Home

4 - Siemens

1. 5 Module 3 op io o iO io iO o io Slot number IM361 3 4 5 6 7 8 9 10 11 Connecting cable 368 Module 2 HEI Slot number IM 361 3 4 5 6 7 8 9 10 11 Connecting cable 368 5 Module 1 Slot number IM361 3 4 5 6 7 8 9 10 1i Il Connecting cable 368 co ia Customer specific module Slot number 2 3 45 Digital address 0 3 assigned 0 1 Analog address 272 287 default values Figure 4 1 Example of Slots in C7 Additional S7 300 You can connect up to three S7 300 racks to a C7 The manual 70 describes Racks how these are connected C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 4 3 Addressing Assigning Parameters and How the C7 I O Works 4 2 Addressing the C7 I O Overview Fig
2. LID Bottling station E gt oog p B EE gam Oooooo000 a D000 ADE Q Labelling F gt P oe Palletization ooooooon ovo i Mixing and Bottling Stations C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 7 3 Standard O I Functions 7 1 2 Screen Elements Screens on the C7 are made up of various screen elements Some examples are listed below Fixed texts Semigraphic characters Input fields for process values Output fields for process values Bars Curves Symbolic graphics We will use the mixing station of the fruit juice plant to show you the various screen elements Screen Elements The screen might look something like this of the Sample Screen Mixing Station Ingredients in I O Tank 1 Tank 2 Tank 3 o gt lt Amount in the mixer in I 4 4 o4 iia Valve 4 Valve 4 Mixer Selection open closed Mixer motor main screen metor off Selec
3. C7 DP CPU as DP master lt gt lt gt User program execution time in C7 DP CPU Response time of the DP slave Bus processing time Figure 3 5 Response Times within the PROFIBUS DP Network Description Table 3 20 shows where you can find a description of the various components of the response times Table 3 20 Components of the Response Time in the PROFIBUS DP Network Component of Response Time Description User program execution time in the C7 DP CPU Response time of the DP slave In the documentation for the DP slave Bus processing time In this section C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 3 37 Controlling with the C7 CPU 3 8 2 Bus Processing Time tpp Definition Calculation Using STEP 7 Several DP Masters 3 38 The bus processing time is the time taken by the DP master to address all the DP slaves assigned to it once only If you have configured your PROFIBUS DP network using STEP 7 STEP 7 will calculate the typical bus processing time to be expected You can display the bus processing time of your configuration on the programming device see STEP 7 User Manual An overview of the bus processing time is provided in Figure 3 6 In this example it is assumed that each DP slave has an average of 4 bytes of data Bus processing time 7ms Transmission rate 1 5MBit
4. Time Date Bits 5 6 Date time 1 New The transfer of the date and time from the C7 OP to the C7 CPU can be initiated by means of C7 CPU job 41 These bits are set by the C7 OP if a new date or a new time is transferred The bits must be reset in the program after the date or time has been evaluated The following diagram shows the layout of byte n 1 Afterwards follows the description of the individual bits Address n 1 7 6 5 4 3 2 1 0 C7 OP Ready bit C7 OP Operating mode C7 OP Restart Bit 0 C7 OP restart 1 C7 OP has been started Bit 0 is reset upon completion of the restart You can reset the bit in the C7 CPU program and thus recognize when the C7 OP is being restarted Bit 1 C7 OP operating mode 1 C7 OP in off line mode 0 C7 OP in normal mode Bit 1 is set if the user switches the C7 OP to off line The bit has a value 0 in an on line condition C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 8 17 Data Areas for Communication between the C7 OP and the C7 CPU Description of byte n 3 Bit 2 C7 OP ready bit The C7 OP inverts the ready bit within the interval of 1 second In the C7 CPU program you can recognize whether a connection to the C7 OP exists Byte n 3 serves to synchronize the transfer of data records and indirect variables The meanings of the individual bits are described below Exactly how the transfer works is
5. Organization Block The operating system of the C7 CPU is based on event controlled user OB program processing The following table shows which organization blocks OBs are automatically called up by the operating system for which event Description of the A detailed description of the various OBs and their users can be found in the OBs manual 235 Size of an OB An OB can have a maximum size of 8 Kbytes OBs for Scan Table 3 3 lists the OBs which determine the behavior of the C7 CPU during Cycle and Startup the scan cycle and startup Table 3 3 List of OBs for Scan Cycle and Startup Scan Cycle and Startup Activated OB Possible Start Preset Priority of Events the OB Scan cycle 1101y 1103H Lowest priority Startup STOP RUN transition 1381y 13824 OB for Internal and Table 3 4 lists OBs which determine the behavior of the C7 CPU after External Interrupts interrupt events The priority of the OBs cannot be changed C7 626 C7 626 DP Control Systems 3 6 C79000 G7076 C627 01 Controlling with the C7 CPU Table 3 4 List with C7 CPU Interrupt Events Interrupts Internal and Activated OB Possible Start Priority of the Priority External Events OB Time of day interrupt OB10 11lly Time delay interrupt OB20 11214 3 Range 1 ms to 60000 ms adjustable in 1 ms increments Low Cyclic interrupt OB35 11364 12 Range 1 ms to 60000 ms adjustable in 1 ms increments Default value 100 ms H
6. ESC Softkeys Figure 7 4 Standard Screen Message Processing Uses The softkeys have the following meaning Open event message window Delete event message buffer Delete alarm message buffer Return to main screen In addition the following functions can be selected via function keys K1 g K2 C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Open event message page alternate between indicating the event message page and the event message buffer Open alarm message page alternate between indicating the alarm message page and the alarm message buffer 7 15 Standard O I Functions 7 2 6 System Messages Overview System Message Window Deselecting Error Causes and Remedies System messages inform you of certain internal operating states of the C7 OP The messages include everything from informational notes to serious and fatal error messages System messages can be caused by the following e Operator errors for example illegal entries e System errors for example disturbed communication between C7 OP and C7 CPU As soon as a certain operating state error occurs the C7 OP automatically displays a window containing a system message Example of a system message window Message number 210 Buffer overflow warning A system message consists of a message number and a m
7. group The LED remains on as long as an unacknowledged alarm message is queued C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Operating the C7 General Table 6 1 ENTER Key Functions Function Description Info key This key is used to open a window containing a help HELP text for the selected object for example message input field The LED goes on when a help text is available for the selected object The help window is closed by pressing any key ENTER key e Accepts and exit an entry e Opens the pop up window for a symbolic entry LM Cursor keys e Moves the cursor to the individual input fields in a screen e Move the cursor within an input field e Select an entry from the message buffer e Select a value from the pop up window Note Pressing several keys at the same time may lead to incorrect entries C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 6 5 Operating the C7 General 6 3 Input Output Fields Overview Procedure Correcting Canceling Entries Edit Mode 6 6 The screens on the C7 contain different types of input output fields e Numeric fields digital or analog e String fields e Symbolic fields The basic procedure for entering values on the C7 OP is described below 1 Using the cursor keys position the cursor on the desired input field 2 Enter the va
8. C7 626 C7 626 DP Control Systems 6 10 C79000 G7076 C627 01 Operating the C7 General Example of a You want to enter valve 05 Proceed as follows String Entry ENTER C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Display Vi VA VAL J VALV E VALVE VALVE J VALVE E VALVE Off VALVE oof Confirm entry 6 11 Operating the C7 General 6 3 3 Symbolic Fields Entries in symbolic fields are made with a pop up window indicating the entries available for this field Entry To make an entry in a symbolic field proceed as follows 1 Open pop up window gt 2 Select entry 3 Confirm e The value belonging to the selected entry NTER entry becomes valid ao e The pop up window is closed or Cancel entry The old value becomes valid again ESC e The pop up window is closed Example You want to use a symbolic entry to turn on mixer 3 The pop up window appears gt Mixer 3 is marked off On You select mixer 3 on Off 2 The entry you selected is confirmed that is accepted C7 626 C7 626 DP Control Systems 6 12 C79000 G7076 C627 01 Operating the C7 General
9. 09 Channel Specific Diagnostic Byte AI2 Parameter error in parameters for 0 no channel Wire break in software O no 1 yes only for 4 20 mA Measurement underrange O no 1 yes underflow Measurement overrange O no 1 yes overflow 10 channel Wire break in software 1 yes only for 4 20 mA Measurement underrange 1 yes underflow Measurement overrange 1 yes overflow 11 Parameter error in parameters for channel Wire break in software l yes only for 4 20 mA Measurement underrange 1 yes underflow Measurement overrange 1 yes overflow 12 Channel type AO of the following channel specific diagnostic information 13H 13 7 Number of analog output Oly channels 14 7 Number of diagnostic bits per 00H channel 15 Channel Vector for Channel Group AO C7 626 C7 626 DP Control Systems 5 6 C79000 G7076 C627 01 VO Diagnostics Table 5 2 Layout of the Diagnostic Area Byte Bit Meaning Explanation Value Range 0 Collective error in AO1 0 no 1 yes 1 7 0000000 Analog inputs will be reset until the channel functions again Exception parameter assignment for wire break check for setting lt gt 4 20 mA AI 7FFFH Analog output will be reset until channel functions again AO 0 V 0 mA Counters will be reset until channel functions again CI FFFFH FC IC FFFFFFH x x No hardware interrupt no diagnostic interrupt no di
10. Declaration Section of OB40 The entries in the declaration section of OB40 are listed in Table 4 19 bytes relevant to the user are hatched in the table The Table 4 14 Declaration Section of OB40 0 Class Identifier Event number 1 2 Priority class Current OB number 3 4 Data identifiers Z2 3 6 Additional information Z1 8 Additional information Z2 o 10 Additional information Z3 12 Time stamp of event z i i Additional Information Z1 Additional information Z1 contains the initial address of the C7 I O module bytes 6 7 Address 272 or 0110y or address with assigned parameters Additional Information Z2 Additional Information Z3 Evaluation in the User Program Bit 4 of byte 8 1 in the case of an end of cycle interrupt Additional information Z3 is not used and assigned the value 0000H The evaluation of hardware interrupts in the user program is described in the manual 234 C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Addressing Assigning Parameters and How the C7 I O Works 4 4 Use and Function of the Universal Inputs Overview This section contains information on e Basic terminology for the function of the universal inputs How to use the universal inputs e How to address and assign parameters to the universal inputs 4 4 1 Addressing the Universal Inputs Overview Adresses in the C7 626 DP Adresses in the C7 626 You can select the following
11. Measurement e Type of measurement e Measuring range Interrupt cycle e Interrupt e Interrupt time Analog Output Value Range Preset Value w Yes No No Yes No No Deactivated Voltage Voltage Current 10 V 10 V 20 mA 4 20 mA Yes No No Unsolicited 3 ms 16 ms 3 5 ms 4 ms 4 5 ms 16 ms C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Addressing Assigning Parameters and How the C7 I O Works Interrupt Cycle Parameter Characteristics of Analog Inputs If parameters are assigned to this mode of analog inputs then e A measurement cycle will be processed Channel 1 2 3 4 e The measured value of each measured channel will be made available to the user program for collection e After expiry of the interrupt time in the C7 CPU a hardware interrupt will be triggered and a new measurement cycle initiated A D conversion 2 A D conversion of the channels 2 of the channels Om 30 1 2 3 4 oy 1 2 3 4 Be SERA e EN Tela gt 0 5 ms lt gt Measurement cycle ba a Assigned interrupt time Figure 4 4 Sequence of the Measurement of all Four Channels with an Assigned Measurement Cycle If individual measurement channels are deactivated then the measurement cycle will be correspondingly shorter Table 4 3 shows which parameters e Are static or dynamic e Can be set for all analog inputs or for each individual channel
12. 1 for 100 ms and then also for 100 ms reset to logic 0 With the Monitor Modify Variable function of STEP 7 the following can be monitored PIW280 current counter value C1 MW20 counter image C1 PIW282 current counter value C2 MW22 counter image C2 PIW284 current counter value C3 MW24 counter image C3 MB40 number of interrupts triggered by C1 MB41 number of interrupts triggered by C2 MB42 number of interrupts triggered by C3 PIB287 status of interrupts The OB100 complete restart block contains the following statements ORGANIZATION_BLOCK OB100 var_temp start_info array 0 19 of byte end_var BEGIN Resetting the counters L 0 explicitly stopping all counters T PQB276 Ci T PQB279 1C2 T PQB282 II C3 CALL SFC 47 WT 10000 wait so that STOP becomes effective C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 4 47 Addressing Assigning Parameters and How the C7 I O Works Setting comparison values L 10 set comparison value C1 T PQW274 L 20 set comparison value C2 T PQW277 L 40 set comparison value C3 T PQW280 Declaring comparison values valid and starting counter L3 declare comparison value valid and start T PQB276 C1 T PQB279 C2 T PQB282 C3 END_ORGANIZATION_BLOCK OB1 Statement OBI contains the following statements Sequence ORGANIZATION_ BLOCK OB1 var_temp start_info array 0 19 of byte status BYTE
13. 2 Switch on the C7 power supply 3 The startup of the C7 OP is delayed and the following message displayed Press DEL to erase total intern FLASH The following procedure is possible If you confirm this message within the delay time with the DEL key the memory of the C7 OP will be completely deleted configuration and OP firmware If you do not confirm the message nothing is deleted and the C7 OP will start up as usual and the existing configuration will be started If the C7 OP is reset the configuration can only be loaded via the serial V 24 interface see Section 2 3 Resetting the C7 CPU means that the C7 CPU is reinitialized the current control program is deleted and any user program found in the flash memory of the C7 CPU is reloaded e Erase with the C7 system function C7 CPU Operating Modes e Erase with the programming function see programming device manual A reset using the programming device function is only possible when the C7 CPU is in STOP mode C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 2 11 Commissioning Startup How to Reset the C7 CPU 2 12 The following describes how to clear the C7 CPU with the help of the system function C7 CPU OperatingModes 1 Switch on the power supply to the C7 and wait until the start up tests have been completed The standby message will be displayed A 2 Select the system function menu by pressing the keys ge
14. 6 4 Switching the Active Window Overview Several windows can be displayed at the same time on the C7 To use them you can switch between the individual windows Switches between the following windows are possible e Main screen e Fixed screen e Message line and message window Selecting a Use the middle cursor key to select the window in which you want to work or Window make entries Key Description Each time you press this key the cursor jumps from one window to the next The window in which the cursor is located is the active window in which you can make entries or perform other operations Restrictions You cannot switch to windows which do not contain input fields Special Features l P Exceptions Message line message window and message page For these exceptions the cursor is positioned on the first message You can then select the information text pertaining to the message Information Key How to use the information key e The first time the key is pressed The information text pertaining to the selected field or message is displayed e The second time the key is pressed The information text pertaining to the main screen is displayed C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 6 13 Operating the C7 General Static and The position of the displayed window is static on the C7 Dynamic Windows When an alarm message window or a pop up window is displayed for example an
15. Table 4 3 Parameter Characteristics of Analog Inputs Parameter Static Dynamic Effective Range Enable diagnostic interrupt Static Analog inputs Analog output Universal inputs Enable diagnostics Static Channel Wire break check Static Channel Type of measurement Dynamic Channel Measuring range Dynamic Channel Interrupt cycle Analog inputs C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Addressing Assigning Parameters and How the C7 I O Works Analog Output Parameters Parameter Characteristics of Analog Outputs Table 4 4 provides an overview of the analog output parameters Table 4 4 Analog Output Parameters Parameter Basic settings e Enable diagnostic interrupt Diagnostics e Enable Configuration parameter error Substitute value switched on Substitute value Analog Output Value Range Preset Value Yes No e Retain last value Yes No No e Value 94004 6C00H 0 Output range e Type of output Deactivated Voltage Voltage Current e Output range 10V 10V 20 mA 4 20 mA Table 4 5 shows which parameters e Are static or dynamic e Can be set Table 4 5 Parameter Enable diagnostic interrupt Static Static Dynamic Parameter Characteristics of Analog Outputs Effective Range Analog inputs Analog output Universal inputs Enable diagnostics Static Output Substitute value e Retain last value Dynamic Output
16. The contents of a C7 CPU flash memory are not automatically reset during a memory reset of the C7 CPU You must explicitly initiate these actions using the functions of the programming device Load User You must explicitly load the C7 flash memory using the STEP 7 function Program into Flash Copy RAM to ROM You do this after you have copied the program and Memory ROM data into the RAM In this way the whole contents of the RAM are transferred to the flash memory ROM Erase Flash After the memory reset the RAM is reinitialized with the contents of the Memory ROM flash memory However since you can only change the contents of the flash memory using the STEP 7 function Copy RAM to ROM you must proceed as follows to erase the flash memory 1 Go on line in the Simatic Manager AP on Select all SDBs OBs FCs DBs FBs and delete these using the menu command Edit Delete 2 Then select MPI 2 direct and execute the function PLC Copy RAM to ROM The C7 CPU is then reset C7 626 C7 626 DP Control Systems 3 42 C79000 G7076 C627 01 Addressing Assigning Parameters and How the C7 I O Works Summary of orien Assigning Parameters to the Analog I Os 4 433 3 Representation of Analog Values of Analog Values recat eB eS 3 4 Representation of Analog Values for the Measurement Ranges of the Analog Inputs 4 3 5 Representation of Analog Values for the Output Range of the Analog Outputs
17. c eee eee eee eee ee C7 626 C7 626 DP Control Systems a C79000 G7076 C627 01 Ili Contents 3 8 Bus Processing Times in the PROFIBUS DP Network 3 8 1 Components of the Response Time with the C7 DP CPU as DP Master 3 8 2 Bus Processing Time tDP 0 cee eee ees 3 9 Test and Reference Data Functions of the C7 CPU 3 10 Loading Erasing the C7 CPU Flash Memory 0000 neues Addressing Assigning Parameters and How the C7 I O Works 4 1 Assigning Addresses to Signal Modules 0000e eee eeeeee 4 2 Addressing the C7 W O 2 ects 4 3 Use and Function of C7 Analog I Os 0 cece eee 4 3 1 Addressing the Analog I Os 00 eee ee 4 3 2 Assigning Parameters to the Analog I OS 0 cece eee ee eee 4 3 3 Representation of Analog Values ccc cece eee eens 4 3 4 Representation of Analog Values for the Measuring Ranges of the Analog Inputs 2200 2 thee Dede saad eating aed ebm EVRE 4 3 5 Representation of Analog Values for the Output Range of the Analog Outputs suc esee pehedews eriad kii kik a eed akie aik ee ne 4 3 6 Conversion and Scan Cycle Time of the Analog I Os 4 3 7 Conversion Scan Cycle Settling and Response Times of the Analog Outputs sven insect E OEE bee ieee EER 4 3 8 Behavior of the Analog I OS 00 ccc eect eee eee 4 3 9 Time Interrupt Interrupt Cycle
18. 0 0 6 c cece eee eee 4 4 Use and Function of the Universal Inputs 0 2 eee 4 4 1 Addressing the Universal Inputs 0 cece ee eee eee 4 4 2 Assigning Parameters to the Universal Inputs 00 4 4 3 Interrupt InputS 2 0 ete ees 4 4 4 COUNLENS 6 04 20 caviar dae cake eden heed E E hana eee ds 4 4 5 Counter Interrupts 00 e eee 4 4 6 Frequency Counters 0 0c cece annann arana 4 4 7 Period Time Measurement 000 cece eee eee eee eens 4 5 Data Set Description for Parameter Block of the C7 Analog I Os and Universal Inputs 2 000 c eee e cette eee eens 4 6 Examples for Programming the Analog I Os and the Universal Inputs 4 6 1 Block for Scaling Analog Output Values 0 0c cece 4 6 2 Block for Scaling Analog Input Values 00 0 cee eee eee eee 4 6 3 Example for Programming Counters 0000 e eens DIAQNOSIICS 0 6 seis ceca een tee eee hee ee nee ee ewes 5 1 Diagnostic Messages 0 cece teens 5 2 Diagnostic Data of the C7 Analog I Os and Universal Inputs 5 3 Constraints and Responses of the Diagnostic Evaluation Operating the C7 General 0 cece eee eee eee eee 6 1 Screen LayOut 2 0 cece eee E EER 6 2 Keyboard sii ata e nhc iaoeia Baked dew dated Ghaca bie a heae boned 6 3 Input Output Fields 3 241 seo e eee rierien eee Generate ween ee 6 3 1 Numeric
19. Mustika centre Building Floor 2a P O Box 4267 B 62 21 8 30 65 74 Fax 62 21 8 30 74 02 Iran 15914 Teheran Siemens S S K Mr Din Payuh Khiabane Ayatollah Taleghani 32 Siemenshouse P O B ox15875 4773 15 Teheran T 98 ER 61 41 Fax 98 21 6 40 23 89 Japan Tokyo 141 00 Siemens K K ATT Mr Nakamichi Siemens Fujikara Building 8F 11 20 Nishi Gotanda 2 chome Shinagawa ku B 81 3 34 90 44 37 Fax 81 3 34 95 97 92 E 4 Pakistan Karachi 74400 Siemens Pakistan Eng Co Ltd Power Division Mr Tlyas ILACO House Abdullah Haroon Road P O Box 7 B 92 21 51 60 61 Fax 92 21 5 68 46 79 a Philippines Metro Manila Siemens Inc Mr B Bonifacio 2nd amp 4th FI Sterling Centre Bldg Esteban cor de la Rosa Legaspi Village B 63 2 8 18 48 18 Fax 63 2 8 18 48 22 Saudi Arabia Jeddah 21412 Arabia Electric Ltd Service Center Mr Kobeissi P O Box 4621 T 966 3 6 65 84 20 Fax 9 66 2 6 65 84 90 Singapore Singapore 1334 Siemens Pte Ltd Singapore AUT Mr Ulf Bexell 2 Kallang Sector T 658 41 35 28 Fax 65 8 41 35 29 South Korea Seoul Siemens Ltd E A Mr Kang W S Asia Tower Building 9th Floor 726 Yeoksam dong Kang nam ku C P O Box 3001 B 82 2 5 27 77 62 Fax 82 2 5 27 77 19 Taiwan Taipei 106 Siemens Ltd AUT 1 Mr Gulden 6th FI Cathy Life Insurance Bldg 296 Jen Ai Road Sec 4 T 886 3 3 25 48 88
20. Table 3 7 Address Spaces and their Size for Operating the C7 626 DP as a DP Master Unassigned addresses Bytes 0 to 1023 in normal I O area P Up to 512 bytes via load and transfer instructions in process image Bytes 0 to 128 Total on DP 2 Kbytes with SFC14 DPRD_DAT readable and SFC15 DPWR_DAT writeable of which 512 bytes via load and transfer instructions Size of an area for consistent user data Up to 32 bytes User data of a station node Input 122 bytes Output 122 bytes C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 3 11 Controlling with the C7 CPU 3 6 C7 CPU Parameters Configurable Characteristics of the C7 CPU Tool for Parameter Assignment When Does the C7 CPU Accept the Parameters 3 12 The characteristics and behavior of the C7 CPU can be assigned parameters Parameter blocks of the C7 CPU Clock memory Start up characteristics System diagnostics Retentive areas Hardware interrupt Real time clock Time of day interrupt Cyclic interrupt Cycle behavior MPI station addresses The tool that you use to assign the parameters to the C7 CPU is the STEP 7 function Hardware Configuration Working with Hardware Configuration is described in manual 231 The C7 CPU accepts the selected parameters After power on After the parameters have been transferred on line and error free to the C7 CPU in STOP mode After erasing the C7 CPU see Section 2 6
21. Transfer a data record from the data medium to the C7 OP cyop gt Transfer a data record from the C7 OP to the data a medium Data Select a data record name Hja SELECT C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 7 21 Standard O I Functions General Use The following table shows you how to use the standard screens Data Record Processing and Data Record Transmission Key Description Softkey 1 Select recipe name 2 Enter data Observe the following conventions when assigning data record names record names Names may not contain more than 11 characters After the eighth character is entered a period is inserted automatically After the period up to three characters can still be entered Special characters blanks and commas may not be used or Select data Activating the softkey causes a window to appear indicating all record name data records of the selected recipe ORANGE Drinks 05 10 11 34 Comment Nectar 05 12 20 17 Comment Juice 05 13 08 56 Comment Data record Time and date of the last storage name change Using the data record selection window Te fe _ Select the desired data record with the cursor keys 2 Boat Accept selected data record and close window 3 Select data Data records can be stored archived on the internal FLASH medium 4 With the softkey sel
22. Use this softkey to switch status processing to Update running Switch to Force Entry Status processing is stopped Entries can now be made Enter When the value of an address is changed a modification identifier modify appears in the last column of the line address value 2 DB DBW 17 24 DEC 14 X Modification identifier The following occurs when the softkey is pressed again e All address values marked with an modification identifier are transferred to the controller e The modification identifiers are reset e A return to status processing is made automatically status Update running Or Cancel The modified values are not transferred to the controller when the Force Variable entry screen is exited or A switch back to Update running status is made C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 7 33 C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Data Areas for Communication between the C7 OP and the C7 CPU Overview This chapter provides you with information concerning configuration pter p X g g parameters that are necessary for communication between the C7 OP and the C7 CPU Communication occurs via two data areas e The user data area and or e The interface area The functions construction and special features of the various user data areas and the interface areas are described in this chapter For those new to operato
23. end_var BEGIN Evaluation if all counters are active L PIB287 scan status bits T status A L20 4 C1 signalled active A L20 5 C2 signalled active A L20 6 C3 signalled active JC run BEU TDetermining counter image optional run NOP 0 L PIW280 C1 T MW20 L PIW282 C2 T MW22 L PIW284 C3 T Mw24 END_ORGANIZATION_BLOCK C7 626 C7 626 DP Control Systems 4 48 C79000 G7076 C627 01 Addressing Assigning Parameters and How the C7 I O Works OB35 Statement Sequence OB40 Statement Sequence OB35 contains the following statements ORGANIZATION_BLOCK OB35 var_temp start_info array 0 19 of byte end_var BEGIN AN Q1 2 assigned to C1 Q1 2 AN Q1 3 assigned to C2 Q1 3 AN Q1 4 assigned to C3 Q1 4 L Qwo transfer QWO immediately T PQWO END_ORGANIZATION_BLOCK OB40 contains the following statements ORGANIZATION_BLOCK OB40 var_temp start_info array 0 19 of byte end_var BEGIN Tetermining which input has triggered interrupt AN L8 0 interrupt from C1 JC c2 L MB40 counts number of interrupts from C1 up to 255 INC 1 T MB40 c2 NOP 0 AN L8 1 interrupt from C2 JC c3 L MB41 counts number of interrupts from C2 up to 255 INC 1 T MB41 c3 NOP 0 AN L8 2 interrupt from C3 BEB L MB42 counts number of interrupts from C3 up to 255 INC 1 T MB42 END_ORGANIZATION_BLOCK C7 62
