow Corridor i e a low value for the Corridor width When the value is set to 0 for the Corridor width Automower will run along the boundary wire which means it will run with half the mower inside the loop and half the mower outside As there are often flower beds hedges and walls along with the boundary wire Corridor width 0 is not normally recommended Should you still like to State this value the boundary wire must lay 50 cm from solid objects instead of the normal 40 cm IMPORTANT INFORMATION The distance at which the
65. r more information about Corridor width 3 2 3 see page 54 In exceptional cases Automower can be set to straddle the boundary wire that is to say half the mower inside the loop and the other half outside The boundary wire must then be kept at a distance of about 50 cm from all the boundaries of the working area and from the edges of a passage Boundaries within the working area Use the boundary wire to demarcate areas inside the working area by creating islands around obstacles that can not withstand a collision for example flower beds and fountains Run the cable out to the area route it around the area to be demarcated and then back along the same route If staples are used the wire should be laid under the same staple on the return route When the boundary wire to and from the island are close together the mower can drive over the wire Obstacles that can withstand a collision for example trees or bushes higher than 15 cm do not need to be demarcated by the boundary wire Automower will turn when it collides with this type of obstacle However for the most gentle and silent operation itis preferable to demarcate all fixed objects in and around the working area Obstacles that slope slightly for example stones or large trees with raised roots should be demarcated or removed Automower can otherwise slide up onto this kind of obstacle causing the blades to be damaged Secondary areas It is recommended to
66. rmat and four digit PIN code plus setting of the time and date see page 32 46 English OFF 6 MENU FUNCTIONS 6 Menu functions 6 1 Main menu The main menu consists of four options 6 3 Commands 1 6 4 Timer 2 6 5 Installation 3 6 6 Settings 4 The numbers in brackets refer to the menu rows on the display of Husqvarna Automower There are a number of submenus under each option You can access all the functions to set Automower settings via these Browse between menus Browse through the main menu and submenus with the help of the arrow buttons Enter values and the time with the help of the numerical buttons and confirm each selection with the YES button Press the Cancel button to go one menu step back and press the Home button to return directly to the main menu Number series To navigate more quickly within the mower menu you Can use a number Series Shortcut to reach a specific function directly The first number in the series corre sponds to a selection in the main menu The second number corresponds to the selection in the first sub menu etc For example Press 2 2 in the main menu and the submenu Day timer is shown The headings on the following pages include respective number series within brackets Submenus In some of the submenus there is a box to the right of specific rows When this box is checked with a tick it means the function is selected In some of the submenus t
67. search settings according to the Follow loop in 3 2 2 on page 53 Change the position of the charging Station The battery is spent Expected life is 1 4 years Contact your dealer to replace the battery something Wrong PIN code Wrong PIN code has been entered Enter the correct PIN code Three attempts are permitted the keypad is then blocked for five minutes PIN code expired The Time lock 4 1 2 function has This is normal Enter the correct PIN been activated because the selected code number of days has expired Anti theft protection in the GPS Return the mower to the anti theft module has been activated because area and enter the correct PIN code the mower Is outside the anti theft If the message is displayed in the area intended working area the anti theft area radius needs to be increased No drive Automower has got caught in Free the mower and rectify the reason for the lack of drive If itis due to wet grass wait until the lawn has dried before using the mower The working area includes a steep Slope Maximum guaranteed slope is 35 Steeper slopes should be isolated The guide wire is not laid at an angle ona slope If the guide wire is laid on a slope it must be laid at an angle across the Slope No contact in charging Automower makes poor contact with Check that Automower has docked and Automower has made a number of charging attempts stat