24. message processing password processing printer settings restore Start events for OBs 3 6 Start value 4 21 Status variable STL STOP 2 9 on the C7 cpu B 7 Stop counter 4 28 String entry example of 6 11 String fields 6 9 STRNG_DI A 9 STRNG_I A 9 C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 STRNG_R Substitute value parameter block 4 9 Super user Switch buffer Symbolic entry example of 6 12 Symbolic fields Synchronization error System diagnostics 3 12 extended diagnostic buffer entries parameter block sending diagnostic messages System errors System function menu selecting System keyboard 6 4 System keyboard image 8 9 System message window System messages causes System settings System state list B 2 T Temporary diagnostic error Test and reference data functions 3 39 blocks B 39 C7 CPU data communication display diagnostic buffer scan cycle times 3 40 stacks 3 39 time system user memory B 39 Test functions Threshold frequency counter TIM_S5TI A 6 Time setting 6 15 Time error CPU B 7 Time interrupt Time delay interrupt CPU Time of day interrupt cpu B 7 start date start time Time of day interrupts parameter block 3 19 Time triggered trends Time setting 6 16 Index 11 Index Timers Update time 8 27 Transfer data records 8 22 Upd
25. 03 41 2 10 30 63 39106 Magdeburg AUT VG 33 Hr Ganschinietz Sieverstorstr 32 33 03 91 5 88 17 21 Fax 03 91 5 88 17 22 68165 Mannheim AUT 16 P Hr Sulzbacher Dynamostr 4 B 06 21 Fax 06 21 4 56 28 43 4 56 25 45 81679 M nchen AUT P 14 Hr Sch fer Richard Strauss Str 76 B 0 89 92 21 30 64 Fax 0 89 92 21 43 99 48153 Munster AUT S 13 Hr Schlieckmann Siemensstr 55 B 0251 76 05 4 25 Fax 02 51 76 05 3 36 90439 Nurnberg AUT P 11 Hr Glas Von der Tann Str 30 B 09 11 6 54 35 87 Fax 09 11 6 54 73 84 49090 Osnabr ck AUT S 13 Hr P hler Eversburger Str 32 B 05 41 12 13 2 73 Fax 05 41 12 13 3 50 93053 Regensburg AUT P S 12 Hr Rewitzer Hornstr 10 T 09 41 Fax ZN ZN ZN ZN ZN ZN ZN ZN 18069 Rostock AUT Fr Langhammer Industriestr 15 B 03 81 78 21 71 Fax 03 81 78 21 75 66111 Saarbr cken AUT Hr Muller Martin Luther Str 25 B 06 81 3 86 22 89 Fax 06 81 3 86 21 11 57072 Siegen AUT P 11 Hr Patz Sandstr 42 48 0271 23 02 2 40 Fax 02 71 23 02 2 38 70499 Stuttgart AUT P 11 Hr Miller Weissacherstr 11 B 07 11 1 37 26 44 Fax 07 11 1 37 29 46 54292 Trier AUT VG 14 P Hr Baldauf Lobstr 15 B 06 51 20 09 23 Fax 06 51 20 09 24 89079 Ulm AUT ZR Hr Birk Nikolaus Otto Str 4 B 07 31 94 50 3 28 Fax 07 31 94 50 3 34 97084 Wurzburg AUT PIS 13 Hr
26. 2 CONCAT Combine two STRING variables in one STRING 180 us n X 28 variable 17 INSERT Insert a STRING variable into another STRING 250 us n X 26 variable at a defined point 4 DELETE Delete L characters of a STRING variable 300 us L P x 27 31 REPLACE Replace L characters of a STRING varaibale with a 300 us L P x 27 second STRING variable 11 FIND Find the position of the second STRING variable in k x 50 us the first STRING variable L P block parameters if 1 P 0 then the execution time L P 254 us n number of characters k number of characters in parameter IN1 C7 626 C7 626 DP Control Systems A 8 C79000 G7076 C627 01 SFCs and SFBs in the C7 CPU Format STEP 7 provides the following IEC functions for converting variables to and Conversions with from the STRING format STRING Name Description Execution Time ILSTRNG Convert a variable from INTEGER format to 1 11 ms STRING format DI_LSTRNG Convert a variable from INTEGER 32 bit 1 5 ms format to STRING format R_STRNG Convert a variable from REAL format to 1 72 ms STRING format STRNG_I Convert a variable from STRING format to 0 5 ms INTEGER format STRNG_DI Convert a variable from STRING format to 0 84 ms INTEGER 32 bit format STRNG_R Convert a variable from STRING format to 2 0 ms REAL format Number STEP 7 provides the following IEC functions for selection functions Processing Name Descrip
27. 506 87 50 50 Fax 5 06 21 50 50 C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Mr Rudriguez Juis Mr Roland Herron Ecuador Quito Siemens S A Dept DEA Mr J Guerra Calle Manuel Zambrano y Panamericana Norte km 2 1 2 Casilla de Correos 17 01 3580 B 5 93 2 47 40 60 Fax 5 93 2 40 77 38 El Salvador San Salvador Siemens S A E A Mr M Dubon 43 Calle Siemens Parque Industrial Sta Elena Apartado 1525 5 03 78 33 33 Fax 5 03 78 33 34 Guatemala Ciudad de Guatemala Siemens S A EA AUT Mr Godoy 2a Calle 6 76 Zona 10 Apartado 1959 B 5 02 2 32 44 44 Fax 5 02 2 34 36 70 Columbia Baranquilla Siemens S A EA Mr C Perez Carrera 58 No 709 40 T 57 ES 56 11 48 Fax 57 958 56 11 48 Bogota 6 Siemens S A Division Energia Mr M Jaramillo Carrera 65 No 11 83 Apartado 80150 57 1 2 94 22 66 Fax 57 1 2 94 24 98 Cali Siemens S A Barranquilla Mr Guido Hernandez Carrera 40 No 13 05 T 57 EAI 66 4 44 00 Fax 57 92 66 5 30 56 Cali Siemens S A Cali Mr C A Naranjo Carrera 48 A 15 Sur 92 57 94 2 66 30 66 Fax 57 94 2 68 25 57 Mexico 02300 Mexico D F Siemens S A de C V EI AUT Mr Gregorio Sanchez Delegacion Azcapotzalco Poniente 116 No 590 Colonia Industrial Vallejo Apartado Postal 15 064 02600 mexico T 52 5 3 28 20 00 Fax 52 5 3 28 21 92 Fax 52 5 3 28 21 93 Peru Lima 13 ESIM S A Dept AUT Mr Paz
28. C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 4 21 Addressing Assigning Parameters and How the C7 I O Works Diagram with The pins are shown in the diagram Universal Inputs __ View of right hand side of C7 000000000000 0000000000000 Universal inputs Ground DI X1 DI X2 DI X3 DI X4 0000000 00000000 ON DD oO BOW N Not used Inputs with this shading are not relevant to this example Pin No Figure 4 6 Pins of Universal Inputs C7 626 C7 626 DP Control Systems 4 22 C79000 G7076 C627 01 Addressing Assigning Parameters and How the C7 I O Works 4 4 2 Assigning Parameters to the Universal Inputs Parameter Block Universal Inputs Parameter Assignment Interrupt Inputs Counter Inputs In parameter block universal inputs you set the parameters for e The interrupt inputs e The counters e The frequency meter period time counter e Digital input always if interrupt or counter input deactivated You set the parameters for the universal inputs using the STEP 7 function Hardware Configuration A parameter block is generated which contains all currently selected parameters of the universal inputs After loading this parameter assignment the C7 CPU then transfers the parameters to the appropriate universal inputs on every transition from STOP RUN If the universal inputs are used as interr
29. Event messages Alarm messages C7 OP Functionality DP with their different versions Functions of C7 626 C7 626 DP The table below provides an overview of the functions of C7 626 and C7 626 Function C7 626 C7 626 DP Number 2000 Indication In message line message window View all queued events On message page Length of message text 2x 35 in characters Lines per message 2 Process values in message text 8 Number 2000 Indication In message line message window Indication type 1st value last value can be selected View all queued alarms On message page Length of message text 2x 35 in characters Lines per message 2 Process values in message text 8 Acknowledge individual alarm Yes messages Acknowledge several alarm messages simultaneously Yes 16 acknowledgement groups Message logging Logged on a printer Yes Message buffer Capacity 512 message occurrences Look at buffered event messages On buffer page alarm messages Delete Yes Buffer overflow warning Yes Forced printout for buffer Yes overflow Message acquisition Time of occurrence Date time Message status Arriving departing acknowledged C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 C7 OP Functionality Standard Screens Control Jobs System Messages Table C 1 Functions of C7 626 C7 626 DP continued Screens Function C7 626 C7 626 DP Indi
30. Fax 003 59 2 68 50 51 Croatia 41000 Zagreb Siemens d o o Mr Culjak Trg Drazena Petrovica 3 Cibona 0 03 85 41 33 88 95 Fax 00385 41 32 66 95 Czech Republic 60200 Brno Siemens AG Kancelar Brno Hr Tucek Vinarsk 6 B00 42 5 43 21 17 49 Fax 00 42 5 43 21 19 86 14000 Praha 4 Siemens AG Zastoupeni v CR Mr Skop Na strzi 40 B00 42 2 61 2150336 Fax 00 42 2 61 21 51 46 Denmark 2750 Ballerup Siemens A S IP Mr Hansen Borupvang 3 0045 44 77 42 90 Fax 00 45 44 77 40 16 Finland 02601 Espoo Siemens Osakeyhtioe OEM AUT 1 Mr Saarelainen Majurinkatu P O Box 60 0 03 58 0 51 05 36 70 Fax 003 58 0 51 05 36 56 E 2 France 69300 Caluire Siemens S A AUT 1 9 11 chemin des petites brosses BP 39 00 33 78 98 60 08 Fax 00 33 78 98 60 18 59812 Lesquin Cedex Lille Siemens S A AUT 1 78 rue de Gustave Delroy BP 239 T 0033 209571 91 Fax 00 33 20 95 71 86 33694 Merignac Bordeaux Siemens S A AUT 1 Parc Cadera Sud 36 Avenue Ariane BP 351 T 00 33 56 13 32 66 Fax 00 33 56 55 99 59 44300 Nantes Siemens S A AUT 1 Zac du Perray 9 rue du petit chatelier T 00 33 40 18 68 30 Fax 00 33 40 93 04 83 93527 Saint Denis Cedex 2 Paris Siemens S A AUT 1 Mr Granger 39 47 Bd Ornano T 0033 1 49 22 33 18 Fax 00 33 1 49 22 32 05 67016 Strasbourg Cedex Siemens S A AUT 1 2 rue du Rhin Napoleon BP 48 T 00 33 88 45 98 22 Fax 00 33 88
31. Figure 1 1 Components of the C7 The individual functional units integrated in the SIMATIC C7 correspond to the modules and devices that can be used in modular configurations comprising S7 300 CPUs COROS OPs etc The C7 s I O expansion capability via its IM interface permits the connection of SIMATIC S7 300 modules distributed over three racks with a maximum of 24 7 300 modules C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Introduction The general functionality of the C7 also corresponds to a configuration with standard modules in the PLC and OP ranges The individual components operate independently of one another and each processor has a separate memory STEP 7 is used for programming the C7 CPU whereas the C7 OP is programmed with ProTool Both tools run under Windows either on programming devices or PCs C7 626 C7 626 DP Control Systems 1 8 C79000 G7076 C627 01 Commissioning Startup Overview Summary of Sections In this chapter you will learn How the C7 behaves on startup What you must do if the configuration has not been loaded How you can activate the C7 CPU operating modes RUN P RUN STOP and MRES How you can activate the DI DO status display How you perform a memory reset of the C7 controller You Will Find On Page With a Loaded Configuration in the C7 OP Without a Loaded Configuration in the C7 OP Reloading a Configuration 2 5 Selecting the C7 CPU Operating Mode an
32. Influence of the Value Range for the Output Influence of Errors The behavior of the analog output is dependent upon the position of the output value within the value range Table 4 13 illustrates this dependency for the analog output values Table 4 13 Behavior of the Analog Input in Relation to the Position of the Analog Input Value in the Value Range Output Value lies Output Diagnostics Interrupt i Value Nominal range C7 value Upper range lower C7 value range Overflow underflow 0 signal Errors lead to a diagnostic message and diagnostic interrupt if diagnostic parameters have been assigned see Volume 2 of the manual Section 4 3 1 and 4 3 9 Time Interrupt Interrupt Cycle Interrupt Cycle Assignable Events Hardware Interrupt OB If the interrupt cycle mode is assigned parameters the new measuring cycle is not started unless the time interrupt is initiated seg Section 4 3 2 Use the STEP 7 function Hardware Configuration for parameter assignment If a hardware interrupt is transferred from the I O to the C7 CPU the hardware interrupt OB OB40 is called in the C7 CPU The event which called OB40 is stored in the start up information declaration section of OB4O0 You have to evaluate the additional information Z1 to Z3 in the start up information C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 4 17 Addressing Assigning Parameters and How the C7 I O Works
33. Request Transfer 1 2 Maximum number per type 8 8 8 Total length of all data areas words 8 8 8 C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 8 13 Data Areas for Communication between the C7 OP and the C7 CPU Trend Request If a screen is opened on the C7 OP with one or more trends the OP sets the Area corresponding bits in the trend request area Once the screen has been deselected the C7 OP resets the corresponding bits in the trend request area The trend request area can be used on the C7 CPU to evaluate which trend is currently being displayed on the C7 OP Trends can be triggered even if the trend request area is not evaluated Trend Transfer This area is used to trigger trends In the S7 program set the bit assigned to Area the trend in the trend transfer area and the trend communication bit The C7 OP detects the trigger and resets the trend bit and the communication bit Depending on the configuration it then reads out a single value or the whole buffer Trend transfer area s Bit number 7 6543 2107 65 43 21 0 1st word 2nd word Trend communication bit Until the communication bit is reset the trend transfer area cannot be modified by the S7 program Trend Transfer Trend transfer area2 is required for trends configured with a switch buffer Its Area2 structure is exactly the same as that of trend transfer areal C7 626 C7 626
34. Vogt Andreas Grieser Str 30 B 0931 61 01 4 59 Fax 09 31 61 01 5 42 42103 Wuppertal siehe ZN 45128 Essen AUT P 14 Hr Klein Kruppstr 16 B 02 01 8 16 24 28 Fax 02 01 8 16 23 31 E 1 Siemens Worldwide SIMATIC Contact in Europe Austria 6901 Bregenz Siemens AG AUT Mr Madlener Jun Josef Huter StraBe 6 P O Box 347 B 00 43 55 74 41 92 72 Fax 00 43 55 74 41 92 88 8054 Graz Siemens AG AUT Mr Jammernegg Strassganger StraBe 315 PO Box 39 B00 43 3 16 2 80 42 80 Fax 00 43 3 16 2 80 42 85 6040 Innsbruck Neu Rum Siemens AG AUT Mr Mayr SiemensstraBe 24 P O Box 9 04 00 43 5 12 23 12 60 Fax 00 43 5 12 23 15 30 9020 Klagenfurt Siemens AG AUT Mr Weber Werner von Siemens Park 1 T 00 43 4 63 3 88 32 43 Fax 00 43 4 63 3 88 34 49 4020 Linz Siemens AG AUT Mr Schmidt Wolfgang Pauli StraBe 2 P O Box 563 00 43 7 32 3 33 02 95 Fax 00 43 7 32 3 33 04 93 5020 Salzburg Siemens AG AUT Mr Mariacher Innsbrucker BundesstraBe 35 P O Box 3 TB 00 48 6 62 4 48 83 35 Fax 00 43 6 62 4 48 83 09 1211 Wien Siemens AG AUT 1 Mr Strasser SiemensstraBe 88 92 P O Box 83 00 43 1 25 01 37 88 Fax 00 43 1 25 01 39 40 Belgium 1060 Brussels Siemens S A VP4 Mr Gmuer Chaussee de Chaleroi 116 B00 32 2 5 36 25 33 Fax 00 32 2 5 36 23 87 Bulgaria 1113 Sofia Siemens AG Mrs Kirova Blvd Dragan Zankov Nr 36 00359 2 70 85 21
35. e Freely configurable function keys e Softkeys e Pop up windows for symbolic entries Process or machine states for example the current operating mode are displayed by the C7 as plain text event messages Alarm messages provide information on critical machine states Current measured values for example temperatures speeds etc can also be included in the text of event or alarm messages Event and alarm messages are stored with date and time in a message buffer At the same time all message events can be printed if message logging is switched on and a printer is connected Information texts can be configured You can use them to give the operator additional information which will help him her to correct a malfunction Complete blocks of machine data can be stored as recipes on the C7 The structure of a recipe is specified during configuration It makes no difference whether the recipes are real recipes or only piece number specifications traversing paths or temperature progressions You can change or redefine recipe data directly on the C7 The C7 offers password protection Each operator can be assigned a different password A password level can then be used to enable or disable each operator s access to special operating functions This prevents incorrect entries and improves system security C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 1 5 Introduction Multiple Languages Programm
36. in a PROFIBUS DP network longest reducing 3 28 shortest variation range Response time longest Response time shortest Response times within ET 200 B 37 Restore EG Retentive areas counters data areas memory bytes number of bytes parameter block timers Index 10 RUN Run oc ee system RUN P 2 9 Run time meter calculating calculation example B 30 extending maximum Screen layout Screen number area Screens SDB SEL Self test 2 3 Settling time analog outputs 4 15 SFB sFC 3 5 B A DPNRM_DG DPRD_DAT DPWR_DAT SHIFT key Sign conventions analog ranges 4 10 SIMATIC S7 alarm messages control jobs data mailbox 8 23 date and time 8 17 event messages function keyboard image 8 10 identifications images LED image recipes screen number area system keyboard image transferring data records trend transfer area 8 13 user version C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Index SIMATIC S7 coupling C7 OP operating mode C7 OP restart E17 control and checkback bits coupling identifier date and time job area ready bit 8 18 Size of an OB Size of the acknowledgement areas Slave See DP slave Slot number Slots C7 4 2 Softkey keyboard 6 4 Speed of the C7 CPU Standard diagnostic byte Standard screen force variable 7 32 Standard screens backup 6 15
37. power supply error program execution error station failure in PROFIBUS DP network communication error programming error direct I O access error 3 9 Controlling with the C7 CPU 3 5 DP Interface of the C7 626 DP Overview Reference Information C7 626 DP asa DP Master 3 10 This section describes all the data which define the C7 626 DP as a DP master You need to know these data in order to configure a PROFIBUS DP network with the C7 626 DP You will find descriptions and information about the design and configuration of a PROFIBUS DP network and diagnostics on the PROFIBUS DP network in the STEP 7 on line help and in the STEP 7 documentation Table 3 6 contains important specifications for operating the C7 626 DP as a DP master Table 3 6 Important Specifications for Operating the C7 626 DP as a DP Master Specifications C7 626 DP as a DP Master Transmission rates 9 6 Kbps 19 2 Kbps 3 Mbps 93 75 Kbps 6 Mbps 187 5 Kbps 12 Mbps 500 Kbps The following DP stations DP slaves ET 200 can be connected DP ASI link PLC 95 DP DP slave S5 115U to 155U with IM308C as DP slave Field devices to DIN E 19245 Part 3 Number of addressable slaves 64 C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Controlling with the C7 CPU Address Space of the C7 CPU DP Table 3 7 lists the address spaces and their size for operating the C7 626 DP as a DP master
38. 6 to 0 Step 3 In the program enter the IDs and the data record in the data mailbox Then set bit 5 to 1 C7 OP required to read data mailbox The data record is determined by the IDs 8 10 Writing Variables Indirectly Principle Indirect variables which are assigned to input fields can be configured for the C7 OP The value is entered directly on the C7 OP by the operator Following input on the C7 OP the contents of these variables are transferred in a coordinated fashion to the data mailbox in the controller Coordination The coordination of data transfer is similar to the coordination of the data record transfer of recipes see Section 8 9 3 Usage Indirect variables can be used on screens as normal variables meaning variables with addresses C7 626 C7 626 DP Control Systems 8 26 C79000 G7076 C627 01 Data Areas for Communication between the C7 OP and the C7 CPU 8 11 Notes on Optimization Decisive Factors The construction of the user data area described in Section 8 3 and the configured polling times in the area pointers are significant factors for the actual reachable update times The update time is the polling time plus the transfer time plus the processing time To reach an optimal update time the following points should be observed during the configuration e Configure the individual data areas as large as necessary but as small as possible e Define the data areas which belong together contiguous
39. 60 08 40 31106 Toulouse Siemens S A AUT 1 Mr Huguet ZAC de Basso Cambo avenue du mirail BP 1304 B 0033 6211 20 15 Fax 00 33 61 43 02 20 Great Britain Manchester M20 2UR Siemens PLC Control Systems Mr Hardern Sir William Siemens House Princess Road 00 44 61 4 46 52 33 Fax 00 44 61 4 46 52 32 Greece 54110 Thessaloniki Siemens A E VB 3 AUT Mr Passalidis Georgikis Scholis 89 P O Box 19290 00 30 31 47 92 12 Fax 00 30 31 47 92 65 15110 Amaroussio Athen Siemens A E HB 3 AUT Mr Antoniou Paradissou amp Artemidos P O Box 6 10 11 00 30 1 68 64 5 15 Fax 00 30 1 68 64 5 56 Hungary 1036 Budapest Siemens GmbH AUT 1 Mr Turi Lajos utca 103 T 00 36 1 269 7455 Fax 00 36 1 269 74 54 Iceland 121 Reykjavik Smith amp Norland H F Mr Kjartansson Noatuni 4 P O Box 519 0 03 54 1 62 83 00 Fax 003 54 1 62 83 40 Ireland Dublin 11 Siemens Ltd Power amp Automation Division Mr Mulligan 8 11 Slaney Road Dublin Industrial Estate 0 03 53 1 8 30 28 55 Fax 00353 1 8303151 Italy 40127 Bologna Siemens S p A AUT R10A Mr Tosatti Via Casciarolo 8 T 00 39 51 6 38 45 09 Fax 00 39 51 24 32 13 25128 Brescia Siemens S p A AUT R10A Mr Gaspari Via della Volta 92 BD 00 39 30 3 53 05 26 Fax 00 39 30 34 66 20 20124 Milano Siemens S p A AUT R10A Mr Berti Via Lazzaroni 3 T 00 39 2 66 76 28 36 Fax 00 39 2 66 76 28 20 35129 Padova Siemens S p
40. 71 71 5000 Cordoba Prov de Cordoba Siemens S A Mr S Garcia Campillo 70 T 54 51 73 9940 994 Fax 54 51 72 97 14 5539 Las Heras Prov de Mendoza Siemens S A Mr S Suarez Acceso Norte 379 T 54 en 30 00 22 0 37 Fax 54 61 30 00 22 0 37 2000 Rosario Prov de Santa Fe Siemens S A Mr R Stiza Ricchieri 750 B 54 1 41 37 03 21 0 Fax 54 1 41 37 07 87 Bolivia La Paz Sociedad Comercial e Industrial Hansa Ltda E amp A Mr Beckmann Calle Mercado esq Yanacocha C P 10 800 B 591 2 35 44 45 Fax 591 2 37 03 97 Brazil 05110 900 Sao Paulo SP Pinituba MAXITEC S A AUT PA Mr F Rocco Avenida Mutinga 3650 T 55 an 8 36 29 99 Fax 55 11 8 36 29 50 Canada Mississauga ON L5N 7AG Siemens Electric Ltd Dept SL 20 Mr Fred Leon 2185 Derry Road West T 4 608 7 92 81 95 82 Fax 1 905 58 19 58 12 Point Claire QUE H9R 4R6 Siemens Electric Ltd Mr D Goulet 7300 Trans Canada Highway T Bi 4 26 60 a Fax 1 514 4 26 6 Burnaby B C V5J 5J1 Siemens Electic Ltd Hr A Mazurek Marine Way Business Park 8875 Northbrook Court B 1 604 4 35 08 80 Fax 1 604 4 35 10 23 Chile pantiago de Chile INGEL S AC Div Energia Hr Browne Avda Holanda 64 Cas 242 V B 56 2 231 0000 Fax 56 2 2 32 66 88 Costa Rica San Jose 1000 Siemens S A San Jose Division Energia y Automatizacion VAT Hr Ferraro La Uruca Apartado 100 22
41. A 7 GT_DT GT_STRNG NE_DT NE_STRNG SB_DT_TM SEL Index 5 Index STRNG_DI A 9 STRNG_I A 9 STRNG_R A 9 TIM_SSTI A 6 FC IEC execution time A 6 FIND Fixed window Flash memory erasing loading Force variable operating procedure standard screen Forced logging 7 28 Free DP address assi gnment 4 2 Frequency clocks Frequency calculation Frequency counter frequency calculation measurement period k33 resolution 4 threshold frequency Frequency meter parameter Frequency meter measurement resolution 4 33 Function keyboard Function keyboard image 8 10 Functions of the C7 OP G GE_DT GE_STRNG GT_DT GT_STRNG Hardcopy 7 28 Hardware Configuration loading Hardware interrupt CPU event parameter block 3 17 priority B 17 Hardware interrupt response time 3 33 calculating 3 33 calculation example Highest MPI address Index 6 I_STRNG Icons Identifiers 8 22 IEC FC execution time A 6 Increments Indication priorities 7 10 Indirect 8 22 Information texts 1 5 display key 6 5 Input range special inputs IN SERT A 8 Integral functions Internal error Interrupt 4 7 Interrupt cycle time of day interrupt Interrupt inputs additional information assignable events hardware input start up information 4 Interrupt OB 4 25 Interrupt outputs parameter characteris
42. C7 CPU Languages i guag e STL Statement List consists of a series of statements Each statement in your program contains instructions which mnemonically represent a function of the C7 CPU e LAD A Ladder diagram is a graphic programming language that resembles electrical circuit diagrams Other programming languages are for example SCL and HiGraph C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 3 3 Controlling with the C7 CPU 3 3 Performance Characteristics of the C7 CPU Overview Table 3 1 Performance Characteristic Load memory Table 3 1 lists the most significant performance characteristics of the C7 CPU Performance Characteristics of the C7 CPU C7 CPU e 160 Kbyte RAM Integrated e 512 Kbyte integrated flash memory Work memory 96 Kbytes Integrated Speed Digital inputs outputs Analog inputs outputs Universal inputs Approx 0 3 ms per 1000 binary instructions 16 16 4 DP address space Connectable DP slaves Bit memories Only C7 626 DP 2 Kbytes with SFC 14 DPRD_DAT and SFC 15 DPWR_DAT e of which 512 bytes with load and transfer commands Only C7 626 DP 64 From MO0 0 to M255 7 Selectable retentivity Preset 16 retentive memory bytes from 0 to 15 Retentive data area Maximum total of all retentive data areas Counters 64 From CO to C63 Selectable retentivity memory required 2 bytes counter Preset 8 r
43. CPU must be preserved even after a memory reset C7 MPI Addresses The C7 occupies two MPI addresses e One for the C7 CPU default address 2 e One for C7 OP default address 1 Parameter Block Table 3 17 lists the parameters of the parameter block MPI Addresses MPI Addresses Table 3 17 Parameter Block MPI Addresses Parameter Explanation Value Range Default Setting Highest MPI address The definition of the highest MPI address in the 15 network is necessary in order that 31 e Every network station can be addressed e Th een 63 e communications process operates effectively 126 Note assign only as many MPI addresses as are necessary You will then reduce the communication times The highest MPI address must be the same for all MPI nodes C7 CPU MPI address Each station that is networked via the MPI must From 2 to 126 possess an address The specified address may only be allocated once in the network The C7 OP has its own MPI address default 1 Note The MPI is the only communications interface of the C7 Parameters should only be modified with utmost care C7 626 C7 626 DP Control Systems 3 22 C79000 G7076 C627 01 Controlling with the C7 CPU 3 7 Calculating the Scan Cycle Time and Response Time of the C7 CPU Overview Definition Scan Cycle Time Elements of the Scan Cycle Time This section explains how the scan cycle and response times of a user program are struct
44. Check configuration for log memory or the number of control sequences is too large 616 See Internal Errors 617 618 Wrong value entered Bit no is actual control value 619 ProTool Lite error data structure for presetting setpoint Re load ProTool Lite repeat download of configuration 620 Wrong parameter transferred by ProTool Lite Repeat download of configuration function keyboard 621 Wrong parameter transferred by ProTool Lite Set required value by means of message type standard screen or controller 622 Configured recipe does not fit in the C7 CPU recipe mailbox more than 256 data words 623 See Internal Errors 624 No recipe entries available C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 C 19 C7 OP Functionality Standard Screens Control Jobs System Messages 625 Invalid recipe number in control job or function area 626 No setpoints configured 627 Internal error See Internal Errors Section C 3 1 628 The recipe does not fit into the boxes 629 LED image area too small 630 Keyboard image area too small 631 Message configuration x is incomplete or incorrect Variable x 1 2 The triggered alarm message is not configured 3 The process connection is only set up symbolically 4 The actual value field is only set up symbolically 5 6 The triggered event message is not configured 7 The symbolic actual value field is only set up symbolically 21 24 F
45. Control Systems C79000 G7076 C627 01 Standard O I Functions 7 2 4 Stored Messages Alarm Message Buffer Event Message Buffer Deleting the Buffer The C7 stores all message occurrences in a battery buffered memory This allows you to display the messages at a later date The stored message occurrences are indicated in the alarm message buffer or the event message buffer depending on what type of message they are A buffer page can be selected on the C7 or via the controller All messages are indicated in the order in which they occurred The latest message is shown at the top of the display Example of indicating the alarm message buffer Alarm Message Buffer 0010 KGQ11 38 04 11 18 93 QGR 02 Oil feed stopped 0010 KQ 11 35 18 11 18 93 QGR 02 Oil feed stopped 0049 KGQ11 34 09 11 18 93 QGR 01 Tank press too high 9 3 bar 0049 KQ 11 33 20 11 18 93 QGR 01 Tank press too high 10 3 bar 0049 K 11 32 00 11 18 93 QGR 01 ank press too jhigh 12 7 bar Process Acknowledgement value group Message status K arrived G departed Q acknowledged Time and date of arrival Message number If a message text contains process values the C7 indicates these values as they were when the message occurrence arrived and departed Otherwise the information is identical to that of the event message page or alarm message page The event message buffer alarm
46. Conversion and Scan Cycle Time of the Analog I Os 4 3 7 Conversion Scan Cycle Settling and Response Times of the Analog Outputs 44 7 4 7 Period Time Measurement Time Measurement E ee 5 Data Set Description for Parameter Block of the C7 Analog I Os and Universal Inputs Examples for Programming the Analog I Os and the 4 40 Universal Inputs Block for Scaling Analog Output Values Block for Scaling Analog Input Values Example for Programming Counters C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 4 1 Addressing Assigning Parameters and How the C7 I O Works 4 1 Assigning Addresses to Signal Modules Overview C7 626 Slots Slots for Customer Specific Module Free Address Assignment Example Advantage Addressing of DP Standard Slaves 4 2 The relationship between card slot and address assignment is described below You require this information to determine the start addresses of the C7 modules used The C7 I O and the customer specific C7 modules always occupy the rack number 0 The logical slots 2 and 3 are reserved for the C7 CPU and the integrated IM360 The I O incorporated in the C7 occupies the logical slots 4 digital I O and 5 analog I O and universal inputs The logical slots 6 to 11 can be occupied by a customer specific module With free address assignment unlike slot oriented addressing you are free to assign the address of a module SM FM CP You define the s
47. DP Control Systems 8 14 C79000 G7076 C627 01 Data Areas for Communication between the C7 OP and the C7 CPU 8 7 User Version Usage When the C7 OP starts up a check can be made to determine whether the C7 OP is connected to the correct controller To perform the check the C7 OP compares a value stored on the C7 CPU with the value that you configured This insures compatibility of the configured data with the C7 CPU If the data do not agree with each other system message 653 is displayed on the C7 OP and the device is restarted For you to be able to use this function you must set the following values when you configure your C7 OP e Value belonging to the configuration 1 to 255 by choosing System gt Parameters Miscellaneous If 0 is set this check is not made e Data type and address of the value stored on the PLC by choosing System Area Pointers select User Version in the Type field C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 8 15 Data Areas for Communication between the C7 OP and the C7 CPU 8 8 Interface Area Overview The interface area is only necessary for the C7 CPU if its functions are to be used or evaluated by the C7 CPU The interface area must be configured if you want to use the following functions Send control jobs to the C7 OP Synchronize data and time between the C7 CPU and the C7 OP Evaluate coupling identifier Recipes transfer of data records
48. District P O Box 8543 T 86 13 436 18 88 Fax 86 10 4 36 32 13 200090 Shanghai Siemens Ltd China Shanghai Office Mr William Cui 450 Lin Quing Lu 86 21 5 39 54 10 Fax 86 21 5 39 54 21 110001 Shenyang Siemens Ltd China Shenyang Office Mr Ren Qi Sakei Torch Building 23rd FI 262A Shifu Da Lu Shen He District 86 24 2 79 02 87 Fax 86 24 2 79 02 86 E 3 Siemens Worldwide SIMATIC Contact Outside Europe Hong Kong Hong Kong Siemens Lid Hang Kong A R O Automation System Division Mr Keiren_ Lake 7th Floor Regency Centre 39 Wong Chuk Hang Road B 85 2 28 70 76 11 Fax 85 2 25 18 04 11 India Bangalore 560 001 Siemens Ltd BAN AUT MAP Mr B Sunderram Jyoti Mahal 3rd Floor 49 St Marks Road P O Box 5212 B 91 80 2 21 21 01 Fax 91 80 2 21 24 18 Bombay 400 018 Siemens Ltd AUT M AP Mr S Mistry Head Office B Building 130 Ganpat Jahav Marg Worli B 91 22 4 93 13 50 60 Fax 91 22 4 95 08 22 Calcutta 700 071 Siemens Ltd CAL AUT MAP Mr D K Ganguli 6 Little Russel Street P O Box 715 91 33 2 47 83 74 80 Fax 91 33 2 47 47 83 New Delhi 110 002 Siemens Ltd DEL AUT MAP Mr R Narayanan 4A Ring Road I P Estate P O Box 7036 B 91 11 331 81 44 Fax 91 11 331 41 78 Indonesia Jakarta 12870 Dian Graha Elektrika Jakarta Power Eng amp Autom Div Mr M Zafrullah Jl Gatot Subroto Kov 74 75
49. Entry To make entries in a numeric field proceed as follows Step Key Description 1 Enter decimal a 9 value Enter The characters A to F must be entered in hexadecimal a alpha mode value 0 9 Enter digital value 0 1 2 Confirm gt e The entered value becomes valid entry ENTER The entry becomes invalid if the entered value violates a configured limit value or an incorrect entry is made The old value is retained or Cancel entry The old value becomes valid again ESC C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 6 7 Operating the C7 General Correcting Entries If you have made a mistake and have not yet confirmed the entry proceed as follows IF THEN lt cS Position the cursor on the digit and overwrite Wrong digit The cursor remains on this position One digit too Delete the digit at the cursor position and many DEL consolidate the input from the left 1 2 O Switch to alpha mode One digit too few 2 Insert a blank where the cursor is positioned and pEL shift the entry to the left starting at the cursor position 3 Switch back to numeric assignment of the input joeo 4 Overwrite blank C7 626 C7 626 DP Control Systems 6 8 C79000 G7076 C627 01 Operating the C7 General 6 3 2 String Fields Both numeric characters digits and alphanumeric characters letters of the alpha
50. Fields 000 c cece ttt tenet eens C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Contents 6 3 2 SUING Fields iss ci5 ew nte oe ete e i ee Taa ede eee 6 3 3 SYMDOIIC FICIAS rensas braced Reedy reai beward hoa hea dh eae a Enida as 6 4 Switching the Active Window 00 cece eee eee eee eee 6 5 C7 System Settings 00 6 cece eee eee 6 5 1 Standard Screen System Settings 0 cece eee eee eee 6 5 2 Standard Screen Printer Settings 0 c cece eee eee eens 6 5 3 Blanking Gircuit si oct faa kee eda aii a de Re Oo ead Lae eed 6 5 4 Contrast and Brightness Adjustment 0000 cece eee 6 6 Setting Changing the Operating Mode 000ece eee ee aee 6 7 Password Protection 000 cece eee eee teens 6 7 1 Logging In on the C7 0c eee e eee n ee 6 7 2 Logging Out on the C7 Logout 00 6 eee 6 7 3 Password Management 0 cece eee eee eens 6 8 Hardware Jest porene inatia ne EA feed See ee be ee has 7 Standard O I Functions cece eee eee eee 7 4 STEENS ui esate na na a a dengan a engine aa R 7 1 1 The C7 in Action Using an Example 0 0000 e cence eee 7 1 2 Screen Elements 0 anuanu e eee e eens 7 1 3 Selecting a Screen 0 eee tenes 7 1 4 Standard Screens 00 ccc cnet eee 7 2 WIESSAQES ss istic cwci eee teen nel ae ty a eae ee eee ENN 7 2 1 Event and Alarm Me
51. H py selecting the E screens Figure 7 3 Basic Picture Example Password processing Printer settings Status variable System settings 0O0O0OO0OO Message processing For detailed information on the function and use of the standard screens see the relevant sections in this manual C7 626 C7 626 DP Control Systems 7 6 C79000 G7076 C627 01 Standard O I Functions 7 2 Messages Overview Messages inform the operator of certain occurrences by displaying a text There are three types of messages e Event messages indicate process states during normal operation of the system e Alarm messages indicate malfunctions interruptions in the process e System messages In contrast to event and alarm messages which contain process related information system messages provide information on internal operating states errors of the C7 7 2 1 Event and Alarm Messages Event Messages Alarm Messages Event and alarm messages provide information on normal or critical process states by indicating message texts The message texts may also contain current measured values Below are two examples showing the differences between event and alarm messages The fruit juice plant has finished a mixing procedure An event message informs the operator of this The event message might look something like this Mixing
52. O11 1 Internal error 1 watchdog EPROM ADC error oll 2 External error 1 error at AI or AO oll 3 Channel error 1 with byte O bit 2 and channel specific diagnostic oll byte bytes 4 7 4 External auxiliary voltage absent 0 5 Front plug absent 0 6 Module not assigned parameters Base condition standard parameters set oll byte 0 bit 0 0 7 Incorrect parameters 1 with bit 0 of byte 8 9 10 11 or 15 standard oll parameters for channel set w o Noses Snes CT 02 0 0 1 0 2 0 3 Watchdog activated with bit 1 of byte 0 oll 4 5 6 7 03 0 0 1 0 2 EEPROM error oll 3 0 4 ADC error with bit 1 of byte 0 oll 5 0 6 Hardware interrupt lost oll 7 0 Channel Specific Diagnostic Entries 04 Channel type AI of the following channel specific diagnostic information 71H 05 Number of analog input channels 04H 06 Number of diagnostic bits per OSH channel 07 i Channel Vector Channel Group AI Change in diagnostic entry AI1 oll Change in diagnostic entry AI2 oll Change in diagnostic entry AI3 oll C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 5 5 I O Diagnostics Table 5 2 Layout of the Diagnostic Area Change in diagnostic entry AI4 08 Channel Specific Diagnostic Byte AI1 Parameter error in parameters for 0 no channel Wire break in software 1 yes only for 4 20 mA Measurement underrange 1 yes underflow Measurement overrange 1 yes overflow
53. Other g Petrochemical C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Remarks Form Your comments and recommendations will help us to improve the quality and usefulness of our publications Please take the first available opportunity to fill out this questionnaire and return it to Siemens Please give each of the following questions your own personal mark within the range from 1 very good to 5 poor Do the contents meet your requirements Is the information you need easy to find Is the text easy to understand Does the level of technical detail meet your requirements Please rate the quality of the graphics tables Or le SON E G2 ot Additional comments C7 626 C7 626 DP Control Systems 2 C79000 G7076 C627 01
54. Recognize C7 OP startup in C7 CPU program Evaluate C7 OP operation mode in C7 CPU program Evaluate C7 OP s ready bit in C7 CPU program Layout of the Figure 8 5 shows the layout of the interface area You can define the interface Interface Area area in a data block or a memory area The address of the interface area is to be declared in the configuration This is necessary so that the OP knows where to put the data The interface area is to be determined once per CPU Interface area Address 7 0 n 0 Control checkback bits n 4 Job area n 12 Reserved n 13 Coupling identifier n 14 Reserved nets Time n 18 Reserved n 21 Date n 25 Reserved Figure 8 5 Layout of the Interface Area for the C7 CPU C7 626 C7 626 DP Control Systems 8 16 C79000 G7076 C627 01 Data Areas for Communication between the C7 OP and the C7 CPU 8 8 1 Control and Checkback Bits Introduction Description of byte n 0 Description of byte n 1 Three bytes are available in the interface area for the control and checkback bits Bytes n 0 and n 1 are used to coordinate between the C7 OP and the C7 CPU Byte n 3 is required for the transfer of data records and indirect variables Bytes n 1 and n 2 are described below The structure of byte n 0 is shown below The diagram is followed by a description of the individual bits Address nso 7 6 5 4 3 2 1 0
55. SFC22 CREAT_DB Data Block Name Description Execution Time 22 CREAT_DB Generate a data block of specified length in a specified area 110 us 3 5 us per DB in the specified area Time Of Day You can use the time of day interrupts for program processing controlled by Interrupt the C7 CPU internal real time clock Functions SFC No Name Description Execution Time SET_TINT Setting the times for a time of day interrupt 190 us SFC 29 CAN_TINT Canceling the times for a time of day interrupt 50 us SFC 30 ACT_TINT Activating a time of day interrupt 50 us QRY_TINT Querying the status of a time of day interrupt 85 us Time Delay Time delay interrupts start the operating system at the end of a specified time Interrupts Time C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 A 3 SFCs and SFBs in the C7 CPU Interrupt and The C7 CPU provides you with the following system functions for responding Error Fault to interrupts and errors faults Handling SFC No Name Description Execution Time SFC 36 MSK_FLT Masking sync faults 150 us SFC 37 DMSK_FLT Enabling sync faults 160 us SFC 38 READ_ERR Reading and erasing programming and access errors that have occurred or have been disabled SFC 39 DIS_IRT Disabling the handling of new interrupts SFC 41 DIS_AIRT Delaying the handling of interrupts SFC 42 EN_AIRT Enabling the handling of interrupts SFC 44 REPL_VAL Copying a substitute value into accumu
56. Table 4 24 Table with Data Set Descriptions Parameter Block DS Byte Bit Time hat Can Be Assigned Meaning of the Respective Bit Value Parameters WI Al4 Measurement type 0 Deactivated 1 Voltage 2 Current End of cycle interrupt 0 No 1 Yes only if Byte 4 lt gt 1 Measurement range 0 Deactivated 3 4 20 mA 4 20 mA if measurement type current 10 V if measurement type voltage Output type 0 Deactivated 1 Voltage 2 Current Behavior on 0 Activate substitute value word 10 CPU STOP 1 Retain last value Output range 0 Deactivated 3 4 20 mA 4 20 mA if measurement type current 10 V if measurement type voltage 0000h to AOL Substitute value if byte 9 bit 2 0 C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 4 39 Addressing Assigning Parameters and How the C7 I O Works 4 6 Examples for Programming the Analog I Os and the Universal Inputs Overview The following examples for programming the analog I O and the universal inputs of counters will help you to get familiar with the principles for programming the C7 I O The three following examples are contained in this section e Block for scaling analog output values e Block for scaling analog input values e Block for programming the counters 4 6 1 Block for Scaling Analog Output Values Function of Block Summary of Formulae 4 40 The FC127 block is used to convert the setpoint to be specified i
57. area C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 C 5 C7 OP Functionality Standard Screens Control Jobs System Messages Listing C 6 Table C 2 lists all the control jobs and their parameters which are possible with the C7 No Job number of the control job Table C 2 1 No Select C7 operating mode Parameters 1 0 1 Parameters 2 3 Control Jobs with Parameters Function 3 Hardcopy Parameters 1 2 3 12 Enable disable message log Parameter 1 0 Off 1 On Parameters 2 3 13 Change language Parameter 1 0 Ist language 1 2nd language 2 3rd language Parameters 2 3 14 Set time BCD coded Parameter n 7 Hours 0 23 Parameter 2 n 8 n 9 Seconds 0 59 Minutes 0 59 Parameter 3 C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 C7 OP Functionality Standard Screens Control Jobs System Messages No 15 Function Set date BCD coded Parameter 1 n 7 oe Weekday 1 Sunday 2 Monday Parameter 2 7 Saturday n 8 n 9 Month 1 12 Day 1 31 Parameter 3 n 10 Year 21 23 24 37 Display mode for alarm messages Parameter 1 0 First value oldest message 1 Last value newest message Set password level 1 9 1 lowest password level 9 highest password level Parameter 1 Parameters 2 3 Password logout
58. bits are displayed as soon as the system function menu has been selected You select the menu by pressing 260 and L HELP simultaneously The following menu is displayed DO CPU MODE 00000000 0 7 0 00000000 1 7 1 11001000 0 7 10101000 1 7 RUN 0 2 1 0 K1 F9 F10 F11 F12 F13 F14 K2 a a Figure 2 5 System Function Menu with Associated Function Keys C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Commissioning Startup Selecting the C7 CPU Operating Modes Table 2 1 You select the individual C7 CPU operating modes as follows Selecting the C7 CPU Operating Mode Mode RUN P RUN STOP Keys F9 F10 F11 Explanation The C7 CPU processes the user program Programs and data can be e Displayed from the C7 CPU with the programming device C7 PG e Transferred to the C7 CPU PG gt C7 The C7 CPU processes the user program Programs and data in the C7 CPU can be displayed using the programming device C7 PG The program cannot be loaded or modified Data cannot be loaded or modified The C7 CPU is not processing a user program Programs can be e Displayed from the C7 CPU using the programming device C7 PG Transferred to the C7 CPU PG gt C7 Note The operating
59. branching in message level Parameters 1 2 3 Overflow warning for event messages on off 0 Off 1 On Parameters 2 3 Parameter 1 38 41 42 Overflow warning for alarm messages on off Parameter 1 0 Off 1 On Parameters 2 3 Transfer date time to C7 CPU If this job is submitted too often the C7 can get overloaded as two transfers per job are necessary Fetch LED area from C7 CPU Parameter 1 Block numbers 1 8 Parameters 2 3 43 C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Fetch C7 CPU event message bit area Block numbers 1 8 Parameters 2 3 Parameter 1 C 7 C7 OP Functionality Standard Screens Control Jobs System Messages C 8 No Function 44 Fetch C7 CPU alarm message bit area Parameter 1 Block numbers 1 8 Parameters 2 3 45 Fetch C7 CPU acknowledgement area Parameter 1 Block numbers 1 8 Parameters 2 3 47 Fetch LED area from C7 CPU Parameter 1 LED image Area number 1 8 Parameter 2 LED image word 0 Parameter 3 LED image word 1 LED image gt LED image word 0 Area pointer LED image word 1 Note The difference between this job and job 42 fetch LED area from C7 CPU is as follows With job 47 the LED image is also transferred resulting in a faster control of the LEDs The declared LED area may not be configured larger than 2DW 49 Delete event message buffer 50 Delete alarm message buffer 51
60. configuration on the C7 OP with another MPI Transfer C7 OP configurations can be transferred via an MPI connection to the C7 OP The only requirement is that the C7 OP must already have a loaded configu ration and the MPI transfer function must be configured Loading the To load the configuration proceed as follows Sentiguration 1 Connect the multipoint interface of the C7 to the configuring computer using a programming device PC cable Note e Ifthe C7 OP and the configuring computer are already included in the MPI bus then there is no need to change cables when transferring the configuration 2 Connect the OP to the power supply 3 Select MPI transfer in the standard screen System Settings gt Operating Modes The C7 OP is now restarted 4 The following screen is displayed in MPI transfer mode C7 626 C7 626 DP Control Systems 2 6 C79000 G7076 C627 01 Commissioning Startup Transferring via a V 24 Interface Loading the Configuration MPI DOWNLOAD Indication of the current configured MPI Baud rate 187 5 kBaud transmission rate entry of another MPI Station address 001 transmission rate Indication of the configured C7 OP Download telegram type station address Download address Bown ESC Switch to transfer mode serial Cancel MPI transfer mode Figure 2 4 MPI Transfer 5 Transfer the configuration from the c
61. coordinated The values are read directly from the address Variables not having an address are ignored The following steps refer only to indirect transfer Bit 0 is checked by the C7 OP If bit 0 is set to 1 data mailbox disabled the transfer is terminated with a system error message If bit 0 is set to 0 the OP sets the bit to 1 The C7 OP enters the IDs in the data mailbox The length of the data record is not specified by the C7 OP length 0 is entered The C7 OP sets bit 3 to 1 data transfer terminated In the program evaluate the IDs and enter the requested data in the data mailbox Then acknowledge whether the IDs were error free or erroneous by setting bit 1 or bit 2 Error free IDs bit 2 is set to 1 Erroneous IDs bit is set to 1 The C7 OP reads the data record from the data mailbox and then resets the following bits Bit 3 bit 2 or 1 depending on acknowledgement bit 0 C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 8 25 Data Areas for Communication between the C7 OP and the C7 CPU Transfer C7 CPU gt Make sure with this direction of transfer that the values are written by the C7 OP initiated by C7 CPU to the variables on the C7 OP The values are not written directly to C7 CPU the data record on the data medium Step 1 In the program request the data mailbox lockout by setting bit 6 to 1 Step 2 If lockout is possible the C7 OP sets bit 0 to 1 and simultaneously resets bit
62. entry field hidden by the window cannot be used Generally entries on the C7 cannot be made unless all windows are closed C7 626 C7 626 DP Control Systems 6 14 C79000 G7076 C627 01 Operating the C7 General 6 5 C7 System Settings Overview The functions described in this section can be used to configure the C7 to your requirements The following can be set Operating modes of the C7 Various message functions Date time Language Brightness contrast blanking circuit Printer parameters 6 5 1 Standard Screen System Settings Overview The following settings can be made in the System Settings standard screen Operating modes normal operation on line off line transfer mode MPI transfer Message indication first oldest or last latest alarm message Switch message logging on off Set current date and time Switch buffer overflow warning on off Choice of up to 3 languages Blanking of the display Select backup restore standard screen C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 6 15 Operating the C7 General 6 5 2 Overview 6 16 Layout of the standard screen System Settings Operating mode Display message Message logging Buffer overflow warning Date Time are ESC Language switchover Display blanking circuit Figure 6 3 Standard Screen for System Settings Standard Screen Printer Settings T
63. equal to or less than the level under which you are logged in Proceed as follows 1 Enter a non existent password in the Edit field You can use up to 8 characters 2 Enter a password level from 1 to 8 After your entries have been accepted the new password is stored in a memory of the C7 OP which is safe from power failure C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 6 23 Operating the C7 General Change Password Password Level Delete Password View Password List 6 24 Proceed as follows 1 In the Edit field Enter the password which you want to change or to which you want to assign a new password level 2 Change password Delete old password Then enter new password You cannot change the password directly Change password level Overwrite old password level with the new one Proceed as follows 1 In the Edit field Enter the password you want to delete The C7 indicates the password level assigned to the password 2 Overwrite the password level with zeros After the entry is accepted the password is deleted The password list is called from the Password Processing standard screen with a softkey The passwords and their assigned level are displayed in a pop up window Note Only those passwords are displayed whose password level is less than or equal to the level in which you are currently logged in If there are so many passwords that they cannot all be d
64. for the Scan Cycle Time Components of the To recap The scan cycle time consists of the following Scan Cycle Time y e Process image transfer time e Operating system execution time e User program execution time e Processing time for S7 timers Example The user program in the C7 CPU has an execution time of 1 5 ms Your user program uses four S7 timers In the parameter assignment of the C7 CPU you have deactivated the C7 CPU self test and since the C7 CPU is a stand alone unit the cycle is not loaded with communication tasks Calculation In the example the scan cycle time is calculated from the following times e Process image transfer time Process image input table approx 0 2 ms Process image output table approx 0 15 ms e Operating system execution time Cycle control approx 0 87 ms Rack monitoring approx 0 05 ms e User program execution time approx 1 5 ms e Processing time for S7 timers For four S7 timers the single update takes 4x 7 us 28 us 0 03 ms Adding the process image transfer time the operating system execution time and the user program execution time yields the time interval 0 2 ms 0 15 ms 0 87 ms 0 05 ms 1 5 ms 2 77 ms This time interval prolongs the execution time of the S7 timers 2 77 ms 10 ms Execution time of S7 timers 1 x 0 03 ms 0 04 ms The scan cycle time is the sum of the times listed Cycle time 0 2 ms 0 15 ms 0 87 ms 0 04 ms 1 5 m
65. is detailed in Table 8 3 C7 OP C7 CPU Alarm message area Internal processing Acknowledgement area ACK linking C7 CPU C7 OP Acknowledgement area 7 C7 OP C7 CPU Figure 8 2 Alarm Message and Acknowledgement Areas C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 8 5 Data Areas for Communication between the C7 OP and the C7 CPU Assignment of Acknowledgement Bit to Message Number 8 6 Table 8 3 Alarm Message Acknowledgement Procedure Action Reaction Meaning Set alarm message bit in Appropriate acknowledge Alarm message has arrived C7 CPU bit C7 OP C7 CPU is and is unacknowledged reset Set acknowledge bit in C7 Alarm message has been CPU acknowledged or Acknowledge bit C7 OP Acknowledgement via a C7 CPU is set C7 OP operation Reset alarm message bit in Alarm message has C7 CPU departed independent of Acknowledgement condition 1 Tf acknowledgement is initiated via the C7 CPU the acknowledge bit C7 CPU C7 OP must be reset using the user program by the time a renewed alarm message comes Every alarm message has a message number To this message number the same bit of the alarm message area and the bit x of the acknowledgement area are assigned This is also valid for more than one acknowledgement area if the length of the previous acknowledgement area does not encompass the entire lengt
66. message buffer can be deleted by operator input on the C7 or via the controller Exceptions e Queued messages e Not yet acknowledged alarm messages C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 7 13 Standard O I Functions Buffer Overflow The C7 stores message occurrences in a common memory area for event and alarm messages the so called message buffer If there is only a certain amount of memory space left in the message buffer that is remaining buffer space the C7 can display a system message to that effect If there is no space left in the message buffer and new messages arrive the C7 continues deleting message occurrences from the message buffer until a certain remaining buffer space is available again The oldest message occurrences are deleted in the following order 1 Event messages which have already departed 2 Alarm messages which have departed and have been acknowledged 3 Event messages which are queued 4 Alarm messages which are queued A forced printout of the deleted messages is made if overflow was configured as on and a printer is connected C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Standard O I Functions 7 2 5 Standard Screen Message Processing Layout Event and alarm messages can be processed with the standard screen Message Processing Message Processing IM eo Te x5