68. st Place Automower in the charging Station and change the PIN code via Settings Security PIN code shortcut 4 1 1 You can use the Same PIN code as earlier This may be due to the boundary wire being routed in the wrong direction around an island which blanks out the signal Check that the boundary wire has been routed correctly If this occurs in isolated areas it may be due to interference from metallic objects perimeter fence reinforcement bar or buried cables in the vicinity Try moving the boundary wire Trapped Automower has got caught in something Free Automower and rectify the reason for it getting trapped English 69 9 TROUBLE SHOOTING Fault message Outside working area Cause If this occurs in isolated areas it may be due to interference from metallic objects perimeter fence reinforcement bar or buried cables in the vicinity Action Try moving the boundary wire The working area slopes too much Check that the boundary wire has been routed correctly The boundary wire has been routed the wrong way around an island Check that the boundary wire has been routed in accordance with the installation instructions The boundary wire is too close to the edge of the working area Check that the boundary wire has been routed correctly Low battery voltage Automower cannot find the charging Station Change the
69. st then be entered each time the main switch is moved to the ON position This theft prevention function is called Time lock 4 1 2 and Automower has this function activated as a default setting The function also means that the mower stops mowing after a set number of days and will not continue until the correct PIN code has been entered The function can be deactivated or changed as required For more information about Time lock 4 1 2 see page 58 Automower can enter a sleep mode to save power The display on the control panel is then completely dimmed The sleep mode is activated 25 minutes after the STOP button has been pressed and then not reset to the operating mode Automower is then activated by Switching the main switch off and on The sleep mode can also be activated in the event of a fault occurring during mowing or charging and which is not rectified within 25 minutes Automower is then activated by pressing the STOP button Movement pattern The mower s movement pattern is irregular and is determined by Automower itself A movement pattern is never repeated This mowing system means the lawn is mown equally without any mowing lines If Automower enters an area where it senses the grass is longer than earlier itcan change the movement pattern It can then mow in a square pattern to cover the area of longer grass more systematically When Automower mows in a square pattern this is known as squ
70. sure the wires are fully inserted in the coupler by checking that the wire ends are visible through the transparent area on the other side of the coupler Now press down the button on top of the coupler fully Use a pair of pliers if the button on the coupler is difficult to press down by hand IMPORTANT INFORMATION Twisted cables or a screw terminal chock block insulated with insulation tape is nota satisfactory splice Soil moisture will cause the conductors to oxidise and after a while result in a broken circuit English 29 3 INSTALLATION 3 5 Connecting the boundary wire Connect the boundary wire to the charging station 1 Liftup the cover on the charging station Grip under the edge of the cover with both hands and pull straight out towards the sides Now lift the cover straight up 2 Slide in the ends of the boundary wire in the lowermost holes on the charging station and catch them in the uppermost holes The right hand wire end should be inserted in the right hand hole and the left hand wire end in the left hand hole IMPORTANT INFORMATION The boundary wire must not be crossed when connecting to the charging station Therefore the right hand wire end must be connected to the right hand connector on the charging station and vice versa 30 English 3 INSTALLATION 3 Place the cable ends in the connector Open the connector Place the wire in the con
71. tallation material Loop wire for the boundary wire and guide wire 19 e Staples 22 During installation you will also need Hammer plastic mallet to simplify putting the Staples in the ground Combination pliers for cutting the boundary wire and pressing the contact units together Edge cutter straight spade if the boundary wire must be buried 3 2 Installation of the charging station Best charging station location Take the following aspects into consideration when identifying the best location for the charging station Allow for 3 metres of free space in front of the charging station e Close to a wall socket The supplied low voltage cable is 20 metres long A level surface to place the charging station on Protection from water spray for instance from irrigation Protection from direct sunlight Place in the lower part of a working area that has a major slope Possible requirement to keep the charging Station out of sight for outsiders Any aesthetic preferences For examples of where best to install the charging Station see 7 Garden example on page 61 If you are going to install a guide wire read 3 8 Installation of the guide wire see page 33 before choosing the position of the charging station 18 English 3 INSTALLATION The charging station must be positioned with a great deal of free area in front of it at least 3 metres It Should also be positione