67. of a message Example of an alarm message window Message number Date Number of Ti unacknowledgedmessages Ime Acknowledgement group 0048 11 34 02 11 11 93 QGR O1 Tank 25 Temperature 156 degrees Call shift supervisor Tel 9465 Process value at time of arrival C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Standard O I Functions Event Message The event message window is not automatically displayed It must be Window selected by the operator or the controller and then deselected again later A standby message is displayed when no current event message is queued Message number Date Number of not departed messages Time 0050 Tia 27 De 1 293 12 Tank 25 Temperature within tol again 94 degrees Process value at time of arrival Alarm Message The message pages give the operator an overview of the still queued that is Page Event not yet departed alarm or event messages Message Page The event message page or the alarm message page can be selected on the C7 or via the controller The individual message occurrences are sorted by indication priority and alarm messages are listed by first last setting Example of an alarm message page Alarm Message Page 0049 K 11 32 00 11 18 93 QGR 01 Tank press too high 12 7 bar 0049 KQ 11 33 20 11 18 93 QGR 01 Tank press too high 10 3 bar 0010 K 11 34 36 11 18 93 QGR 02
68. of the C7 CPU Loading Erasing the C7 CPU Flash Memory C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 3 1 Controlling with the C7 CPU 3 1 C7 CPU Overview Properties of the The CPU of the C7 626 has the following characteristics Cree e 96 Kbyte work memory e 160 Kbyte integrated load memory RAM e 512 Kbyte integrated flash memory e Integrated IM 360 e Speed approximately 0 3 ms per 1000 binary instructions e Maximum 512 digital I Os connectable e Maximum 128 analog I Os connectable e Back up battery Properties of the The CPU of the C7 626 DP has the following characteristics er 26 DP e 96 Kbyte work memory e 160 Kbyte integrated load RAM memory e 512 Kbyte integrated flash memory e Integrated IM 360 e Speed approximately 0 3 ms per 1000 binary instructions e Free addressing e Additional system status lists for DP e Maximum 1024 digital I Os connectable e Maximum 128 analog I Os connectable e Back up battery C7 626 C7 626 DP Control Systems 3 2 C79000 G7076 C627 01 Controlling with the C7 CPU 3 2 Programming the C7 CPU Overview The user program that controls the process to be visualized on the C7 OP runs on the C7 CPU Required Tools You require the following tools to develop the user program e Programming device PC with multipoint interface and corresponding cable e STEP 7 with the appropriate manuals e C7 Programming Two programming languages are currently relevant to the
69. s 20s Transmission rate 12 MBit s 1 ms 1 2 4 8 16 32 Number of DP slaves Figure 3 6 Overview of the Bus Processing Time on PROFIBUS DP at 1 5 MBit s and 12 MBit s If you operate a PROFIBUS DP network with several masters you must allow for the bus processing time for each master that is Total bus processing time Bus processing time X Number of masters C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Controlling with the C7 CPU 3 9 Test and Reference Data Functions of the C7 CPU Overview The C7 CPU offers the option of scanning the status of the C7 CPU and its associated signal modules by means of a series of test and reference data functions This enables you to obtain information on the following e The current layout of the C7 e The current parameter assignment e The current states e The current sequences in the C7 CPU and the associated signal modules You can also change process variables independently of the user program Description of the The test and reference data functions can only be executed using the STEP 7 Test and Reference software The description of the test and reference data functions can be Data Functions found in the appropriate chapters of the manual 231 List of Test and Table 3 21 contains the reference data functions of the C7 CPU Reference Data Functions Table 3 21 Reference Data Functions of the C7 CPU Reference Data Function Application User memory Displ
70. the C7 CPU The data mailbox contains only the values of the variables their addresses are not transferred When a data record is written the variables are written to the clipboard When a data record is read the variables in the program have first to be written to the clipboard The C7 OP then reads the variables out of the clipboard 8 9 2 Addressing Recipes and Data Records and the Required Data Areas Addressing Data Areas 8 22 Three IDs are available for identifying a recipe on the PLC The IDs can be freely defined We recommend that you enter the same value for the first ID as for the number of the recipe In ProTool you enter the ID of the recipe in the Parameters dialog box against IDs ProTool automatically enters the number of the recipe for the first ID These IDs are written to the data mailbox when a data record is transferred between the C7 OP and the C7 CPU and can be evaluated by the PLC You create data records on the C7 OP under a symbolic name The symbolic name is not transferred with a data record between the C7 OP and the C7 CPU There is no ID for the data record on the C7 CPU C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Data Areas for Communication between the C7 OP and the C7 CPU Data mailbox The area for the data mailbox has to be reserved on the C7 CPU Use the same specifications for it as were set in the configuration under ProTool for Area Pointers The following figure show
71. the FC126 in OB1 Relating actual value to total measuring range L channel relate input value to total range ITD LLL D DTR L RANGE_HEX DTR IR T PERCENT Computing floating point number L upper limit calculate floating point number range L lower limit R L PERCENT L lower limit R T actual value END_FUNCTION An example for calling the FC126 is given in the following Before calling the function block the range limits must be reassigned to memory double words This is necessary to enable using variable values Normally upper limit and lower limit are fixed values This can be achieved by setting the upper limit and lower limit parameters in the declaration section of the FC126 to REAL To enhance flexibility in a test environment this variant has been omitted Sequence of Statements in OB1 ORGANIZATION_BLOCK OB1 var_temp start_info array 0 19 of byte end_var BEGIN L10 0 T MD4 L 10 0 T MDO CALL FC 126 lower limit MDO0 upper limit MD4 channel PIW272 actual value MD8 END_ORGANIZATION_BLOCK C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 4 45 Addressing Assigning Parameters and How the C7 I O Works 4 6 3 Example for Programming Counters Function of Block 4 46 The program is intended to implement a simple function which shows the principle of addressing the counter in
72. universal input frequency meter is automatically started The first valid frequency is calculated after the first measurement period Before the end of the first measurement period the frequency counter value FFFFFFy is available in the C7 CPU Cycle OB1 Startup OB100 Cycle OB1 Cycle OB1 T Valid frequency Time ie gt End of first measurement period Preset 1 lt J e Start of first measurement period Last frequency before STOP mode or FFFFFFy if POWER ON Figure 4 9 Frequency During First Measurement Period C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Addressing Assigning Parameters and How the C7 I O Works Exceeding the Threshold Frequency ZN Resolution of Measurement Disadvantage of Long Measurement Periods Disadvantage of Short Frequency The universal input frequency meter is designed for a maximum frequency of 10 kHz A frequency filter is fitted to the input Warning If the actual frequency exceeds the threshold frequency of 10 kHz then the correct function of the universal inputs can no longer be guaranteed since counter pulses will be lost With relatively constant frequencies the resolution of the measurement is higher if you set a longer measurement period Table 4 22 displays the resulution of the measurement according to the configured measurement period Table 4 22 Resolution of the M
73. 1 SFCs and SFBs in the C7 CPU A 1 SECs and SFBs Overview The C7 CPU provides you with various system functions for example for program processing and diagnostics You call these system functions in your user program with the number of the SFC or SFB You will find detailed descriptions of all system functions in the reference manual 235 Real Time Clock For the clock functions the CPU offers you the following system functions Function SFC Description Execution Time SFC Setting the clock time If the clock to be set is a master clock the clock time synchronization is triggered simultaneously If the clock to be set is a slave clock only the clock time is set SFC Reading the clock time SFC SET_RTM Setting the run time meter In the C7 CPU you can set 1 run time meter SFC CTRL_RTM Starting and stopping the run time meter SFC READ_RTM Reading the run time meter SFC 64 TIME_TICK Reading out the system time 45 us You can read out the system time in milliseconds Block Functions The following table contains system functions for copying and presetting array variables SFC No Name Description Execution Time SFC 20 BLKMOV Copying variables of any type 90 us 2 us byte SFC 21 FILL Setting array default variables 90 us 3 2 us byte C7 626 C7 626 DP Control Systems A 2 C79000 G7076 C627 01 SFCs and SFBs in the C7 CPU Creating a You create a data block using
74. 1 Mr Pereira Linares Rivas 12 14 00 34 81 12 07 51 Fax 00 34 81 12 03 60 30008 Murcia Siemens S A AUT 1 Mr Martinez Marques de los Velez 13 TB 00 34 68 23 36 62 Fax 00 34 68 23 52 36 41092 Sevilla Siemens S A AUT 1 Mr de la Fuente ISLA DE LA CARTUJA Paseo de la Acacias s n Edificio Siemens 00 34 5 4 46 30 00 Fax 00 34 5 4 46 30 46 28760 Tres Cantos Madrid Siemens S A AUT 1 Mr Olaguibel Ronda de Europ T 0034 1 Fax 0034 1 a 5 8 03 12 00 803 2271 46021 Valencia Siemens S A AUT 1 Mr Albors Avda Aragon 30 Ed Europa 0034 6 3 69 94 00 Fax 00 34 6 3 62 61 19 36204 Vigo Siemens S A AUT 1 Mr Garrido Pizarro 29 00 34 86 41 60 33 Fax 0034 86 41 84 64 50012 Zaragoza Siemens S A AUT 1 Mr Aliaga Avda Alcalde Gomez Laguna 9 00 34 76 35 61 50 Fax 00 34 76 56 68 86 Sweden 40020 G teborg Siemens AB ASP Mr Ohlsson Ostergardsgatan 2 4 P O Box 1 41 53 0046 31 7 76 86 53 Fax 00 46 31 7 76 86 76 55111 J nk ping Siemens AB ASP Mr Jonsson Klubbhusgatan 15 P O Box 10 07 0046 36 15 29 00 Fax 00 46 36 16 51 91 20123 Malm Siemens AB ASP Mr J mtgren Grimsbygatan 24 P O Box 326 B 00 46 40 17 46 14 Fax 00 46 40 17 46 17 85122 Sundsvall Siemens AB ASP Mr Sj berg Lagergatan 14 P O Box 766 0046 60 18 56 00 Fax 00 46 60 61 93 44 19487 Upplands Vasby Stockholm Siemens AB ASP A1 Mr Persso
75. 277 PQW280 Activate the new start comparison value Bit 1 of PQB276 PQB279 PQB282 rising edge O gt 1 Set the start bit Bit 1 of PQB276 PQB279 PQB282 rising edge O gt 1 Restart counter without No setting of the new start comparison value counter initialization counter e Start the counter by setting the start bit continues counting without a Bit 0 of PQB276 PQB279 PQB282 reset rising edge 0 1 Select new start comparison Enter new start comparison value value PQW274 PQW277 PQW280 e Set value Bit 1 of PQB276 PQB279 PQB282 rising edge O gt 1 New start comparison value will be activated with the next rising edge at the counter input If counting up running new comparison value will be accepted If counting down running new start value will be accepted current counter value will be corrected by the difference C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Addressing Assigning Parameters and How the C7 I O Works Table 4 20 Controlling Counters with the User Program Initialization of the counter start of a new counting process always occurs Generation of hardware interrupt and resetting of counter Procedure At zero transition counting down or comparison value reached exceeded counting up After setting the enable bit in the data area Bit 0 of PQB276 PQB279 PQB282 rising
76. 44 Information on current operating status 0524H Information on the operating status STOP status specified STARTUP status RUN status 0131H Communication performance Number of connections transmission parameters on the communications rates type specified Test and start up parameters Operator interface parameters Diagnostic functions and diagnostic entries Communications via global data parameters Operator interface time specifications 01324 Communications status information Number and type of connections on the communications type specified Number of test jobs set up Number of current cyclic operator interface tasks Protection levels of the C7 CPU Diagnostic status data Communications via global data Scan cycle time correction factor run time meter date time of day Set transmission rate via the MPI OD91y Module status information of all Features parameters of the module modules in the rack specified plugged in Rack 0 Rack 1 Rack 2 Rack 3 Diagnostic buffer Event information OOA0H All entered event information The information in each case depends 01A0H The x latest information entries on the event Module diagnostics Module rack and Module dependent diagnostic 00B2H Complete module dependent record of slot number information B 6 the module diagnostic information C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 System Status List in the C7 CPU Sublists for PROFIBUS DP Table B 2 The follow
77. 5E6H data The data block for the global data status is not available or too short Programming error OB121 25214 25224 The same priority for example the addressed timer does not exist 25234 25244 as the OB in 2525y 25264 which the error 25274 25284 has occurred 25294 25304 25314 2532H 2533y 2534H 2535p 253A 253Cy 253Eq Error during direct I O access defective or missing module OB122 29444 29454 The same priority as the OB in which the error has occurred OB121 and Please note the following feature of the C7 CPU in connection with OB121 OB122 and OB 122 Note Please note the following feature for OB121 and OB122 The C7 CPU enters the value 0 in the following temporary variables of the variable declaration table in the local data of the OBs e Byte no 4 OB121_BLK_TYPE or OB122_BLK_TYPE type of block where error occurred e Byte nos 8 and 9 OB121_BLK_NUM or OB122_BLK_NUM number of block where error occurred e Byte nos 10 and 11 OB121_PRG_ADDR or OB122_PRG_ADDR address in block where error occurred C7 626 C7 626 DP Control Systems 3 8 C79000 G7076 C627 01 Controlling with the C7 CPU CPU Behavior with If you do not program an error OB the C7 CPU behaves as follows C7 CPU goes to STOP mode with C7 CPU remains in RUN mode with missing missing Missing Error OB C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 time error OB81
78. 6 C7 626 DP Control Systems C79000 G7076 C627 01 4 49 C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 I O Diagnostics Overview Summary of Sections In this section you will learn which diagnostic messages you can select and the layout of the diagnostic buffer The diagnostics of the C7 analog I O are described This chapter contains a statement of how you can correct the reported errors for the most important diagnostic messages of the C7 analog I O with universal inputs The term module refers here to a unit consisting of the C7 analog I O and the universal inputs In Section 5 3 You Will Find Diagnostic Messages Diagnostic Data of the C7 Analog I Os and Universal Inputs Constraints and Responses of the Diagnostic Evaluation C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 5 1 I O Diagnostics 5 1 Diagnostic Messages Overview Advantages Diagnostic Events C7 CPU I O Diagnostics Assign I O Diagnostic Parameters 5 2 The C7 CPU has a diagnostic buffer in which detailed information is provided for all diagnostic events in the order of their occurrence The contents of the diagnostic buffer are preserved even after a complete reset of the C7 CPU The diagnostic entries in the diagnostic buffer can be read and interpreted by the user program Errors in the system can be evaluated after a long time delay using the diagnostic buffer in order
79. 6 C7 626 DP Control Systems C79000 G7076 C627 01 6 17 Operating the C7 General 6 5 4 Contrast and Brightness Adjustment Display Contrast Brightness of the Display Background Illumination 6 18 The following can be adjusted at any time on the C7 during operation e Display contrast e Brightness of the display background illumination Press one of the key combinations shown below simultaneously Higher Lower Higher Lower D lt gt C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Operating the C7 General 6 6 Setting Changing the Operating Mode Overview Normal Operation On Line Normal Operation Off Line Transfer Mode MPI Transfer Setting Changing the Operating Mode During Operation The C7 OP recognizes the following operating modes e Normal operation on line off line e Transfer mode This is the standard operating mode for unrestricted manipulation and visualization of the processes The C7 OP and the C7 CPU exchange data with one another Communication with the controller does not take place in this operating mode Process manipulation and visualization are not possible Entries can still be made on the C7 OP Configuration data can be downloaded from the programming device PC to the C7 OP in transfer mode Entries cannot be made on the C7 OP in this operating mod
80. 7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Glossary STEP 7 STEP 7 Application Substitute Value System Diagnostics System Function SFC System Function Block SFB System Memory System Message T Time Delay Interrupt Time Of Day Interrupt Programming software for creating user programs for SIMATIC S7 programmable controllers A STEP 7 application is a tool of gt STEP 7 which is tailored to a specific task Substitute values are values which are output to the process in the case of faulty signal output modules or which are used in the user program instead of a process variable in the case of faulty signal input modules The substitute values can be specified in advance by the user for example maintain old value System diagnostics comprises the recognition evaluation and signalling of errors which occur within the programmable controller Examples of such errors include program errors or module failures System errors can be indicated via LEDs or via STEP 7 A system function is a function integrated in the operating system of the CPU which can be called in the STEP 7 user program when required A system function block is a function block integrated in the operating system of the C7 CPU which can be called in the STEP 7 user program when required The system memory is integrated in the CPU and executed in the form of RAM The address areas for example timers count
81. 7076 C627 01 Data Areas for Communication between the C7 OP and the C7 CPU 8 4 3 LED Image Data Areas The LED image can be categorized into separate data areas e Maximum number of data areas 8 for example 8 different data areas in various CPUs e Total length of all data areas words 16 LED Assignment The assignment of the individual LEDs to the data area bits is defined during the configuration of the function keys The bit number within the image area is declared for every LED The bit number n denotes the first of two consecutive bits which can control four different LED states in total Bitn 1 Bit n LED Function 0 0 Off 0 1 Flashing at about 2 Hz 1 0 Flashing at about 0 5 Hz 1 1 Continually on C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 8 11 Data Areas for Communication between the C7 OP and the C7 CPU 8 5 Screen Number Area Application Prerequisite Layout 8 12 The C7 OP stores information concerning the C7 OP s called up screen in the screen area number It is thus possible to transfer information about the current display contents from the C7 OP to the C7 CPU and from there to trigger certain reactions for example calling up another screen If the screen number area is to be used it must be declared as an area pointer in the configuration It can only be placed once and in one C7 CPU The screen number area is spontaneously transferred That mean
82. 9 Frankfurt AUT P 25 Hr W Muller R delheimer Landstr 1 3 B 069 7 97 34 18 Fax 0 69 7 97 34 42 79104 Freiburg AUT P Hr Thoma Habsburgerstr 132 B 07 61 27 12 2 38 Fax 07 61 27 12 4 46 20099 Hamburg AUT 1 Hr Rohde Lindenplatz 2 B 0 40 28 89 30 03 Fax 0 40 28 89 32 09 30519 Laatzen Hannover AUT P 10 Fr Hoffmann Hildesheimer Str 7 B 05 11 8 77 23 19 Fax 05 11 8 77 27 39 C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 ZN ZN ZN ZN ZN ZN ZN 74076 Heilbronn AUT P S Hr Gaul Neckarsulmer Str 59 B 07131 1 83 203 Fax 07131 183 3 20 76185 Karlsruhe AUT 14 P Hr Boltz Bannwaldallee 48 B 07 21 9 92 24 13 Fax 07 21 9 92 25 85 34117 Kassel AUT P 13 Hr Uhlig Burgermeister Brunner Str 15 B 05 61 78 86 3 32 Fax 05 61 78 86 4 48 87439 Kempten AUT P Hr Fink Lindauer Str 112 B 0831 58 18 2 25 Fax 08 31 58 18 2 40 24109 Kiel AUT 1 Fr Drews Wittland 2 4 B 04 31 58 60 3 26 Fax 04 31 58 60 2 48 56068 Koblenz AUT P 11 Hr Ricke Frankenstr 21 T 0261 132 2 44 Fax 0261 1 32 2 55 50823 K ln AUT P 14 Hr Prescher Franz Geuer Str 10 B 02 21 5 76 27 62 Fax 02 21 5 76 27 95 AUT P Fr Wiest Fritz Arnold Str 16 B 075 31 988 2 02 Fax 075 31 988 1 40 ZN ZN ZN ZN ZN ZN ZN ZN 04105 Leipzig AUT P 2 Fr Kiesewetter Springerstr 15 B 03 41 2 10 30 07 Fax
83. A AUT R10A Mr Millevoi Viale dell Industria 19 00 39 49 8 29 13 11 Fax 0039 49 8 07 00 09 00142 Roma Siemens S p A AUT R10A Mr Vessio Via Laurentina 455 0039 6 5 00 95 1 Fax 00 39 6 5 00 95 20 10127 Torino Siemens S p A AUT R10A Mr Montoli Via Pio VII 127 B00 39 11 617 3 1 Fax 00 39 11 61 61 35 Luxembourg 1017 Luxemburg Hamm Siemens S A AUT Mr Nockels 20 Rue des Peupliers B P 1701 0 03 52 4 38 43 4 21 Fax 003 52 4 38 43 4 15 Netherlands 2595 AL Den Haag Siemens Nederland N V IPS APS Mr Penris Prinses Beatrixlaan 26 00 31 70 3 33 32 74 Fax 00 31 70 3 33 34 96 Norway 5033 Fyllingsdalen Siemens A S Bergen Mr Troan Bratsbergveien 5 P O Box 36 60 00 47 55 17 67 41 Fax 00 47 55 16 44 70 0518 Oslo 5 Siemens A S AUT Produkter Mr Eggen Ostre Aker vei 90 Postboks 10 Veitvet T 00 47 22 63 34 09 Fax 00 47 22 63 33 90 7004 Trondheim Siemens A S Trondheim Mr Thorsen Spelaugen 22 T 00 47 73 95 96 69 Fax 00 47 73 95 95 04 Poland 40 931 Katowice Siemens Sp 2 0 0 Katowice Branch Office Mr Krzak UL Kosciuszki 30 00 48 3 157 32 66 Fax 00 48 3 157 30 75 60 815 Poznan Siemens Sp Z 0 0 Poznan Branch Office Mr Weiss UI Gajowa 6 00 48 61 47 08 86 Fax 00 48 61 47 08 89 03 821 Warszawa Siemens Sp Z 0 0 Mr Cieslak UL zupnicza 11 00 48 2 6 70 91 47 Fax 00 48 2 6 7091 49 53 332 Wroclaw Siemens Sp z 0 0 Wro
84. AND_TIME format for not equal to Compare STRING STEP 7 provides the following IEC functions for comparing the contents of variables in the STRING data format Name Description Execution Time EQ_STRNG Compare the contents of two variables in the 150 us n X 32 STRING format for equal to GE_STRNG Compare the contents of two variables in the 150 us n X 32 STRING format for greater than or equal to GT_STRNG Compare the contents of two variables in the 140 us n X 38 STRING format for greater than LE_STRNG Compare the contents of two variables in the 150 us n X 32 STRING format for less than or equal to LT_STRNG Compare the contents of two variables in the 140 us n X 38 STRING format for less than NE_STRNG Compare the contents of two variables in the 150 us n X 32 STRING format for not equal to n number of characters C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 A 7 SFCs and SFBs in the C7 CPU STRING Variable STEP 7 provides the following IEC functions for operations with the contents Processing of STRING variables FC Name Description Execution Time No 21 Read the length of a STRING 90 us variable 20 Read the first L characters of a STRING variable 150 us L x 26 32 RIGHT Read the last L characters of a STRING variable 150 us L x 26 26 Read the middle L characters of a STRING variable 150 us L x 26 starting at the defined character
85. Bars A Basic settings parameter block 4 7 4 9 3 16 Bit number Bit triggered trends Blanking circuit Block diagram frequency counter integrated function Blocks Blocks of the C7 CPU 3 6 Buffer overflow 7 14 Buffer overflow switching on off 6 15 Bus processing time PROFIBUS DP network Bus processing time tDP Bus processing times in the PROFIBUS DP network C C7 parameter assignment 3 12 reference functions test functions C7 CPU blocks 3 6 parameters response time scan cycle time term C7 CPU job data record C7 CPU gt C7 OP C 8 data record C7 OP gt C7 CPU C7 CPU operating modes changing 2 10 selecting 2 9 C7 CPU operating modes menu exiting 2 10 C7 I O diagnostics C7 OP 1 1 term C7 OP functions overview C7 OP operating mode C7 OP restart B17 C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Index C7 operation what you require C7 626 CPU characteristics C7 626 DP CPU characteristics C7 CPU flash memory erasing 3 42 loading 3 42 C7 DP CPU address space DP interface DP master C7 CPU modes Calibration measurement 4 14 Cancel key 6 4 CCFL tubes lifespan Channel specific diagnostic byte 5 5 correction factor Clock memory 3 12 parameter block Clocks frequencies period times Communication cycle loadin Communication via the MPI Communications error
86. C7 CPU Overview vost tanta arate ceca tacitaorteiaeen lew saad veo 3 2 Programming the C7 CPU nis cvcercresbaretaewaiaeneenen row eewes 3 3 Performance Characteristics of the C7 CPU 00200ee eee 3 4 C7 CPUIBIONS 1 4seeraisousie neui eniinn Di e n 3 5 DP Interface of the C7 626 DP cece nee eee 3 10 3 6 C7 CPU Parameters 0 0 e eee eee eens 3 6 1 Parameter Block Clock Memory 0000 cece eee eens 3 6 2 Parameter Block Start Up Characteristics 00000e eee 3 6 3 Parameter Block System Diagnostics 2 00ceeeeee eee 3 6 4 Parameter Block Retentive Areas 0 0 cece eee eee 3 6 5 Parameter Block Hardware Interrupts 0 0 e cece eee eee 3 6 6 Parameter Block Real Time Clock 0000 e neces 3 6 7 Parameter Block Time Of Day Interrupts 0000 eee ee eee 3 6 8 Parameter Block Cyclic Interrupts 0 00 eeee neces 3 6 9 Parameter Block Cycle Behavior 0 0000 e cece eens 3 6 10 Parameter Block MPI Addresses 0 0 00 e eects 3 7 Calculating the Scan Cycle Time and Response Time of the C7 CPU 3 7 1 Calculation Example for the Scan Cycle Time 0005 3 7 2 Calculation Example for the Response Time 0008 3 7 3 Hardware Interrupt Response Time 0 cece eee eee eee ee 3 7 4 Diagnostic Interrupt Response Time 0
87. CPU Comparison value CONCAT Configuration error Consistent user data CPU Control and checkback bits Control jobs SIMATIC S7 Control jobs and their parameters Conversion time analog inputs analog outputs Correction factor Count direction setting Counter actual value 4 27 comparison value 4 28 hardware interrupt initializing resetting start value starting stopping threshold frequency universal inputs C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 E Counter edge setting Counter input counter edge frequency counter gate time parameter period time counter Counter inputs parameter block 4 24 Counters counting down counting up 4 27 programming example 4 46 software Counting down Counting up 4 2 Coupling identifier CPU connectable DP slaves consistent user data DP address space 3 4 FCs EC A 6 transmission rates Current measuring range analog I O analog outputs Cursor keys Curves ra Customer specific module Cycle behavior parameter block 3 21 Cycle control 3 29 Cycle loading due to communication B 21 due to self test 3 21 Cyclic interrupt 3 12 3 20 CPU 3 7 parameter block periodicity Cyclic OB Ra 10 D_TOD_DT A 6 Data consistent Data area retentive screen number area system keyboard image 8 9 Data areas trend request area trend transfer area I
88. D UL DWORD RANGE_DEC DWORD RANGE_HEX DWORD PERCENT DWORD end_var BEGIN Case unipolar or bipolar measuring range L lower limit lower limit negative L 0 0 yes gt bipolar measuring range lt R JC bipo L DW 16 0000_0000 funipolar range lower limit TLL JU comp bipo NOP 0 L W 16 9400 bipolar range lower limit ITD TLL Calculating the range hexadecimal comp NOP 0 L W 16 6C00 upper limit for unipolar and bipolar range identical ITD LLL D T RANGE_HEX buffer difference Relating setpoint to total measuring range L upper limit compute range L lower limit R T RANGE_DEC C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 4 41 Addressing Assigning Parameters and How the C7 I O Works L setpoint relate setpoint to total range L lower limit R L RANGE_DEC R T PERCENT Computing hex pattern to be output L RANGE_HEX relate hex value to total range DTR L PERCENT R L LL add offset DTR R RND convert floating point number to 32 bit integer T channel output result Calling the FC127 An example for calling the FC127 is given in the following in OB1 Before calling the function block the range limits and the setpoint must be reassigned to memory double words This is necessary to enable using variable values Normally upper limit and lower limit are fixed values th