72. the boundary wire Guide wire recommended Timer Operating time of 24 hours per day Exit angles 90 270 Search method Irregular and Follow guide wire in Delay Guide 1 2 minutes Guide 2 2 minutes and boundary wire 99 minutes Automower is never permitted to follow the boundary wire Corridor width 19 Area 1600 m2 L shaped garden with the charging station placed in the large open area No guide wire is necessary N j co O Timer Operating time of 8 hours per day Exit angles 90 270 Search method Irregular and Follow boundary wire in Delay Guide 1 2 minutes Guide 2 2 minutes and boundary wire 11 minutes Corridor width 19 Waa aS Area 1600 m L shaped garden with the charging station placed in the narrow area There are two islands No guide wire is necessary Timer Operating time of 8 hours per day Exit angles 250 290 Search method Irregular and Follow boundary wire in Delay Guide 1 2 minutes Guide 2 2 minutes and boundary wire 11 minutes Corridor width 19 62 English 7 GARDEN EXAMPLE Proposals for installation and settings Area 3500 m2 U shaped garden with the charging station placed on one of the large open areas Guide wire recommended through the passage Timer Operating time of 17 hours per day Exit angles 90 270 Follow loop out Direction Guid
73. the required position The selected position is the marking on the knob that aligns with the arrow on the body Turn clockwise to raise the cutting height Turn anticlockwise to lower the cutting height 4 Close the cover Ensure that the catch button locks English 43 5 CONTROL PANEL 5 Control panel All forms of commands and settings for Husqvarna Automower are made via the control panel All functions are accessed via a number of menus The control panel consists of a display and a keypad All information is shown on the display and all input is done using the buttons The main page shows the main menu cursor clock selected operating mode number of mowing hours clock icon program selection and battery status e The main menu is the uppermost level in the entire menu structure Main menu e The cursor shows which menu has been selected when the YES button is pressed Commands The clock shows the current time Timer The text AUTO or MAN shows which operating Installation mode has been selected Settings The number of operating hours indicates the number of hours since the day of manufacture that Automower has been in operation The time that Automower has spent mowing or looking for the charging station is counted as operating time e The clock icon shows when Automower should be or is switched off by the timer i e stands in the charging station or is on its way to the ch
74. u want the sector sector 1 to end Commands Exit angles Timer Follow loop Installation Installation shape Settings Advanced Exit angles Reversing dist Follow loop Start angle 1 Installation shape End angle 1 Advanced English 51 6 MENU FUNCTIONS Follow loop 3 2 These functions in this sub menu are for situations when the mower needs to be guided to reach remote areas to find the charging station more easily and to determine at what distance the mower shall follow the Follow loop in loop You will also find test functions here to see how Exit angles different charge exit settings work and how the mower finds its way into the charging station Follow loop Follow loop out Corridor width EPES ee Test IN Installation shape T T Advanced 33 e Follow loop out 3 2 1 This function means that Automower can be set to follow the boundary wire or a guide wire away from the charging station to reach a more remote area of the garden This function is very useful in gardens where the front and back are joined by a passage where the charging station cannot be placed tp e When this function is activated Automower will follow the boundary wire or guide wire away from the charging station in the set direction It will Start mowing when it reaches the area p I I I I I I Up to five remote areas can be activated Area 1 Area 2 Area 3
75. uction and safety 1 1 Introduction Congratulations on your choice of an exceptionally high quality product To get the best results from your Husqvarna Automower requires knowledge of Its function This Operator s manual contains important information about the mower how you install it and how you use it The following system is used in the Operator s manual to make this easier e Italic content indicates one of the following It is shown in the mower s display Itis an SMS via a mobile phone Itis a reference to a another section in the operator s manual e Words written in bold are one of the buttons on the mower s keypad e Words written in UPPERCASE and italics refer to the position of the main switch and the different operating modes on the mower Husqvarna AB has a policy of continuous product development and therefore reserves the right to modify the design and appearance and function of products without prior notice IMPORTANT INFORMATION ae Read through the Operator s Manual carefully and understand the content before using your Automowers AN WARNING Automower can be dangerous if incorrectly used English 5 1 INTRODUCTION AND SAFETY 1 2 Symbols on Automower These symbols can be found on the lawn mover Study them carefully so you understand their significance e Read through the Operator s Manual carefully and understand the content before using your Automower