89. E Siemens Worldwide ai o0 ches ached atte atte tata dard ar dad and dade E 1 C7 626 C7 626 DP Control Systems vI C79000 G7076 C627 01 Introduction Overview What do you Require to Operate the C7 Summary of Sections This chapter will inform you about the prerequisites for programming the C7 and its functionality as an operator interface device Note The C7 consists of two independent units each with its own processor C7 CPU and C7 OP These components are explicitly named as required You require the following equipment and tools e A programming device or PC with multipoint interface and a programming device cable e STEP 7 applications from version 2 including documentation e The ProTool configuring tool from version 2 10 including documentation e C7 connector set for I O and power supply Operating and Monitoring with C7 C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 1 1 Introduction 1 1 Controlling with C7 Overview C7 CPU Programming Languages The user program which controls the process that is to be visualized by the operator interface part of the C7 runs on the C7 CPU The operation of the C7 CPU is determined by the following functional elements Program Memory This contains the user program Processor The processor executes the program cyclically e At the beginning of the cycle the processor reads the signal states of all inputs and gene
90. Fax 8 86 2 7 05 49 75 Thailand Bangkok 10110 Berli Jucker Co Ltd Mr Narong Berli Jucker House 99 Soi Rubia Sukhumvit 42 Road P O Box 173 BMC Bangkok 1000 T 66 PEREI 11 Fax 66 2 3 67 10 00 Vietnam Hanoi Siemens AG Representation Office Mr Nguyen Huang Gian 18 Phan Boi Chau Stree B 84 4 25 60 61 Fax 84 4 26 62 27 Australia Australia Adelaide Siemens Ltd Adelaide Office CS I A Mr J Weiss 315 Glen Osmond Road Glenunga S A 5064 T 6 3 79 66 66 Fax 61 8 3 79 08 99 Melbourne Siemens Ltd CS I A Mr N Gilholm 544 Church Street Richmond Victoria 3121 T 6 3 4 20 75 20 Fax 61 3 4 20 75 00 Perth Siemens Ltd CS I A Mr A Lostrom 153 Burswood Road Victoria Park W A 6100 61 9 3 62 01 42 9 3 62 01 47 Fax 6 Sydney N S W 2064 Siemens Ltd Sidney Industrial Automation Mr Stephen Coop 383 Pacific Highway Artamon BD 61 2 436 78 04 Fax 61 2 4 36 86 24 New Zealand Greenlane Auckland 5 Siemens Ltd Auckland Office CS I A Mr A Richmond 300 Great South Road P O Box 17 122 T 64 3 5 20 30 33 Fax 64 9 5 20 15 56 C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Glossary A ACCU Accumulator Address Alarm Message Alarm Time Analog I O Area Pointer Assigning Parameters Authorization Input Accumulators are registers in the gt C7 CPU and serve as buffers for load and tr
91. For 32 S7 timers the single update takes 32 X 7 us 0 22 ms The execution time for the S7 timers is calculated as follows 4 04 ms 10 ms x 0 03 ms 0 04 ms Execution time of S7 timers 1 F e Cycle load due to communication 20 The time base is the 11 ms calculated above 20 of this is 2 2 ms e 2nd subtotal The response time not including the delay times of the inputs and outputs is calculated from the total of 11 ms Result of the first subtotal 0 5 ms Execution time for S7 timers 2 2 ms Cycle load due to communication 13 7 ms 14 ms e Input and output delay times The digital input SM321 DI 16 x 24 VDC has an input delay of max 4 8 ms per channel The delay time of the digital output of the C7 can be neglected The analog input of the C7 has a resolution of 12 bits The conversion time per channel is approximately 0 5 ms All four channels are supposed to be active Calibration measurement must be enabled The cycle time is thus 2 5 ms The analog output of the C7 has a conversion time of 0 8 ms per channel A settling time for the ohmic load of 0 1 ms must be added to this This yields a response time for the analog output of 0 9 ms e Response times with delay times of the inputs and outputs e Case 1 An output channel is enabled when a digital input signal is read in The response time is Response time 4 8 ms 5 ms 9 8 ms 10 ms e Case 2 An analog value is read in and
92. If an SDBO is available in the integrated flash memory then the stored parameters will be loaded with the exception of the MPI parameters If no SDBO is present in the flash memory then the standard parameters of SDB2 will be set Caution If after the last storage of the program in the flash memory of the C7 additional parameters are modified in the RAM these will be lost the next time the memory is reset with the exception of the MPI parameters C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Controlling with the C7 CPU 3 6 1 Parameter Block Clock Memory Definition Clock Clock memories are memories which periodically change their binary states Memory at regular intervals in a pulse pause ratio 1 1 Eight fixed frequencies are defined for the C7 these can be allocated to any memory byte The period time can be found in Figure 3 1 Clock Period Time Figure 3 1 shows the period times and the corresponding clock frequencies generated by the clock memory byte Clock memory byte Period time and corresponding frequency Bit 76543210 0 1 seconds corresponding to 10 Hz 0 2 seconds corresponding to 5 Hz lamp flicker 0 4 seconds corresponding to 2 5 Hz fast lamp flash 0 5 seconds corresponding to 2 Hz 0 8 seconds corresponding to 1 25 Hz lamp flash 1 0 seconds corresponding to 1 Hz 1 6 seconds corresponding to 0 625 Hz slow lamp flash 2 seconds cor
93. Oil feed stopped 0010 KQ 11 35 18 11 18 93 QGR 02 bil feed stopped Message status Process value Acknowledgement group K arrived at time of arrival Q acknowledged Time and date of arrival Message number If all messages do not fit on the display at the same time you can scroll the contents of the message page up down with the cursor keys C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 7 11 Standard O I Functions To Message Buffer and Back Message Logging 7 12 The message page contains the following information for each message occurrence Message number Message status with date and time The C7 updates the message status display for example K for arriving Q for acknowledged Acknowledgement group to which an alarm message belongs Message text with process values if applicable When a message contains process values the C7 indicates these values as they were when the state occurred or stopped occurring that is time of arrival or time of departure The C7 does not acquire current process values after the message has been acknowledged You can switch back and forth between indication of the message page and the message buffer by repeatedly pressing the function key which you used to call the alarm message page event message page All message occurrences are logged directly on a printer if message logging is switched on and a printer is connected C7 626 C7 626 DP
94. PU The event that called the OB40 is stored in the start up information declaration section of the OB40 You must evaluate the additional information Z1 to Z3 in the start up information The entries in the declaration section of OB40 can be found in Table 4 19 The bytes that are relevant to the user are hatched in the table Table 4 19 Declaration section of OB40 Meaning Priority class Data identifier Z2 3 Additional information Z1 Meaning Byte Event number Current OB number Data identifier Z1 Additional information Z2 oO rN NW w Additional information Z3 Time stamp of event The start address of the C7 I O module is contained in the additional information Z1 bytes 6 7 Address 272 or 0110 or address with assigned parameters C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 4 25 Addressing Assigning Parameters and How the C7 I O Works Additional The serial number of the universal inputs that triggered the hardware Information Z2 interrupt can be found in byte 8 of the additional information Z2 Byte 9 is irrelevant You can find the additional information broken down into bits in Figure 4 7 Byte 8 76543210 0 0 0 0 L 0 0 0 0 14 1 when universal input 1 has triggered hardware interrupt 1 when universal input 2 has triggered hardware interrupt 1 when universal input 3 has tr
95. Period time counter Hardware interrupt 0 No 1 Yes always with interrupt DI selectable if use 2 Edge 0 Rising edge 1 Falling edge only if use 1 or 2 Direction 0 Up 1 Down if use 2 Gate time 0 0 1s l s 2 10s if use 3 Use 0 Disable normal DI 1 Interrupt DI Hardware interrupt 0 No always when deactivated 1 Yes always with interrupt DI selectable if use 2 Edge 0 Rising edge 1 Falling edge only if not deactivated Scan cycle time 0 16 ms 1 continuous approx 2 5 ms 6 3 ms 7 3 5 ms 8 4 ms 0 5 ms increments All Measurement type 0 Deactivated 1 Voltage 2 Current End of cycle interrupt 0 No 1 Yes only if Byte 4 lt gt 1 Measuring range 0 Deactivated 3 4 20 mA 4 20 mA if measurement type current 9 10 V if measurement type voltage Measurement type 0 Deactivated 1 Voltage 2 Current End of cycle interrupt 0 No 1 Yes only if Byte 4 lt gt 1 Measuring range 0 Deactivated 3 4 20 mA 4 20 mA if measurement type current 9 10 V if measurement type voltage Measurement type 0 Deactivated 1 Voltage 2 Current End of cycle interrupt 0 No 1 Yes only if Byte 4 lt gt 1 Measuring range 0 Deactivated 3 4 20 mA 4 20 mA if measurement type current 9 10 V if measurement type voltage C7 626 C7 626 DP Control Systems 4 38 C79000 G7076 C627 01 Addressing Assigning Parameters and How the C7 I O Works
96. Refer to the grouping External error in Table 5 3 Refer to the grouping External error in Table 5 3 Refer to the grouping Channel in Table 5 3 5 9 I O Diagnostics Table 5 4 Reason for the Diagnostic Message Source of Error Diagnostic Messages and Possible Responses Response of the Module Possible Elimination Wire break Precondition An error counter will be Check the connection of the The measurement range incremented If the error appropriate measurement 0 20 mA has been set for counter reaches a fixed value channel the channel of 3 then the error wire If a wire break check has break is reported been assigned then the error is identified by evaluation of the input current of the analog input channel lt 1 6 mA Overflow The error is identified after The bit is set and reset again Check the connection of the the comparison of the when the measurement appropriate input channel or measured value including decreases transducer correction calculation Measurement gt overflow range Underflow The error is identified after The bit is set and reset again Check the connection of the the comparison of the when the measurement appropriate input channel or measured value including becomes valid transducer correction calculation Measurement gt neg overflow range That is lt 0 mA for 4 20 mA Incorrect The error is identified after The measureme
97. SIEMENS SIMATIC C7 626 C7 626 DP Control Systems Volume 2 Working with C7 Manual C79000 G7076 C627 01 Contents User Information Introduction N Commissioning Startup Controlling with the C7 CPU Addressing Assigning Parameters and How the C7 I O Works o oO A I O Diagnostics Operating and Monitoring Operating the C7 General 6 Standard O I Functions 7 Data Areas for Communication between the C7 OP and the C7 CPU Appendices SFCs and SFBs in the C7 CPU A System Status List in the C7 CPU B C7 OP Functionality Standard C Screens Control Jobs System Messages SIMATIC C7 and S7 D Literature List Siemens Worldwide E Glossary Index Safety Guidelines ZN AX Ax Qualified Personnel Correct Usage A Trademarks This manual contains notices which you should observe to ensure your own personal safety as well as to protect the product and connected equipment These notices are highlighted in the manual by a warning triangle and are marked as follows according to the level of danger Danger indicates thatdeath severe personal injury or substantial property damage will resultif proper precautions are not taken Warning indicates thatdeath severe personal injury orsubstantial property damage can resultif proper precautions are not taken Caution indicates that minor personal injury or property damage can r
98. STOP mode After the C7 OP has been started up the following standard screen is displayed 399 Startup complete Basic C7 626 picture Softkey mm Ne icons for g E A WZ H PE selecting standard O 4 screens Figure 2 2 Basic C7 Picture Example 4 The start up message displayed can be confirmed by pressing ESC Load Control The C7 OP must access data in the C7 CPU in order to operate and monitor Program the process Therefore the user program must first be loaded if this has not already been done Load the user program as follows 1 Transfer the user program and the data blocks on your programming device PC using STEP 7 2 Set the C7 CPU to STOP mode se Section 2 5 3 Start the copy procedure from the programming device PC C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 2 3 Commissioning Startup 2 3 Without a Loaded Configuration in the C7 OP Overview Loading the Configuration 2 4 There is no configuration loaded on startup This must however be loaded in order to operate the C7 OP otherwise the operating function C7 CPU Operating Mode Selection will not be available You can only set the C7 CPU operating modes RUN P RUN STOP and MRES on the C7 if a configuration is loaded No
99. Screen selection Parameter 1 n 7 Screen number 1 255 Parameter 2 Parameter 3 Field number 1 255 Output fields are not taken into account with the running number 69 Transfer recipe data record to C7 OP Parameter 1 Key word 1 Parameter 2 Key word 2 Parameter 3 Key word 3 70 Transfer recipe data record from C7 OP to C7 CPU Parameter 1 Key word 1 Parameter 2 Key word 2 Parameter 3 Key word 3 72 Cursor positioning in current process image or current recipe Parameter 1 Parameter 2 Field number 1 255 Parameter 3 C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 C7 OP Functionality Standard Screens Control Jobs System Messages C 3 System Messages Overview This section provides an overview of the most important system messages with their causes and the action required to remedy the errors Language System messages are displayed in the language selected during the configuration If there are no configuration data in the C7 messages will always be displayed in English Message Number System messages on the C7 can be placed in different categories Information on the category to which a system message belongs is contained in the message number Message number Message text a Driver error Startup message Warning Note Operating error Other message Configuration error Internal error NQOof WDM O Message Category The message category gives you a rou
100. Soldan Avda N Arriola 385 4to Piso B 51 14 71 46 61 Fax 51 14 71 09 93 USA Alpharetta GA 30202 SIA Inc Regional Sales Manager Southeast Mr Mich Gunyon Technology Drive B 1 404 7 40 36 60 Fax 1 4 04 7 40 36 96 Andover MA 01810 SIA Inc North East Region Mr Mark Fondl One Tech Drive Suite 310 T 4 2 88 8 88 88 72 Fax 1 6 08 6 86 88 72 Houston TX 77040 SIA Inc SouthWest Region Mr Wade Bradford 13100 Northwest Freeway Suite 210 B 1 713 690033 Fax 1 713 4 60 44 50 Mason OH 45040 9011 SIA Inc Central Region Mr_ Luther Crouthamel 4770 Duke Drive suite 381 T 4 g BEREE 5 13 3 98 98 39 Fax Mukilteo WA 98275 SIA Inc MidwWest Region Mr Earl Haas 8412 54th Avenue West B 1 714 979 66 00 Fax 1 7 14 5 57 90 61 Plymouth MN 55442 SIA Inc MidWest Region Mr Greg Jaster 13235 45th Avenue No 1 7 08 6 40 1595 Fax 1 7 08 6 40 80 26 Venezuela 1071 Caracas Siemens S A AUT ASI Mr Jesus Cavada Avda Don Diego Cisneros Urbanizacion Los Ruices 3616 Caracas 1010 A 58 6 2 39 07 33 Fax 58 2 2 03 82 00 Asia China 510064 Guangzhou Siemens Ltd China Guangzhou Office Mr Peter Chen Room 1134 1157 GARDEN Hotel Garden Tower 368 Huanshi Dong Lu T 86 20 3 85 46 88 Fax 86 20 3 34 74 54 100015 Belling Siemens Ltd China Beijing Office Mr Wolfgang S llner 7 Wangling Zhonghuan Nan Lu Chaoyang
101. Sublist Operating system areas Block types All records of the sublist One record depending on the index Loadable SDBs SDB Number Record Contents Sublist Excerpt Process image of the inputs number in bytes Process image of the outputs number in bytes Number of memory bits Number of timers Number of counters Size of the I O address area Entire local data area of the C7 CPU in bytes OBs Number and size DBs Number and size SDBs Number and size FCs Number and size FBs Number and size Rack information All records of the sublist One record depending on the index Interrupt error assignment via number of assigned OBs Records of all possible interrupts Records of all assigned interrupts Interrupt status Record for the specified interrupt Priority class 00234 Records for all priority classes 00004 Only sublist header information Interrupt class of free cycle Interrupt class of asynchronous interrupts Priority of possible OBs C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 B 5 System Status List in the C7 CPU Table B 1 Sublists of the System Status List of the C7 CPU SZL_ID Sublist Index Record Contents ID of the Sublist Excerpt Individual Records of the Sublist Operating statuses of the C7 CPU 00244 Information on all stored operating status transitions 01244 Information on the last executed operating status transition 042
102. System Diagnostics Diagnostic events include errors in a digital function in the C7 system faults in the C7 caused for example by programming errors or operating mode transitions Diagnostic functions comprise the complete scope of system diagnostics and the detection evaluation and signalling of faults within the C7 Modules with diagnostics capability signal system errors to the C7 CPU by means of diagnostic interrupts Representation of logically related process data for display and modification in the C7 either in groups or individually Interval between the arrival and departure of an event message Element of a display It consists of the entry number text and variables Function that causes a change in the display contents for example display of message level or display of error message buffer Processing level of the C7 at which displays can be monitored and operated C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Glossary Error Display Error Response Event Message FB FC Fields Flash EPROM Forced Printout Function FC The error display is one of the possible responses of the operating system to a run time error The other possible responses are Error Response in the user program STOP mode of the C7 CPU Response to a run time error The operating system can react in the following ways the C7 CPU changes to STOP mode an organization block is called in which the us
103. U C7 OP C7 OP C7 CPU Transfer data records Data medium C7 OP C7 OP data medium Parameter records Yes Print functions Hardcopy of the contents of the display Character mode ASCII Yes Graphic mode Yes Direct message logging Yes Screen printout in character mode Yes ASCII Online language switchover Number of languages 3 PG functions For SIMATIC S7 Yes Status force variable Display Setting for display brightness Yes contrast Blanking circuit Yes C 4 C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 C7 OP Functionality Standard Screens Control Jobs System Messages C 2 Control Jobs and Their Parameters Overview Control jobs can be used to trigger functions from the user program in the C7 OP Examples of these functions are as follows Display screen Set date and time Modify general settings A control job consists of four data words The first data word contains the job number Depending on the function up to three parameters are transferred in data words 2 to 4 Figure C 1 shows the general structure of a control job Address Most significant byte MSB Least significant byte LSB 1st word 0 Job no 2nd word Parameter 1 3rd word Parameter 2 4th word Parameter 3 Figure C 1 Structure of a Control Job Note Please refer to Section 8 8 for information on any provisions to be made in the interface
104. a symbolic field 24 The current field text is not configured for a symbolic field 25 Invalid data format for a symbolic field only KF and KY are permitted 26 Recipe setpoint configured with Char data format 33 Invalid data format for setpoint field 35 Data format for the scheduler is too short 36 Invalid data format for actual control value 44 For fixed cross jump to menu menu item does not exist 45 For fixed cross jump to screen entry or field number does not exist 46 Too many current control values on screen maximum of 200 permitted 48 Too many fields on process screen 50 Process connection for softkeys does not exist 51 Softkey number too high 53 Information text for softkey not configured or not in all languages 55 Softkey specified in entry does not exist C 21 C7 OP Functionality Standard Screens Control Jobs System Messages Message Cause Remedy 636 Initiated event messages no x not configured Add to configuration and repeat 637 download 638 The actual value field for event message no x is available 639 in symbolic form only 640 Initiated alarm messages no x not configured Add to configuration and repeat 641 download 642 The actual value field for alarm message no x is 643 available in symbolic form only 645 Internal errors 649 650 Area pointer for function you used not configured Configured area pointer 651 Internal error 653 Configure
105. a word to zero For this reason the parameters must first be entered in the job area and only then the job number The possible control jobs are listed with job numbers and parameters in Appendix C 2 Byte n 13 The C7 OP enters the coupling identifier in byte 13 Time byte n 15 to n 17 Date byte n 21 to n 24 The date and time can be transferred from the C7 OP to the C7 CPU via control job 41 The following screens show the layout of the data area All inputs are coded in Binary Coded Decimal BCD Time Address 7 0 n 15 Hours 0 23 n 16 Minutes 0 59 n 17 Seconds 0 59 Date Address 7 0 n 21 Weekday 1 7 n 22 Day 1 31 n 23 Month 1 12 n 24 Year 0 99 C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 8 19 Data Areas for Communication between the C7 OP and the C7 CPU 8 8 3 Example for Activating a Control Job Control Job Procedure for activating a control job Procedure 1 You must configure the interface module which contains the interface area in the C7 CPU example DB52 2 You enter the interface module 52 into the Area Pointers dialog box during the configuration The interface module is thus made known to the C7 OP 3 The job is entered in the interface module via the C7 CPU program see Figure 8 6 4 The C7 OP reads the interface module and executes the job Program for Screen Selection OPN DB 52 Call i
106. addresses result You can see that for the analog I O the analog input channel and the analog output channel are addressed starting from the same address i View of right hand side of C7 Analog inputs hannel 0 Address PIW272 I Alt l C Al1 M A s 28 A Al2 U i ce o Al2 1 Channel 1 Address PIW274 28 o Al2 M i 2 e o AI3 U Se o AI3 I Channel 2 Address PIW276 o Al3 M o Al4 U l o Al4 Channel 3 Address PIW278 e Al4 M o Mana Analog output el AO U Soa i _ Channel 0 Address PQW272 o AO MJ ETT gt o Default addresses eo j Inputs with this shading are i not relevant to this example Pin number Figure 4 3 Analog I O Addresses C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 4 5 Addressing Assigning Parameters and How the C7 I O Works 4 3 2 Assigning Parameters to the Analog I Os Introduction Parameter Assignment Assigning Parameters for Characteristics 4 6 This chapter contains an overview of the analog I O and their parameters You set the parameters for the analog I O using the STEP 7 function Hardware Configuration A parameter block is generated that contains all the currently selected I O parameters After loading this parameter block the parameters are not immediately transferred to the analog I O The C7 CPU then transfers the parameters to the respective analog I O after every mode change
107. age appears if you make a wrong entry for example data format does not agree with data type entered The first entry from the pop up window is then accepted by default in the field When this softkey is pressed status processing is switched to Update running The values of the addresses are then shown in the last column The values are updated cyclically When this softkey is pressed again status processing returns to Status stop C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 7 31 Standard O I Functions Force Variable In addition to the functions of Status Variable values of addresses can be Standard Screen modified controlled with Force Variable You have to configure the Force Variable standard screen in ProTool you select it by means of a function key On the C7 OP the display is split into two lines Force Variable 12 DB DBB 100 10 BIN 00000000 00000000 1 222222 0 22222222 0 1 22222 0 222222222 0 1 222222 0 222222222 0 1 22222 0 222222222 0 bal Status ESC Force entry Force Input Start Start Stop update Return to the main screen Figure 7 10 Force Variable Screen of C7 OP and SIMATIC S7 C7 626 C7 626 DP Control Systems 7 32 C79000 G7076 C627 01 Standard O I Functions Operating Procedure for controlling address values Procedure for FORCE VAR Step Key Description Softkey
108. all From 1 to 65 000 modules after power on If the modules do not transmit a ready message to the C7 CPU within this time then the C7 CPU reverts to STOP You should assign the highest values to the parameters for the module time limits if you are not sure of the required times in the C7 C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Controlling with the C7 CPU 3 6 3 Parameter Block System Diagnostics Definition System diagnostics perform the acquisition evaluation and reporting of an System error within the programmable controller The wiring to the process is also Diagnostics included in the system diagnostics so that for example wire breaks can be recognized by the system diagnostics Example Examples of errors that can be identified evaluated and reported by the system diagnostics are e Errors in the user program e Failure of hardware modules e Breaks in wiring to transducers Parameter Block Table 3 10 lists the parameters of the parameter block System Diagnostics System Diagnostics Table 3 10 Parameter Block System Diagnostics Extended diagnostic For Extended diagnostics buffer entries yes buffer entries the C7 CPU enters not only the error events into the diagnostic buffer but also all OB calls Value Range Default Setting For Transmission of diagnostics messages Yes No Yes yes the C7 CPU transmits the
109. ample STEP 7 access error it calls the organization block error OB designated for this particular case in which the behavior of the C7 CPU can be established The user memory contains logic blocks and data blocks of the user program The user memory is integrated in the C7 CPU as flash memory In general however the user program is executed from the gt work memory of the C7 CPU The user program contains all the statements and declarations and the data required for signal processing to control a plant or a process The program is linked to a programmable module for example C7 CPU FM and can be structured in the form of smaller units blocks The work memory is a RAM in the gt C7 which the processor accesses while executing the program C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Index A Acknowledgement 8 5 area bit 8 6 Acknowledgement groups Acknowledgement key Acknowledgement procedure 8 6 Acknowledging alarm messages Actual value of counter calculating AD_DT_TM Additional information Address assignment customer specific module 4 2 free signal modules 4 2 Address space C7 DP CPU 3 11 Addresses analog I O universal in puts 4 19 Addressing recipe and data records 8 22 Addressing recipes and data records Alarm acknowledgement number Alarm message representing Alarm message area bit set Alarm message buffer deleting
110. an analog value is output The response time is Response time 2 5 ms 5 ms 0 9 ms 3 9 ms 4 ms C7 626 C7 626 DP Control Systems 3 32 C79000 G7076 C627 01 Controlling with the C7 CPU 3 7 3 Hardware Interrupt Response Time Hardware Interrupt Response Time Calculation C7 CPU Signal Modules Interrupt Handling Calculation Example The hardware interrupt response time is the time that elapses between the first occurrence of a hardware interrupt signal and the calling of the first instruction in the hardware interrupt OB OB40 In general higher priority interrupts take precedence That means the hardware interrupt response time is increased by the program execution time of the higher priority hardware interrupt OBs and hardware interrupt OBs of the same priority which have not yet been processed The hardware interrupt response time is calculated as follows Hardware interrupt response time hardware interrupt response time of the C7 CPU hardware interrupt response time of the signal module The hardware interrupt response time of the C7 CPU is approx 1 1 ms The hardware interrupt response time of the signal modules is calculated as follows e Digital input modules Hardware interrupt response time Internal interrupt preparation time input delay The times are listed in the data sheet for the respective digital input module e Analog input modules Hardware interrupt response time Interna
111. an be calculated as follows e 1x process input image transfer time e 1x operating system execution time e 1x program execution time e 1x process output image transfer time e Processing time for S7 timers e Input and output delay times The input delays are not marked in the diagram Depending on the module however you have to take into account the following delay times e For digital inputs input delay time e For digital outputs negligible delay times e For analog inputs scan cycle time of the analog input e For analog outputs response time of the analog output C7 626 C7 626 DP Control Systems 3 26 C79000 G7076 C627 01 Controlling with the C7 CPU Longest Response Figure 3 4 illustrates the conditions for the longest response time Time eae _____ i Bus processing times in the i PROFIBUS DP network PIQ A Oe ee Ne pee Ve oe A i PII The state of the observed input changes i while it is being read by the PII The change i in the input signal will not appear in the PII Operating system User program eee eee PQ o a 9 i PII The change in the input signal is S written into the PII al i n 1 al Operating system i User program The change in the input signal will be processed here by the user program PIO The response of the user program to the Change in the input sig
112. and double word The bit memory area can be used to by the user to store interim results The C7 620 control system integrates an S7 300 CPU a COROS OP the I O and an IM 360 interface module in one single unit The C7 CPU is a central processing unit of the C7 range complete with processor arithmetic unit memory operating system and interfaces for programming devices The C7 CPU is independent of the gt C7 OP The C7 CPU has its own MPI address and is connected to the C7 OP via the MPI multipoint interface The C7 I O signal module forms the interface between the process and the programmable controller There are digital input and outputs as well as analog inputs and outputs The integral universal inputs have special functions in the C7 interrupt counter inputs The C7 OP handles the OP functions of the C7 control system It is independent of the gt C7 CPU and continues to operate for example if the C7 CPU enters the STOP mode The C7 OP has its own MPI address and is connected to the C7 CPU via this interface It is via the MPI that the C7 OP is connected to a configuring computer programming device PC Communications Processor Communication processors are intelligent modules with their own processor They form an important group within the components of a programmable controller A distinction can be made between various types of communications processors according to their tasks For example CPs for mes
113. ansfer operations as well as for comparison math and conversion operations An address includes the address identifier and the physical memory location where the address is stored It points out particularly critical operating states An alarm message always requires an acknowledgement Interval between the arrival and departure of an alarm message The analog I O converts analog process values for example temperature into digital values that can be processed by the C7 CPU or converts digital values into analog manipulated variables The area pointer is necessary for exchanging data between the operator panel section and the controller section of the C7 It includes information on the location and size of data areas in the controller Assigning parameters means setting the operating characteristics of a module External access point to superuser password level C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Glossary 1 Glossary Back Up Memory Bit Memory C7 620 C7 CPU C7 I O C7 OP CP Communications Processor CP Glossary 2 The back up memory backs up memory areas of the C7 without the need for a back up battery The memory backs up a programmable number of timers counters bit memory and data bytes the retentive timers counters bit memory and data bytes A memory area in the system memory of the CPU This area can be accessed using write or read access bit byte word
114. ardware interrupt OB40 11414 16 Behavior of the C7 The C7 CPU reverts to STOP if a CPU with Missing OB Time of day interrupt e Time delay interrupt e Hardware interrupt e Diagnostic interrupt occurs but the corresponding OB has not been programmed The C7 CPU does not revert to STOP if a cyclic interrupt occurs and OB35 has not been programmed OB for Error Table 3 5 lists the OBs which determine the behavior of the C7 CPU in an Responses error situation The C7 CPU reverts to STOP if an error occurs but the corresponding OB has not been programmed Table 3 5 List of OBs Error Activated OB Possible Start Preset Priority of Events the OB Time error 35014 35024 26 for example initiated by the scan cycle time monitor 35054 3507H Power supply error 38224 39224 26 for example missing back up battery One of the following errors has occurred 35Al1 p 39Bly 26 e Event that triggers OB start for example time delay 39B2y interrupt has occurred but the relevant OB cannot be executed Error during update of the process image Failure return of a node in the PROFIBUS DP network 38Ely 39E2y 26 C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 3 7 Controlling with the C7 CPU Table 3 5 List of OBs continued Error Activated OB Possible Start Preset Priority of Events the OB Communications error OB87 35Elq 35E2q 26 e Wrong message frame identifier when receiving global 3
115. are interrupt response time elapses from the time a signal is present at the digital input until the first instruction in OB40 is processed C7 626 C7 626 DP Control Systems 3 34 C79000 G7076 C627 01 Controlling with the C7 CPU 3 7 4 Diagnostic Interrupt Response Time Diagnostic Interrupt Response Time Calculation C7 CPU Calculation Example The diagnostic interrupt response time is the time that elapses between the first occurrence of a diagnostic interrupt signal and the calling of the first instruction in the diagnostic interrupt OB OB82 In general higher priority interrupts take precedence That means the diagnostic interrupt response time is increased by the program execution time of the higher priority interrupt OBs and interrupt OBs of the same priority which have not yet been processed The diagnostic interrupt response time is calculated as follows Diagnostic interrupt response time Diagnostic interrupt response time of the C7 CPU diagnostic interrupt response time of the signal module For C7 0 6 ms The diagnostic interrupt response time of the C7 CPU is approximately 1 3 ms 1 3ms 0 6ms 1 9ms 2 ms C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 3 35 Controlling with the C7 CPU 3 8 Bus Processing Times in the PROFIBUS DP Network Introduction In a PROFIBUS DP network the response times are composed of several components e The response time of the DP master e T
116. ating the S7 timers Transfer mode User data area optimization Transferring data records User data areas direct functionality 8 3 indirect writing variables indirectly Transmission parameters printer User data consistent CPU Transmission rates CPU User program execution time Trend request area User version Trend transfer area Trends 8 13 bit triggered V time triggered Type of measurement Variables write indirectly 8 26 Voltage measuring range analog I O U analog outputs Voltage current measuring ranges Universal inputs 3 4 Voltage current output ranges addressing counter W ene a Window operation DP addresses Windows function dynamic selecting hardware interrupt interrupt inputs parameter block programming example 4 40 switching between Wire break Wire break check 4 19 2 U aes Work memory p counter C7 626 C7 626 DP Control Systems Index 12 C79000 G7076 C627 01 Q ox Siemens AG AUT E 146 Ostliche Rheinbriickenstr 50 D 76181 Karlsruhe Federal Republic of Germany From Your Name Your Title Company Name Street City Zip Code Country Phone Please check any industry that applies to you O Automotive O Pharmaceutical O Chemical O Plastic O Electrical Machinery Pulp and Paper O Food O Textiles O Instrument and Control Transportation O Nonelectrical Machinery O
117. ator or the controller on Confirm indicated alarm message 2 ACK After acknowledgement the next unacknowledged message if one exists is then displayed You can combine messages into acknowledgement groups When the indicated message belongs to an acknowledgement group its acknowledgement automatically acknowledges all other alarm messages of this acknowledgement group C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Standard O I Functions 7 2 3 Message Line Flashing Alarm Messages Indication Priorities Message Window Current Messages The message line is always present regardless of which screen is selected Depending on your configuration event messages and or alarm messages are displayed in the message line Example of an event message Mixing procedure finished wakes skin iinabsieg SOOO I Process value at the time of arrival Alarm messages flash to distinguish them from event messages Alarm messages always take precedence Alarm messages over event messages Event messages Standby message Event messages are not indicated unless no more alarm messages are queued and all have been acknowledged A standby message is indicated when no event messages are queued In addition to the message text messages in a message window contain other information for example message number and date time of the arrival
118. ay of the current loading of the e Constant memory EEPROM integrated into the C7 e Load memory of the C7 CPU RAM e Work memory of the C7 CPU RAM Blocks Display of all available blocks and the possible priority classes e SFCs system functions e SFBs system function blocks e OBs organization blocks e All blocks Stacks Read out the contents of B stack block stack e I stack interrupt stack e L stack local data stack C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 3 39 Controlling with the C7 CPU Table 3 21 Reference Data Functions of the C7 CPU Reference Data Function Application Communication Display of Number of links Message frame length Transmission rate via the MPI Reserved OP links Reserved programming device links Free links Time system Display of following values C7 time C7 date Time system Correction factor Cycle of the synchronization frames Scan cycle times Display of the scan cycle times of the user program Monitoring time Length of the longest cycle Length of the shortest cycle Length of the last cycle Display diagnostic buffer Display of the contents of the diagnostic buffer e Date and time of a diagnostic event e Number of the diagnostic event e Information describing the diagnostic event more exactly for example OB call for access errors C7 CPU data Display of the following C7 information e C7 type and version of the C7 CPU e Size of the work and l
119. be able to identify the cause of for example a STOP or to trace and sort the occurrence of individual diagnostic events Diagnostic events are for example e Errors in an I O module e System errors in the C7 CPU e Change of operating modes for example from RUN to STOP e Program errors in the CPU program The I O diagnostics are divided into two groups e Standard diagnostics general malfunction of the C7 analog I O module and universal inputs e Module specific diagnostics The standard diagnostics are always entered in the diagnostic buffer of the C7 CPU after the occurrence of a diagnostic interrupt The precondition is an assigned module diagnostic The module specific diagnostics provide detailed information regarding the type and possible cause of the error This information can be called up by the user program by means of special system calls The precondition is the assignment of a diagnostic enable default setting is always no in this case You can select whether the analog I O diagnostic messages should be generated using STEP 7 Using the STEP 7 application Hardware Configuration you can also assign parameters to the diagnostic behavior of the analog I O that is you select whether the analog I O diagnostic messages should be sent to the C7 CPU on request Furthermore you can assign parameters to define whether the module should trigger a diagnostic interrupt in the C7 CPU after the occurrence of an e
120. ber greater than 15 11 DB length greater than 1024 12 DW is not in data block header 13 Area located in wrong DB 14 Sum of data blocks too high 670 Too many variables were requested simultaneously Remedy Configure a longer basic clock fewer variables in the screen 681 The link between OP and controller is disturbed The interface parameters are possibly set incorrectly 682 Configure fewer process links for the screen currently displayed C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 C 23 C7 OP Functionality Standard Screens Control Jobs System Messages Message Cause Remedy 702 Internal error actual value error 703 Internal error job faulty Limit configuration 704 Flash memory full 705 Internal error S7 error 706 Internal error unknown message acknowledged 7xx Internal errors C 3 1 Internal Errors Procedure The field numbers from 700 onwards and some errors defined in previous sections are used to describe internal errors of the C7 control systems or the ProTool configuring tool Please proceed step by step as described below if an internal error occurs e Set the C7 CPU to STOP mode Switch off the C7 and then restart it e Set the C7 OP to transfer mode during startup Transfer the configuration again and restart the C7 e Should the error occur again contact the Siemens regional office in your vicinity Specify the
121. bet can be entered in a string field Strings may also contain blanks The cursor changes shape in input mode The entry starts at the left edge of the input field The cursor jumps one position to the right each time a character is entered Entry To make entries in a string field proceed as follows Key Enter digits Description If necessary switch back from alpha mode Enter letters Confirm entry or Cancel entry C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Switch to alpha mode The entered string becomes valid e Switch back from alpha mode e The input cursor is deleted e Switch back from alpha mode e The old string becomes valid again 6 9 Operating the C7 General Correcting Entries If you have made a mistake and have not yet confirmed the entry proceed as follows IF THEN Position the cursor on the character and Wrong character lt gt overwrite The cursor jumps one position to the right after the overwrite One character too Delete the character at the cursor position many peL and consolidate the input from the right O O F 1 Switch to alpha mode One character too few 2 Insert a blank where the cursor is DEL positioned and shifts the entry to the right starting at the cursor position 3 Overwrite blank
122. blist You use the ID for the sublist excerpt to select the extent of the sublist to be Excerpt output On The complete sublist is output e lytoEg A special sublist is output e Fu Only header information is output Index You must assign an index if you want to read out only one specific record from the sublist Length of the This data word shows how much information in bytes a record of the sublist Subsequent contains Records Number of This data word shows how many records the transferred sublist contains Records Table of Sublists Table B 1 below shows the individual sublists of the system status list with the entries relevant for the individual C7 CPUs Table B 1 Sublists of the System Status List of the C7 CPU SZL_ID Sublist Index Record Contents ID of the Sublist Excerpt Individual Records of the Sublist C7 CPU identification CPU type and version number O011ly All records of the sublist Ollly One record of the sublist C7 CPU features 00124 All records of the sublist 01124 Only those records of a group of STEP 7 processing features Time system in the C7 CPU STEP 7 instruction set 00134 User memory areas Working memory Integrated load memory Size of back up memory C7 626 C7 626 DP Control Systems B 4 C79000 G7076 C627 01 System Status List in the C7 CPU Table B 1 Sublists of the System Status List of the C7 CPU Sublist Index ID of the Individual Records of the
123. carried out 1 The C7 CPU erases the entire user program in the work memory and in the load memory The C7 CPU erases the back up memory The C7 CPU tests the hardware If an application is stored in the integrated flash memory of the C7 CPU its contents will be automatically copied into the load memory and compiled in the work memory see Section 3 10 If no application is stored then the load memory remains empty and the C7 CPU has the memory content 0 After resetting the C7 CPU the following items remain The contents of the diagnostic buffer The contents can be displayed using the programming device System diagnostic parameters Perhaps a user program loaded from the flash memory with reinitialized data The MPI parameters last set C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 2 13 C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Controlling with the C7 CPU Summary of pe ercromes YC 3 6 5 Parameter Block Hardware Interrupts 3 6 6 Parameter Block Real Time Clock 3 6 7 Parameter Block Time Of Day Interrupts 3 6 8 Parameter Block Cyclic Interrupts 3 6 9 Parameter Block Cycle Behavior 2 3 6 10 Parameter Block MPI Addresses Calculating the Scan Cycle Time and Response Time of the C7 CPU 3 8 1 Components of the Response Time with the C7 DP CPU as DP Master Bus Processing Time tDP Test and Reference Data Functions
124. cate Yes Print hardcopy Yes Static screen elements Static full graphics Fixed text Semigraphic characters Input output elements Input fields Output fields Combined input output fields Symbolic input pop up window Symbolic output graphics text Bars Curves Operator prompting Icons for softkey functions Fixed window Yes Limit value monitoring For inputs outputs Yes Conversion functions For inputs outputs Linear Square Fonts Loadable fonts per language 3 Fonts not dependent on language 1 with semigraphic characters Character sizes in pixels 8 x 8 to 64 x 64 Text attributes Display Flashing inverse underlined Printer Bold italics underlined Information texts Lines characters 7 35 For messages Yes For input fields Yes For screens Yes Password protection Number of passwords 50 Password levels 9 C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 C 3 C7 OP Functionality Standard Screens Control Jobs System Messages Table C 1 Functions of C7 626 C7 626 DP continued Function C7 626 C7 626 DP Recipes Number 255 Data records per recipe 500 Entries per data record 500 Save data records create C7 CPU C7 OP storage medium Load data records Storage medium C7 OP C7 CPU Delete data records In storage medium Change data records edit In storage medium Transfer current values C7 CP
125. cause of STOP via the multipoint interface to the display system programming device OP This diagnostic message is the newest entry in the diagnostic buffer Transmission of diagnostic messages after reversion to the STOP mode Undetected Errors Errors that occur in the process that is outside the automation system are not detected by the system diagnostics Such errors are for example motor failure These errors fall within the area of the process error diagnostics C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 3 15 Controlling with the C7 CPU 3 6 4 Parameter Block Retentive Areas Definition A memory area is retentive when its contents are retained even after a power Retentivity failure and a transition from STOP to RUN The non retentive areas for the bit memory timers and counters are reset after a power failure and after a transition STOP RUN The following can be retentive e Bit memory e Timers e Counters e Data areas Retentivity Without Areas that you declare to be retentive areas in the parameter block will be Battery Backup preserved without a back up battery after a power failure and after a transition from STOP to RUN The boundary defined for the retentive and non retentive areas is not influenced by the use of a back up battery in the C7 Note The C7 must always be supplied with a back up battery Retentivity With All data blocks are rete
126. ck DS Byte Bit Time What Can Be Assigned Meaning of the Respective Bit Value Parameters a Enable diagnostics AI1 Enable diagnostics AI2 Enable diagnostics AI3 Enable diagnostics AI4 Enable diagnostics AO1 Enable diagn wire break AI1 Enable diagn wire break AI2 Enable diagn wire break AI3 Enable diagn wire break AI4 1 Yes 1 Yes 1 Yes 1 Yes 1 Yes 1 Yes only if measurement range 1 Yes only if measurement range 1 Yes only if measurement range 1 Yes only if measurement range 03 0 0 Enable diagnostic interrupt for 0 No 1 Yes module 1 7 0 1 00 0 2 0 Il Use 0 Disable normal DI 1 Interrupt DI 2 CI 3 0 Hardware interrupt 0 No 1 Yes always with interrupt DI selectable if use 2 4 0 Edge 0 Rising edge 1 Falling edge only if not deactivated 5 0 Direction 0 Up 1 Down only if CI 6 7 0 01 0 2 0 I2 Use 0 Disable normal DI 1 Interrupt DI 2 CI 3 0 Hardware interrupt 0 No 1 Yes always with interrupt DI selectable if use 2 4 0 Edge 0 Rising edge 1 Falling edge only if not deactivated C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 4 37 Addressing Assigning Parameters and How the C7 I O Works Table 4 24 Table with Data Set Descriptions Parameter Block DS Byte Bit Time What Can Be Assigned Meaning of the Respective Bit Value Parameters 0 Direction 0 Up 1 Down only if CD 0 Disable normal DD 1 Interrupt DI 2 CI 3 FC 4
127. claw Branch Office Mr Wojniak Ul Powstanc w Slaskich 95 00 48 71 60 59 97 Fax 00 48 71 60 55 88 Portugal 2700 Amadora Siemens S A Dep Energia e Industria Mr C Pelicano Eng Estrada Nacional 117 ao km 2 6 Alfragide Apartado 60300 003 51 1 4 17 85 03 Fax 00351 1 4178071 4450 Matosinhos Porto Siemens S A Dep Energia e Industria Mr A Amaral Eng Estrada Nacional 107 No 3570 Freixieiro Apartado 5145 00351 2 999 21 11 Fax 003 51 2 9 99 20 01 Romania 76640 Bucuresti Siemens Birou de consultatii tehnice Mr Fritsch Str Zarii No 12 sector 5 00 40 1 2 23 47 95 Fax 00 40 1 2 23 45 69 Russia 113043 Moskau Siemens AG Mr Engelhard Mr Michailow UI Dubininskaja 98 007 095 2 36 75 00 Fax 007 095 2 36 62 00 Slovakia 81261 Bratislava Siemens AG Mr Sykorcin Tovarenska 11 00 42 7 Fax 00 42 7 12174 1 6332 ww Slovenia 61000 Ljubljana Siemens Slovenija Mr Lavric Dunajska C47 003 86 61 1 Fax 003 86 61 1 Spain 48011 Bilbao Siemens S A AUT 1 Mr Tapia Maximo Aguirre 18 TB 00 34 4 4 27 64 33 Fax 00 34 4 4 27 82 39 60 68 42 81 wo NN 08940 Cornella de Llobregat Barcelona Siemens S A AUT 1 Mr Ortiz yoan Fernandez Vallhonrat 1 B00 34 3 4 74 22 12 Fax 00 34 3 4 74 42 34 33206 Gijon Siemens S A AUT 1 Mr Huchet Corrida 1 00 34 85 35 08 00 Fax 00 34 85 34 9 3 10 15005 La Coruna Siemens S A AUT
128. contains the definitions and relationships between conversion time and scan cycle time for the analog inputs Conversion Time The conversion time consists of the basic conversion time and an additional conversion time necessary for the input calibration Scan Cycle Time The analog digital conversion and the transfer of the digitized measured value to the C7 CPU is performed sequentially that is the analog input channels are converted one after the other The scan cycle time that is the elapsed time before an analog input value is converted again is the sum of all conversion times 0 5ms channel of all activated analog input channels plus one calibration measurement Unused analog input channels should be deactivated in Hardware Configuration in order to reduce the scan cycle time Figure 4 5 gives you an overview of how the scan cycle time for a 4 channel analog input is composed y N Conversion time channel 1 y Conversion time channel 2 y Conversion time channel 3 gt Scan cycle time max 2 5 ms y Conversion time channel 4 Calibration measurement J Figure 4 5 Scan Cycle time of an Analog Input Interrupt Cycle If the interrupt cycle mode has been assigned parameters the new measuring cycle is not started unless the timed interrupt is initiated se Section 4 3 2 C7 626 C7 626 DP Control Systems 4 14 C79000 G7076 C627 01 Addressing A
129. creen layout that is configure fewer screen elements functions Examples Shift the function causing the message to another screen Do not use any curves in connection with this function 257 A data record was not stored in connection with the currently loaded recipe version If the data records concerned are still to be used the old version must be entered in the recipe configuration The assignment of the values of a data record is defined in the recipe structure If the structure was modified in a new configuration an old data set may be interpreted incorrectly 259 A data record must be transferred to the controller within a specified period of time This time was exceeded Possible causes Reception of the data record was not acknowledged by the controller user program The data record is very large The data record is transferred completely despite the timeout 260 The controller mode for example manual mode automatic mode STOP mode does not correspond to the configuration 261 A data set can no longer be used since the data are not consistent C7 626 C7 626 DP Control Systems C 14 C79000 G7076 C627 01 C7 OP Functionality Standard Screens Control Jobs System Messages Message Cause Remedy 303 Controller did not invert life memory bit Data have not Check controller status been requested or are no longer valid 304 Invalid job number o
130. d Representatives SIMATIC Contact in the Federal Republic of Germany ZN ZN ZN ZN ZN ZN ZN ZN ZN Zweigniederlassung Regional Office 52066 Aachen AUT P 13 Hr Georgens Kurbrunnenstr 22 T 02 41 451 252 Fax 02 41 451 3 98 86159 Augsburg AUT S11 Hr Hirth Werner von Siemens Str 6 B08 21 25 95 4 50 Fax 08 21 25 95 4 08 95448 Bayreuth AUT P S 11 Fr H sl Weiherstr 25 BW 09 21 281 3 41 Fax 09 21 2 81 4 44 10587 Berlin AUT P 1 Hr Liebner Salzufer 6 8 B 0 80 39 93 23 97 39 9 Fax 0 30 39 93 23 02 33605 Bielefeld AUT P 12 Fr Schl pmann Schweriner Str 1 B05 21 291 5 21 Fax 05 21 2 91 5 90 38126 Braunschweig AUT P 11 Hr Pelka Ackerstr 20 T 05 31 27 Fax 05 31 27 12 3 05 12 4 16 28195 Bremen AUT P 12 Fr Ulbrich Contrescarpe 72 T 04 21 3 64 24 27 Fax 04 21 3 64 28 42 09114 Chemnitz AUT P 11 Fr Aurich Bornaer Str 205 Bw 0371 4 Fax 0371 4 NN 5 35 10 5 35 25 ZN ZN ZN ZN ZN ZN ZN ZN 01189 Dresden AUT 1 Hr Lehmann Karlsruher Str 111 B 03 51 40 22 2 77 Fax 03 51 40 22 2 74 40219 Dusseldorf AUT P 15 Hr Becker Lahnweg 10 B 02 11 3 99 16 64 Fax 02 11 3 99 18 48 99097 Erfurt AUT P 22 Hr Skudelny Haarbergstr 47 B 03 61 4 25 23 51 Fax 03 61 4 25 23 50 45128 Essen AUT P 14 Hr Klein Kruppstr 16 B 02 01 8 16 24 28 Fax 02 01 8 16 23 31 6032