76. uently reach all parts of the garden and in doing so achieve a perfect mowing result Different gardens require different settings A number of garden examples and proposed installations and settings are presented on the following pages Functions where the settings deviate from the mower s default settings are shown in bold For further and more detailed information about the different settings see chapter 6 Menu functions on page 47 IMPORTANT INFORMATION The default setting for Automower has been chosen to work on as many different gardens as possible The settings only need to be adjusted when special installation conditions exist for example narrow passages Proposals for installation and settings Area 3500 m2 No guide wire is necessary No default settings except Timer need to be changed Timer Operating time of 17 hours per day Exit angles 90 270 Search method Irregular Delay Guide 1 2 minutes Guide 2 2 minutes and boundary wire 11 minutes Corridor width 19 Area 6000 m2 No guide wire is necessary Timer Operating time of 24 hours per day Exit angles 90 270 Search method Irregular and Follow boundary wire in Delay Guide 1 2 minutes Guide 2 2 minutes and boundary wire 11 minutes Corridor width 19 English 61 7 GARDEN EXAMPLE Proposals for installation and settings Area 4500 m2 A number of islands and a Steep slope along
77. utomower to mow before it requests the PIN code Finish by pressing YES When the selected number of days has elapsed Automower completes mowing and charges the battery The message Enter PIN code is then Shown on the display You then enter your code and press YES In addition Automower will now request the PIN code each time the main switch is switched to ON e Deactivate Move the cursor to Time lock and press YES Now move the cursor to OFF and press YES 58 English 6 MENU FUNCTIONS e Alarm 4 1 3 This function means that the first digit of the PIN code must be entered within 10 seconds after PIN code the STOP button has been pressed or the mower has been lifted up for any reason If the Tia anh correct number is not entered after three Oe attempts the alarm sounds The alarm can then be stopped by entering the complete PIN code IMPORTANT INFORMATION The alarm can be activated on the mower using the Alarm function It is recommended that this function is used TO e Activate Move the cursor to Alarm and press YES Select ON to activate and press YES Then specify for how long the alarm should sound by answer the question Duration of alarm Deactivate Move the cursor to Alarm and press YES Select OFF to deactivate and press YES When you select OFF the alarm function is also deactivated e GPS 4 1 4 GPS anti theft protection offers increased protection and control of Automower
78. wer covers a working area when it mows Above all it influences the turning angles and how often the mower changes Normal direction The Open setting optimises the pattern of Installation shape movement for an open garden If the garden contains a lot of small areas linked with passages a better function will be obtained with the Complex setting Select e Open 3 3 1 for an open lawn area with few obstacles and no passages Follow loop Complex Advanced when steep slopes give an uneven mowing result e Normal 3 3 2 for an average number of obstacles and or passages e Complex 3 3 3 for a large lawn area and large number of obstacles and or passages Advanced 3 4 e Drive past wire 3 4 2 The front of Automower always passes the boundary wire by a specific distance before the mower turns The default distance is 27 cm but this can be changed if required The minimum Follow loop value is 15 cm and the maximum value is 50 cm Exit angles To adjust the distance Move the cursor to Drive Installation shape Check loop past wire and press YES Now specify the number of centimetres you want Automower to pass the boundary wire Advanced Drive past wire 3 4 6 6 Settings 4 From this option in the main menu you access the settings e Security 4 1 Commands Timer Security for PIN code time lock alarm and GPS settings The PIN code must be specified for the Security menu to be shown

Download Pdf Manuals

Related Search

Related Contents

Istruzioni per l`uso Lavastoviglie Manual de instrucciones    Les produits d`entretien chimiques ne sont pas sans taches  User`s Manual - Topp Pro Professional Audio Gear  Kurzanleitung Quick Reference Guide Guide de consultation rapide  Vigo VG15194 Installation Guide  Homelite HL80215 Pressure Washer User Manual  ネットワークカメラ  

Copyright © All rights reserved. Failed to retrieve file