131. d data record from the selected storage medium Note If you want to delete all data records it is easier to just reformat the FLASH memory or floppy disk f EDIT Edit change the selected data record on the selected storage medium ga SELECT Select a data record from the selected recipe Data Record You can transfer the current values back and forth between the C7 OP and the Transmission controller without storing the values on a data medium This makes process Screen startups easier for example Transmission between the C7 OP and the data medium is also possible The Data Record Transmission screen is available for these transmissions Data Record Transmission Recipe Symbolic entry Data record name Drink String entry Comment Text Data medium int Flash Symbolic entry iD nil g ESC Softkeys Ald id h Figure 7 6 Standard Screen Data Record Transmission C7 626 C7 626 DP Control Systems 7 20 C79000 G7076 C627 01 Standard O I Functions The icons in the softkey bar have the following meaning Transfer the current values from the controller to the C7 OP update values in the C7 OP Transfer the current values from the C7 OP to the controller transfer values to the controller
132. d frequency is 10 kHz corresponding to 600 000 rev min If this frequency is exceeded then the input values will be erroneous since individual pulses will be suppressed by the input filter of 10 kHz The relative measuring discrepancy gets smaller as the period time increases Thresholds These thresholds are applicable for a transducer that generates one pulse per revolution If you use transducers that generate several pulses per revolution you must reconsider the threshold frequencies Counter Overflow The counter value FF FF FFy indicates a shortfall of the lower threshold A diagnostic report will not be generated in this case Parameter In order to use the universal input 3 as a period time counter this must also Assignment be set as such assigned parameters This is performed with the STEP 7 function Hardware Configuration C7 626 C7 626 DP Control Systems 4 36 C79000 G7076 C627 01 Addressing Assigning Parameters and How the C7 I O Works 4 5 Data Set Description for Parameter Block of the C7 Analog I Os and Universal Inputs Overview If a reassignment is to be performed during normal process operations then the validity and inter relationships between the individual parameters must be examined by the user program Incorrect value ranges of the parameters can result in incorrect behavior of the I O Table 4 24 lists the layout of the parameter data sets Table 4 24 Table with Data Set Descriptions Parameter Blo
133. d the DI DO Status Display 2 6 Resetting the C7 C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 2 1 Commissioning Startup 2 1 Starting Up Overview The following diagram shows the basic steps when starting up With Configuration default The C7 OP is operated with the loaded Without Configuration There is no configuration firmware in the C7 OP Reloading the Configuration The C7 OP should work with a new modified configuration configuration Switch on C7 power supply C7 OP SZ Transfer configuration data to the C7 OP V Z C Start Up Screen Figure 2 1 Start Up Process 2 2 C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Commissioning Startup 2 2 With a Loaded Configuration in the C7 OP Startup After connecting the power supply the C7 performs a self test During this test it checks the functionality of the most important device components and shows the test results via the status LEDs and display The following start up procedure is carried out 1 The C7 performs a self test after power on 2 If the configuration has not been loaded a contrast setting is requested The C7 performs an operating system test for both units C7 CPU and C7 OP 3 During the start up phase 1 and 2 the C7 CPU remains in the
134. d user version number does not agree with that Adjust user version number stored in C7 CPU 655 Controller acknowledgement area not physically beyond Re configure C7 CPU C7 O I alarm message bit area serious error no startup acknowledgement areas and repeat download 657 Configured controller driver not supported by version of Change protocol for version of device device you are using serious error you are using and repeat download configuration 659 Invalid variable in recipe no x BIN format 660 Invalid destination configured for cross jump in screen Add to configuration and repeat download 662 Invalid destination configured for cross jump in screen Add to configuration and repeat download C 22 C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 C7 OP Functionality Standard Screens Control Jobs System Messages Message Cause Acton 667 Incorrect configuration x x 1 8 Change configuration of Variable x process link and transfer again 1 Data type does not correspond to DB A x 9 13 Change configuration of 2 DB number greater than 15 area pointer and transfer 3 DB length greater than 1024 again 4 DW is in data block header x 14 Restrict configuration and 5 Actual value is not in send block transfer again 6 Setpoint is not in receive block 7 Setpoint actual value is not in receive block 8 Initial value is not in send block 9 Data type does not correspond to DB 10 DB num
135. described in Section 8 9 3 Bit 0 1 Data mailbox is disabled is set only by the C7 OP 0 Data mailbox is enabled Bit 1 1 Data record variable is errored Bit 2 1 Data record variable is correct Bit 3 1 Data transfer terminated successfully Bit 4 1 Request data record variable Bit 5 1 C7 OP should read the data mailbox Bit 6 1 Request data mailbox disable 8 8 2 Data Areas in the Interface Area Overview Job Area 8 18 In this section the layout and usage of the interface data areas is described The C7 CPU initiates an action to be carried out on the C7 OP by means of the job area All other bytes are areas in which the C7 OP writes data These areas can be evaluated by the C7 CPU program The bytes are individually described below Byte n 4 to n 11 The C7 OP is passed on the control jobs via the job area The actions on the C7 OP are initiated in this way The job area consists of four words In the first word of the job area is the job number In further words the job parameters are to be entered maximum 3 Address 7 0 7 0 n 4 Job number Parameter 1 Parameter 2 n 10 Parameter 3 C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Data Areas for Communication between the C7 OP and the C7 CPU Coupling Identifier Date and Time If the first word of the job area is not equal to zero the C7 OP evaluates the control job After that the C7 OP sets this dat
136. different priority classes which control the processing of the user program These priority classes include interrupts such as hardware interrupts When an interrupt occurs the relevant organization block is called automatically by the operating system in which the user can program the required reaction to the interrupt for example in a function block FB C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Glossary Load Memory Logic Block Memory Reset Message Level Message Logging Module Parameters MPI Multipoint Interface MPI The load memory is part of the C7 CPU It contains objects created by the programming device It is available as an integrated memory In SIMATIC S7 a logic block is a block that contains part of the STEP 7 user program The other type of block is a data block which contains only data During a memory reset of the gt C7 CPU the following memories are cleared e The work memory e The write read area of the gt load memory e The system memory e The back up memory The user program is reloaded from the flash memory The following memories are cleared in a memory reset of the gt C7 OP e The work memory e The configuration memory After this procedure there is no longer any user configuration loaded Operating level of the C7 at which any messages triggered in the system are displayed Printout of fault and event messages paral
137. dress space user data 3 11 C7 DP CPU transmission rate DP slave connectable to CPU DP slaves on CPU B 10 Dynamic parameters 4 6 Dynamic window C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Index E Edit mode 6 4 6 6 Enable diagnostic ingen tea 4 Enabled diagnostics Enter key 6 3 Entries numeric string symbolic EQ_DT EQ_STRNG Error communications CPU direct I O access direct I O access CPU power supply CPU programming CPU time CPU BT Error entries constraints Error response OB Event hardware interrupt Event message message line message status Event message area bit set Event message buffer deleting Event message buffer page Event message page 7 8 opening 7 15 Event message window Event message window opening Event messages buffer page displaying 7 8 indication priorities message buffer message line message page message window Example of alarm message buffer indicating 7 13 alarm message page alarm message window string entry 6 11 symbolic entry 6 12 Execution time FC IEC Extended scan cycle time External error C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 FB 3 5 FC B 5 AD_DT_TM A 6 CONCAT D_TOD_DT A 6 DELETE A DI_STRNG A 9 DT_DATE DT_DAY DT_TOD EQ_DT A 7 EQ_STRNG A 7 FIND A 8 GE_DT GE_STRNG
138. dware pa The priority of the hardware interrupt OB40 cannot be altered Interrupts Table 3 12 Parameter Block Hardware Interrupts Explanation Value Default Priority OB40 The priority of OB40 cannot be altered C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 3 17 Controlling with the C7 CPU 3 6 6 Parameter Block Real Time Clock Setting the Time You set the C7 CPU clock using STEP 7 or via the SFCO SET_CLK in the user program see Appendix A and reference manual 235 Parameter Block Table 3 13 lists the parameters of the parameter block Real Time Clock Real Time Clock Table 3 13 Parameter Block Real Time Clock Parameter Explanation Value Range Default Setting Synchronization The synchronization of the real time clock is None as master None on C bus performed via the C bus Synchronization Not possible None None on the MPI Synchronization Interval during which the real time clock is None None interval synchronized Seconds 10 seconds Minute 10 minutes Hour 12 hours 24 hours Correction factor A deviation of the real time clock is compensated From 10000 to 0 with the correction factor within 24 hours 10000 Example if the real time clock is slow by 4 ms after 24 hours then you must set a correction factor of 4 ms Example If the real time clock is two seconds slow after seven days the correction factor is to be calculated as foll
139. e If MPI transfer is configured configuration data can be transferred to the C7 OP via an MPI link You can set or change the operating mode of the C7 OP either on the C7 OP or via a job from the C7 CPU The current operating mode is stored by the C7 OP and cannot be lost during a power failure After the power is switched on the C7 OP returns to the operating mode which was last set Setting or changing the operating mode can be performed in the System Settings standard screen for example C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 6 19 Operating the C7 General During Startup You can use key combinations during C7 OP startup to set the operating modes shown below Transfer mode serial transfer ESC You can exit transfer mode with as long as no data transmission between the programming device PC and the C7 OP is running R Alternate toggle between on line and off line operation ESC Reset C7 OP Firmware and configuration are deleted a serial ae M transfer is then required via the V 24 interface C7 626 C7 626 DP Control Systems 6 20 C79000 G7076 C627 01 Operating the C7 General 6 7 Password Protection Overview Password Password Level Super User Password Screen Password List The function keys softkeys and input fields can be protected with passwords that is only authorized persons can use t
140. e drink orange nectar or pure orange juice for example The juice can then be bottled in different sized containers All this is performed with the same recipe but using different values for the individual entries Related values for the entries for example for the orange drink are combined into a data record The data records for a recipe are put together on the C7 OP An example of how they could appear is shown below Data Records For ORANGE Recipe Drink Nectar Juice Tank 1 90 70 0 Tank 2 10 30 100 Mixing time 5 10 0 Bottle size 1 0 7 1 Label 4 2 1 Bottles per case 6 12 6 C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 7 17 Standard O I Functions Analogy of a Filing Cabinet A filing cabinet is a good way to illustrate how recipes function The filing cabinet is the plant or the process to be controlled Each of the individual drawers represents the fixed structure of one recipe Index cards in the drawer contain the data records for that recipe Fruit Juice Plant GRAPEFRUIT Nectar Drink ORANGE The operator uses the C7 OP to handle the index cards We will now show you how to do this in the following subsections C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Standard O I Functions 7 3 1 Processing and Transferring Data Records Data Record Processin
141. e setpoint is variable This can be achieved by setting the upper limit and lower limit parameters in the declaration section of the FC127 to REAL To enhance flexibility in a test environment this variant has been omitted C7 626 C7 626 DP Control Systems 4 42 C79000 G7076 C627 01 Addressing Assigning Parameters and How the C7 I O Works Sequence of Statements in OB1 ORGANIZATION_BLOCK OB1 var_temp start_info array 0 19 of byte end_var BEGIN L 10 0 T MDO L 10 0 T MD4 L 2 2 T MD8 CALL FC 127 lower limit MD0O upper limit MD4 setpoint MD8 channel PQW272 END_ORGANIZATION_BLOCK 4 6 2 Block for Scaling Analog Input Values Function of Block The FC126 block is used to convert the actual value entered as hexadecimal number in a peripheral input word into a corresponding floating point number analog value to be output to a peripheral output word For this purpose a simple calculation using the rule of three is programmed 1 First the actual value is related to the total range RANGE_HEX resulting from the difference UL LL The result is a percentage of the absolute actual value This is identical in the floating point number and in the hexadecimal representation Then the total range RANGE DEC resulting from the difference UL LL is calculated in floating point number representation depending on whether the measuring range is uni
142. e C7 C7 CPU user program within 10 seconds CPU side 509 Firmware version different from standard FB version Load new standard FB onto C7 CPU 510 This message is output if Either set up the data block or change The data block for the variable does not exist in the the configuration recipe or The recipe data contains errors 511 The data record number in the control job or the function key is invalid 512 This message indicates a PLC error The variable which Correct the configuration if necessary is transferred with the message identifies the number of a data block that is too short 520 Too many returns stored Go to message level if necessary by pressing ESCAPE key 522 Screen cannot be selected due to inadequate storage 1 Delete unused fields from space Results in cold restart with memory optimization configuration 2 Configure smaller screen with fewer fields or partition screen 526 Loop through mode is set on C7 Change to Normal mode 536 Disturbance on link between OP and disk drive Check the physical connection 538 Job and operator access data record simultaneously Repeat your input if it was not executed 539 The data records stored in RAM for recipe no x contain errors they have been deleted Any data records stored in flash memory are still valid 540 The maximum permissible number of data records in memory has already been reached 541 to 550 The specified variable cannot be found in the c
143. e Data Block Interrupt Glossary 6 According to the International Electrotechnical Commission s IEC 1131 3 standard function blocks are logic blocks that reference an instance data block meaning they have gt static data A function block allows you to pass parameters in the user program which means they are suitable for programming complex functions that are required frequently for example control systems operating mode selection Output of the display contents to a connected printer A hardware interrupt is triggered by modules with interrupt capability as a result of a specific event in the process The hardware interrupt is reported to the C7 CPU The assigned organization block is then processed according to the priority of this interrupt Point in time at which the C7 triggers a message output Supplementary user configurable information on messages displays display entries and selection fields The information functions of STEP 7 permit the display of status information on the programming device via one or more C7 systems during the various startup phases and during operation of a programmable controller Each call of a function block in the STEP 7 user program is assigned a data block which is generated automatically In the instance data block the values of the input output and in out parameters as well as the module local data are stored The operating system of the C7 CPU recognizes 10
144. e Value Dynamic Output Type of output Dynamic Output Output range Dynamic Output C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Addressing Assigning Parameters and How the C7 I O Works 4 3 3 Representation of Analog Values Overview The representation of analog values or an analog value in binary form is the same for all C7 analog inputs and analog outputs This section describes the analog values for all measuring ranges or output ranges that can be used with the C7 analog I O Representation of The digitized analog value is the same for input and output values of the Analog Values same nominal range The representation of analog values is performed as a two s complement Table 4 6 illustrates the representation of the analog I O Table 4 6 Representation of Analog Values Resolution Analog Value Bit number Weighting of the bits VZ 214 213 212 gil 210 29 28 Sign Conventions The sign of the analog value is always contained in bit number 15 e 0 gt e a a 12 Bit Resolution The resolution is 12 bit The analog value is entered into the ACCU left justified The unoccupied low significance positions are written with 0 Table 4 7 contains an example of a bit pattern showing how the unoccupied positions for 12 bit resolution are filled with 0 Table 4 7 Bit Pattern of a 12 bit Analog Value Example 3 2 0 Bit number 12 bit analog value includin
145. e an area in the gt system memory of the gt C7 CPU The contents of these counters can be changed using STEP 7 instructions for example up counter down counter A cyclic interrupt is generated periodically by the C7 CPU according to a time grid which can be assigned parameters It triggers execution of the relevant organization block Data blocks are data areas in the user program which contain user data There are shared data blocks which can be accessed by all logic blocks and there are instance data blocks which are associated with a particular function block FB call C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Glossary 3 Glossary Data Static Data Temporary Default Setting Diagnostics Diagnostic Events Diagnostic Functions Diagnostic Interrupt Display Display Duration Display Entry Display Function Display Level Glossary 4 Static data are data which are used only within a function block These data are stored in an instance data block belonging to the function block The data stored in the instance data block are retained until the next function block call Temporary data are local data of a block that are stored in the L stack during execution of the block and that are not retained after the execution The default setting comprises generally applicable basic settings which are used whenever no other values are specified Diagnostic Functions
146. e operator with a continuous stream of important process variables regardless of which screen is open at the time Main Screen Area The main screen area contains the actual contents of the currently opened screen Additional windows for example message windows help windows and pop up windows are displayed over the main screen area and the fixed window Icons Icons symbolize softkey functions related to specific screens C7 626 C7 626 DP Control Systems 6 2 C79000 G7076 C627 01 Operating the C7 General 6 2 Keyboard Keyboard The keyboard of the C7 consists of three functional blocks see Figure 6 2 e Function keys K1 K10 e Softkeys F1 F14 e System keys SIEMENS SIMATIC C7 626 System keyboard Figure 6 2 C7 626 or C7 626 DP with Keyboard and Display Function Keys The function keys K1 K10 always trigger the same actions on the C7 OP or C7 CPU regardless of the picture currently displayed global meaning on the C7 OP These actions can be for example e Calling up a screen e Displaying the current alarm messages e Starting a printout of a screen hardcopy e Displaying the time window C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 6 3 Operating the C7 General Sofikeys System Keys Key Functions The softkeys F1 F14 have a specific local meaning according to the picture displayed The function of a softkey can vary from screen to screen When a screen is open a softk
147. e same time When a new print job is triggered while another print procedure is already running the new print job is buffered You can switch message logging on and off on the C7 OP All message occurrences for which logging is configured are printed out if message logging is active During message logging you can print out messages at the same time Messages arriving while the copies are being printed are stored in the buffer and printed later If forced logging has been configured the messages deleted from the C7 OP are automatically output on a printer when the message buffer overflows Trigger The hardcopy is triggered by pressing a function key The screen indicated on the display is then printed as characters ASCII or as pixel graphics Windows currently opened in the screen for example message windows are not included in the hardcopy Cancel You can cancel an already started hardcopy by pressing the HARDCOPY key again A system message is issued each time a hardcopy is cancelled The functions Trigger and Cancel a hardcopy are both displayed by a system message For logging purposes you can configure a list containing up to 20 screens which are printed automatically one after the other one screen per page after a print job has been initiated If a screen contains output fields for process values the current values from the controller are printed for these fields Trigger Printing is initiated by pressing a func
148. e the reference manual 235 The system status list is divided into sublists This makes it possible to target specific information in the system status list Each sublist contains e Header information of four data words e A specific number of records containing the event information C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 System Status List in the C7 CPU Header The header information of a sublist is four data words long Figure B 1 shows Information the contents of the header information of a sublist SZL ID Sublist ID Index Specification of an object type object number Length of a record contained in the sublist Number of records in the sublist Figure B 1 Header Information of a Sublist of the System Status List System Status Each sublist has an System Status List ID SZL ID In addition it is List ID possible to read only one excerpt from a sublist The ID of this excerpt from the sublist is also contained in the SZL ID Figure B 2 shows the structure of the SZL ID for the CPUs Bit 151413121110 9876543210 o ololol l SV v A Identification number sublist ID ID forthe sublist excerpt Figure B 2 Structure of the System Status List ID of the Sublist C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 B 3 System Status List in the C7 CPU ID for the Su
149. easurement Measurement Resolution Example of Frequency Period Count Value During Calculated Measurement 0 1 s Frequency can be calculated in 900 9000 Hz 10 Hz increments 9010 Hz Frequency can be calculated in 900 Hz 1 Hz increments 901 Hz Frequency can be calculated in 90 Hz 0 1 Hz increments 901 90 1 Hz The frequency meter calculates the frequency in longer intervals This means that with long measurement periods an updated frequency value is less often available If the frequency continuously changes then only average values are available Due to the principle of measurement the measurement error increases with a reduction in the measured frequency C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 4 33 Addressing Assigning Parameters and How the C7 I O Works 4 4 7 Period Time Measurement Overview Application Principle Measuring Accuracy 4 34 The universal input 3 can be assigned as a period time counter This universal input reads pulses from a transducer The transducer could for example be fitted to the barrel extruder of an injection moulding machine Calculation of low frequencies and speeds The period time counter counts the number of increments fixed time intervals of tz 0 5us between two rising edges The first period starts at the first transition from 0 to 1 rising edge It ends at the next rising edge This is also the start of the next
150. ecord as for a data record b Store a data record individually for recipe selected 1 Select recipe name 2 Specify data record name and data medium 3 Save data record 4 Repeat steps 1 and 3 for each data record All data records with the selected name on the data medium are loaded to the C7 OP and then to the controller Use the procedure described in Section 7 3 1 Note Depending on the scope of the recipes it may require a relatively long period of time to transfer a parameter record to the controller For this reason a parameter record should only contain those recipes which are absolutely necessary Complete parameter record Use procedure described in Section 7 3 1 Select Parameter Record as the recipe name Part of a parameter record Delete the desired data record individually from the selected recipe Use procedure described in Section 7 3 1 A parameter record cannot be edited Only the individual data records within the parameter record can be edited Use procedure described in Section 7 3 2 C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 7 27 Standard O I Functions 7 4 Printing Overview Message Logging Configure Forced Logging Hardcopy Printing Screen List 7 28 The C7 OP can e Log messages e Force logins e Make hardcopies of the contents of the current display e Print a list of screens Hardcopies and message logging can be performed at th
151. ect the function to be executed for example load save and edit C7 626 C7 626 DP Control Systems 7 22 C79000 G7076 C627 01 Standard O I Functions 7 3 2 Setting Up and Editing Data Records Only the recipe structure is specified during configuration of the C7 OP No data records exist yet These are generated set up on the C7 OP Setting Up The standard screen called Data Record Processing contains an edit function Editing Data You can use this function to accomplish the following Records e Set up new data records on a selected data medium e Change the contents of data records stored on a data medium To set up edit data records proceed as follows 1 Select recipe 2 Enter data record names If you are setting up a new data record enter a data record name which does not yet exist 3 Select a data medium on which the data record is to be stored Note The data medium must be formatted before data are stored on it for the first time The screen called Data Record Processing contains a format function which you can use to format flash disks and diskettes 4 Select edit mode The data record which you have selected is shown as a list in the edit window that is each line contains one recipe entry and value ORANGE Drink Comments Tank 1 cep ae 4 Tank 2 10 Mixing time 5 Bottle size 1 4 6 Label Bottles per case Figure 7 7 Data Record i
152. ed Value of the Analog Inputs Voltage Current Measuring Ranges Measuring Measuring Measuring Units Range Range 11 759 gt 23 516 gt 22 815 32767 TFFF 11 7589 32511 JEFF 3 3 Upper range 10 0004 20 0007 6C0lH 10 IV 7 500 Nominal range 7 50 10 00 20 000 10 0004 20 0007 Lower range 11 759 IA 11 76 lt 23 517 IA 1 1845 32768 80004 Underflow C7 626 C7 626 DP Control Systems 4 12 C79000 G7076 C627 01 Addressing Assigning Parameters and How the C7 I O Works 4 3 5 Representation of Analog Values for the Output Range of the Analog Outputs Table for Output Table 4 10 contains the analog output ranges of the analog output Ranges Voltage Current Table 4 10 contains the representation of the voltage output range 10 V Output Ranges and the current output ranges 20 mA 4 20 mA Table 4 10 Representation of the Analog Output Range of the Analog Outputs Voltage Current Output Ranges Output Range Range 10V 4 20 mA 11 7589 Range Decimal Hexadecimal Overflow Upper range 10 0004 20 0007 10 0000 Nominal range 10 0004 Lower range 11 7589 Underflow C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 4 13 Addressing Assigning Parameters and How the C7 I O Works 4 3 6 Conversion and Scan Cycle Time of the Analog I Os Introduction This section
153. edge 0 1 if the bit set new start comparison value is set simultaneously Bit 1 of PQB276 PQB279 PQB282 Prerequisite is that the hardware interrupt of the counter is set to yes When counting direction is up if counter value comparison value When counting direction is down if counter value zero C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 4 29 Addressing Assigning Parameters and How the C7 I O Works 4 4 5 Counter Interrupts Introduction The universal inputs of counters can be assigned parameters for hardware interrupts In this case an up counter triggers a hardware interrupt when it reaches the comparison value and a down counter when it passes through Zero Assignable Events The parameter assignment is performed with the STEP 7 function Hardware Configuration Hardware Interrupt If a hardware interrupt from the counter is sent to the C7 CPU then the OB hardware interrupt OB OB40 to the C7 CPU will be called The event that called the OB40 is stored in the start up information declaration section of the OB40 You must evaluate the additional information Z1 to Z3 in the start up information Declaration The entries in the declaration section of OB40 can be found in Table 4 21 Section of OB40 the bytes that are relevant to the user are hatched in the table Table 4 21 Declaration Section of OB40 Class Identifier Event number Priority class Curren
154. end E temporary correction at connector P permanent reset by use of correct parameter R permanent remove by RESET complete erasure and restart of C7 CPU or exchange of equipment M temporary disappears after new measurement C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 VO Diagnostics Reaction to Diagnostic Messages Table 5 4 Reason for the Source of Error Diagnostic Message Module not assigned parameters During the startup of the module if no parameters were assigned to the C7 CPU The module error bit is not set if no further error exists Module fault Collective error except no module parameters of all set diagnostic bits The error bit is set simultaneously with the error bits Watchdog EEPROM error or ADC error In addition the watchdog is activated with EEPROM error Internal error Watchdog The watchdog error is identified after an internal reset of the module The watchdog error can arise as the result of an EPROM or general module error The error is identified after resetting the module during the reading of the calibration values for the compensation of the offset error of the analog I O from the serial EEPROM EEPROM error Diagnostic Messages and Possible Responses Response of the Module Report to C7 CPU that the module is working with default parameters no channel specific module diagnostics no hardware and dia
155. er can program a response or an error is displayed It draws the operator s attention to certain operating states in the machine or plant to which the C7 is connected Function Block Function Reserved areas in configured or fixed texts used to output or input values With regard to their characteristic to retain data in the case of a power failure FEPROMs correspond to the electrically erasable EEPROMs but can be erased much faster FEPROM Flash Erasable Programmable Read Only Memory The following data can be held in flash memory without being affected by a power failure e The user program e The parameters that determine the characteristics of the gt C7 CPU and the I O functionality of the C7 Automatic printout of fault and event messages that can be deleted in the event of a buffer overflow According to the International Electrotechnical Commission s IEC 1131 3 standard functions are logic blocks that do not reference an instance data block meaning they do not have a memory A function allows you to pass parameters in the user program which means they are suitable for programming complex functions that are required frequently for example calculations C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Glossary 5 Glossary Function Block FB H Hardcopy Hardware Interrupt Incoming Message Information Text Information Function Instanc
156. error number including any variables coming up in the message Possible Causes e 005 C 24 e 6xx e 701 e 702 e 703 e 704 e 705 e 706 e 7xx Error no Varl Var2 Var3 Var4 Error in configuration file Internal actual value errors Invalid job illegal job number or job parameter Flash full restrict your configuration Controller error Acknowledgement for unknown message Recipe request already active Internal errors C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 SIMATIC C7 and S7 Literature List Supplementary Literature 70 S7 300 Programmable Controller Hardware and Installation Manual T1 S7 300 M7 300 Programmable Controllers Module Specifications Reference Manual 72 _ S7 300 Programmable Controller CPU 312 CPU 314 Instruction List 231 User Manual Standard Software for S7 and M7 STEP 7 233 Ladder Logic LAD for S7 300 and S7 400 Programming Manual 235 System Software for S7 300 and S7 400 System and Standard Functions Reference Manual 280 System Software for M7 300 and M7 400 Program Design Programming Manual C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 D 1 C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Siemens Worldwide Overview In this appendix you will find a list of e All cities in the Federal Republic of Germany with Siemens Sales Offices and e All European and non European Siemens Companies an
157. ers bit memory and data areas required internally by the operating system for example backup for communication are stored in the system memory It reports internal states in the C7 and in the controller The time of day interrupt belongs to one of the priority classes in the program execution of the C7 CPU It is generated at a specific date or day and time for example 9 50 or every hour or every minute A corresponding organization block is then executed The time delay interrupt belongs to one of the priority classes in SIMATIC S7 program execution It is generated when a timer has expired in the user program A corresponding organization block is then executed C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Glossary 11 Glossary Timers T Tool Transfer Mode Transmission Rate Troubleshooting via OB U User Memory User Program WwW Work Memory RAM Glossary 12 Timers are an area in the gt system memory of the gt C7 CPU The contents of these timers is updated by the operating system asynchronously to the user program You can use STEP 7 instructions to define the exact function of the timer for example on delay timer and start processing it Start STEP 7 Application Operating mode of the C7 OP used for transferring data from the programming device to the C7 OP Data transmission rate bit s When the operating system recognizes a specific error for ex
158. es are set by the user program The universal input counter counts pulses up to a maximum frequency of 10 kHz A frequency filter is fitted to the inputs Warning If the actual frequency exceeds the threshold frequency of 10 kHz then the correct function of the universal inputs can no longer be guaranteed since count pulses will be lost C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 4 27 Addressing Assigning Parameters and How the C7 I O Works Stopping and Starting Counters 4 28 The universal counter inputs are controlled by the user program The control options you have in the user program to influence the counters are explained in Table 4 20 The addresses in this table can be freely addressed in the C7 626 DP Table 4 20 Controlling Counters with the User Program Aim Procedure Start counter Enter a valid start value if counting down or a valid comparison value PQW274 PQW277 PQW280 Activate the new start comparison value Bit 1 of PQB276 PQB279 PQB282 rising edge O gt 1 Start the counter by selecting the start bit Bit 0 of PQB276 PQB279 PQB282 falling edge O gt 1 Stop counter Reset the start bits Bit 0 of PQB276 PQB279 PQB282 falling edge O 1 Restart counter with counter If necessary enter a new start value or retain old initialization reset start value for counting down or comparison value for counting up PQW274 PQW
159. essage page Message processing 7 15 Message status Message window 7 8 Messages i loggin stored MID A 8 MIN A 9 Module time limits MPI address highest MPI addresses 75 22 parameter block B 22 MPI bus MPI station addresses MPI transfer MRES N NE_DT NE_STRNG A 7 Nesting level 3 5 Normal operation Numeric fields O OB B 5 3 6 OB1 start event in CPU 3 6 start events Index 7 Index OB10 start event in CPU 3 7 start events B 7 OB100 start event in CPU 3 6 start events 3 6 OB121 C7 CPU 3 8 start event in CPU 3 8 OB122 C7 CPU 3 8 start event in CPU 3 8 OB20 start event in CPU 3 7 start events B 7 OB35 start event in CPU 3 7 start events 0B40 4 18 start event in CPU start events 3 7 OB80 start event in CPU 3 7 start events B 7 OB81 start event in CPU 3 7 start events B 7 OB82 start event in CPU 3 7 start events 3 7 OB85 start event in CPU 3 7 start events 3 7 OB86 C7 CPU 3 7 failure return OB87 C7 CPU 3 8 start event in CPU OBs for error responses communications error direct I O access error process image update programming error time error OBs start events B 61 ion Operating mode select Index 8 Operating modes Operating system run time B 29 Operating system execution time Operating system test startup Operating sytem exec
160. essage text The message text can also contain internal system variables which help to localize the cause of the error message Some system messages expect a confirmation from or a decision by the operator For example Delete error message buffer 0 Yes 1 No By entering 0 yes or 1 no you determine what happens next The system message window can be closed by pressing the cancel key or by selecting another screen The appendix of this manual contains a list of system messages including additional information on the cause of the message and any system variables indicated In some cases possible remedies are also shown C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Standard O I Functions 7 3 Recipes Overview Example of a Recipe Data Records Our fruit juice plant was introduced in Section 7 1 1 pf this manual The finished product of our fruit juice plants a bottle of fruit juice The finished product is determined by the various variables of the system You can combine the variables for one type of juice into a set of processing instructions This set of instructions is called a recipe The individual variables are called recipe entries Recipes are configured and cannot be changed on the C7 We will call our recipe ORANGE Tank 1 Tank 2 Mixing time Bottle size Label Bottles per case One type of juice can be mixed in different concentrations to make orang
161. esult if proper precautions are not taken Note draws your attention to particularly importantinformation on the product handling the product orto a particular part of the documentation The device system may only be set up and operated in conjunction with this manual Only qualified personnel should be allowed to install and work on this equipment Qualified persons are defined as persons who are authorized to commission to ground and to tag circuits equipment and sys tems in accordance with established safety practices and standards Note the following Warning This device and its components may only be used forthe applications described in the catalog or the technical description and only in connection with devices or components from other manufacturers which have been approved or recommended by Siemens This product can only function correctly and safely if itis transported stored setup and installed correctly and operated and maintained as recommended SIMATIC and SINEC are registered trademarks of SIEMENS AG Third parties using for their own purposes any other names in this document which refer to trademarks might infringe upon the rights of the trademark owners Copyright Siemens AG 1996 All rights reserved The reproduction transmission or use of this document or its contents is not permitted withoutexpress written authority Offenders will be liable for damages Allrights including righ
162. etentive counters from 0 to 7 Timers 128 From TO to T127 Selectable retentivity memory required 2 bytes timer Preset no retentive timers Max 8 data areas from one or more data blocks Maximum of 4096 retentive data bytes 4736 bytes Clock memory Local data 3 4 Memory that can be used in the user program to obtain a clock beat Number 8 1 memory byte freely selectable address of a memory byte Total 1536 bytes 256 bytes for each priority class C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Controlling with the C7 CPU Table 3 1 Performance Characteristics of the C7 CPU Performance C7 CPU Process image area From 0 to 127 Digital inputs from 10 0 to 1127 7 Digital outputs from QO0 0 to Q127 7 Nesting level 8 for each priority class 4 additional within an error OB Blocks OBs 14 FBs 128 FCs 128 DBs 127 SDBs 9 SFCs SFBs C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 37 for C7 626 DP 40 3 5 Controlling with the C7 CPU 3 4 C7 CPU Blocks Overview Table 3 2 lists all blocks that the C7 CPU can process Table 3 2 Overview C7 CPU Blocks OB 8 Kbytes A complete list of all possible OBs can be found at the end of this table FB 8 Kbytes FC DB 127 1 127 8 Kbytes 0 is reserved SFC 34 A complete list of all SFCs in the C7 CPU can be found in Appendix A A detailed description can be found in the reference manual 235
163. ew A cyclic interrupt is a periodic signal that the C7 CPU generates internally and leads to the automatic call up of a cyclic interrupt OB OB35 Priority The priority of OB35 is fixed at 12 You cannot change this value Parameter Block Table 3 15 lists the parameters of the parameter block Cyclic Interrupts Cyclic Interrupts Table 3 15 Parameter Block Cyclic Interrupts Parameter Explain y O Value Range Default Periodicity OB35 Call up interval e __ OB35 From 1 in ms to 60000 C7 626 C7 626 DP Control Systems 3 20 C79000 G7076 C627 01 Controlling with the C7 CPU 3 6 9 Parameter Block Cycle Behavior Parameter Block Table 3 16 list the parameters of the parameter block Cycle Behavior Cycle Behavior Table 3 16 Parameter Block Cycle Behavior Parameter Explanation Value Default Range Setting Cycle loading due to communication To limit the extent of slowing down program From 5 20 processing due to communications processes to 50 via the MPI in you can define the maximum percentage of cycle loading The communication between C7 CPU and programming device or between communicating C7 CPUs can slow down due to the cycle loading limit Operating system services such as the collection and provision of data for the communication will not be influenced Functions that require continuous reading of data slow down program exec
164. example of indication Alarm message buffer page Alarm message page example of opening 7 15 Alarm message window example of C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Alarm messages 7 7 acknowledgin buffer page displaying 7 8 indication priorities message buffer message line 7 8 7 10 message page Index 1 Index message status 7 9 message window 7 8 Analog I O addressing dynamic parameters parameter programming example 4 40 relationship static parameters Analog input basic conversion time conversion time diagnostics interrupt cycle time measured values parameter scan cycle time 4 14 Analog input parameter basic settings diagnostics 4 7 interrupt cycle 4 measurement Analog input value scaling 4 43 Analog output conversion time diagnostics 5 4 output ranges parameters 4 9 response time scan cycle time settling time Analog output parameter basic settings diagnostics output range substitute value Analog output value scaling 4 40 Analog ranges resolution sign conventions 4 10 Analog value representation 4 11 measured value resolution resolution 4 10 two s complement Analog digital conversion Area pointer screen number area El Background illumination display 6 17 Index 2 Backing up printer jobs 7 28 Backup 6 15 battery 3 16
165. ey s function is shown by an icon at the edge of the screen With the system keys you make entries on the C7 OP The key block is marked with the system keys in Figure 6 2 The functionality of the individual keys is explained in Table 6 1 The control keys of the C7 OP have the following functions Table 6 1 Key Functions Key Function Description o SHIFT key This key is used to switch the input keys from numeric to alphanumeric The key is equipped with two LEDs which indicate the current status No LED is on e Numeric assignment of the input keys is active e Alphanumeric assignment of the input keys becomes active when this key is pressed once One of the two LEDs left or right is on Left or right alphanumeric assignment of the input keys is active Input key assignment alternates between the left and right alphanumeric assignment each time this key is pressed Switches the active window Ded Switches from alphanumeric assignment of the input keys back to numeric assignment Activates edit mode DEL Deletes inserts individual characters Cancel key This key cancels already started actions Some ESC ESCAPE examples are listed below e Delete an already entered character for a value input e Delete a queued system message CN Acknowledge This key acknowledges the currently indicated alarm REx ment key message or all messages of an acknowledgement
166. from STOP to RUN Alternatively you can also change some parameters in the user program with SFC55 to SFC57 see reference manual 235 We subdivide the parameters for the two alternatives into e Static parameters and e Dynamic parameters The following table explains when the static and dynamic parameters are adopted Table 4 1 Time of Transfer of the Parameters from the C7 CPU to the Analog I O Parameter Set with Time of Parameter Transfer Static Hardware Configuration STOP gt RUN Dynamic Hardware Configuration STOP gt RUN SFC55 to SFC57 RUN The following parameter blocks permit the assignment of parameters in the STEP 7 function Hardware Configuration to define the following characteristics of the analog I O e For inputs Basic settings Diagnostics Measurement Interrupt cycle e For outputs Basic settings Diagnostics Substitute values Output range C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Addressing Assigning Parameters and How the C7 I O Works Analog Input Table 4 2 provides an overview of the analog input parameters Parameters Table 4 2 Analog Input Parameters Parameter Basic settings e Enable diagnostic interrupt Diagnostics e Enable Configuration parameter assignment error Wire break only 4 20 mA Measuring range undershoot Measuring range overshoot Wire break check only for measuring range 4 20 mA
167. functions by assigning the appropriate parameters to the universal inputs e Digital input e Interrupt input Counter e Frequency counter e Period time counter All of the addresses referred to in the following sections are default addresses and can be assigned parameters The addresses for the universal inputs are default addresses which cannot be changed According to the application of the universal inputs the results occupy different addresses For the address assignment a distinction can be made between e Input range PIW280 PIB287 for count values or signal state of the digital inputs e Output control range PQW 274 PQB282 for counters C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 4 19 Addressing Assigning Parameters and How the C7 I O Works Input Range The four universal inputs of the input range se Figure 4 6 have the following addresses and weightings Table 4 15 Input Address of the Universal Inputs PIW280 CI1 Counter input ma PIB284 CI3 Counter input PIB285 Frequency period time counter el PIB286 Bit 4 Bit 5 States of the counter inputs see Table 4 16 Bit 6 Bit 7 States of the The state of the individual inputs is stored as a bit pattern in PIB287 Inputs Table 4 16 State of the Inputs Address Status Display of the Universal Inputs PIB287 Bit 0 Bit 1 universal input 1 set Bit 0 universal input 1 reset Bit 1 Bit 1 universa
168. g Data Records Parameter Records Printing 7 5 Status Force with the C7 C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 7 1 Standard O I Functions 7 1 Screens Overview Logically related process values are combined into screens Graphic elements illustrate the relationships between these values The individual screens provide a quick overview of a process or a system In addition to showing what is happening in the process screens can also be used to control the process by entering new process values 7 1 1 The C7 in Action Using an Example The C7 OP is to control and monitor a plant which mixes and bottles various fruit juices Plant functions are divided roughly into the mixing and bottling stations Mixing Station The ingredients for the juices are stored in three tanks The ingredients are mixed in certain proportions depending on which fruit juice is to be produced Bottling Station After the juice is mixed a valve is opened and the finished fruit juice flows into a filling tank and is then bottled The bottles are transported on a conveyor belt Before being filled they are checked for glass breakage After being filled the bottles are sealed labelled and palletized C7 626 C7 626 DP Control Systems 7 2 C79000 G7076 C627 01 Standard O I Functions Figure 7 1 TANK1 TANK2 TANK3
169. g Screen Up to now you have learned that the recipe and its entries are configured and that you cannot change the recipes with the C7 OP later on Thus handling of the recipes with the C7 OP is limited to the following operations on the data records e Store set up e Load e Delete e Edit The standard screen Data Record Processing is available for processing data records A second standard screen called Data Record Transmission provides you with special transfer functions Layout of the Data Record Processing standard screen Recipe Data record name Comments Data medium Data Record Processing ORANGE Drink Text int Flash Format Symbolic input String input i g EZA T al A ESC Symbolic input Figure 7 5 Standard Screen Data Record Processing C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Softkeys 7 19 Standard O I Functions The icons in the softkey bar have the following meaning JT2 SAVE Copy the current values from the PLC to the C7 OP and store them as a data record on the required storage medium LOAD Load the selected data record from the selected storage alll medium in the C7 OP and transfer to the controller H DELETE Delete the selecte
170. g sign C7 626 C7 626 DP Control Systems 4 10 C79000 G7076 C627 01 Addressing Assigning Parameters and How the C7 I O Works 4 3 4 Representation of Analog Values for the Measuring Ranges of the Analog Inputs Overview The tables in this chapter contain the digitized analog values for the measuring ranges of the analog inputs In Table 4 8 you will find the representation of the binary analog values and the associated decimal or hexadecimal representation of the units of the analog values How the Measured Table 4 9 contains the digitized analog values for the various measuring Value Tables ranges Should be Read Since the binary representation of the analog values is always the same the tables contain only the comparison of the measuring ranges to the units These tables are therefore clearer and easier to read The corresponding binary representation of the measured values can be referred to in Table 4 8 Measured Value The bits identified with x are not relevant to a resolution of 12 bits Resolution Table 4 8 Possible Resolutions of Analog Values C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 4 11 Addressing Assigning Parameters and How the C7 I O Works Voltage Current Table 4 9 contains the representation of the digitized voltage measuring Measuring Ranges ranges for 10 V and the digitized current measuring ranges 20 mA 4 20 mA Table 4 9 Representation of the Digitized Measur
171. gh idea of the cause of a system message A few important system messages are shown below together with their causes and the action that has to be taken Self explanatory system messages are not included Note Messages are displayed in English until configuration data have been downloaded to the C7 C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 C 9 C7 OP Functionality Standard Screens Control Jobs System Messages Messages Message The following tables list the most important messages their causes and possible action to take Cause Remedy Please wait Mode being changed Ready for transfer Data transfer Firmware not compatible Waiting for data from programming device PC Data being transferred between programming device PC and C7 Firmware cannot be used for current configuration EPROM memory failure RAM memory failure Flash memory failure Memory submodule defective internal hardware error Memory submodule defective or transfer failure Return device for repair with details of error Repeat download configuration or return device for repair C 10 C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 C7 OP Functionality Standard Screens Control Jobs System Messages Message Cause Remedy Error during data transfer in Download mode Check connection repeat download message with two variables Status display Func
172. gnostic interrupts The error is set reset with the subordinate diagnostic bits If the diagnostic interrupt has been assigned one will be generated With watchdog the module adopts a safe state 0 V is output the measured values become 7FFF and the counter values become FFFF FFFFFFp The module adopts a safe state 0 V is output the measured values become 7FFF and the counter values become FFFF FFFFFF The diagnostic messages listed in Table 5 4 refer tq Table 5 3 Table 5 4 lists the diagnostic messages and also possible reactions of the user Possible Elimination Assign parameters to module See error under the grouping module error Table 5 3 See error under the grouping Internal error Table 5 3 The error cannot be corrected by the user The module can only be restarted after a reset on the bus restart C7 CPU The error cannot be corrected by the user The module can only be restarted after a reset on the bus restart C7 CPU or the analog I O must be recalibrated at the manufacturer s factory device exchange The error bit is set when channel specific errors of the analog inputs or outputs occur External error A channel causes an error The diagnosis of the error causing channel is activated by the parameter assignment Channel error C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Refer to the grouping External error ir Table 5 3
173. h of the alarm message area Figure 8 3 clarifies this situation Alarm message area 1 Acknowledgement area 1 Alarm message no 1 Acknowledge bit for alarm message no 1 Alarm message area 2 Acknowledgement area 2 Alarm message no 49 Acknowledge bit for alarm message no 49 Figure 8 3 Assignment of Acknowledge Bit and Message Number C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Data Areas for Communication between the C7 OP and the C7 CPU Acknowledgement Area C7 CPU gt C7 OP Acknowledgement Area C7 OP C7 CPU Size of the Acknowledgement AreasC7 CPU C7 OP and C7 OP C7 CPU One of the bits set in the C7 CPU area causes the acknowledgement of the corresponding alarm message at the C7 OP The acknowledgement area C7 CPU C7 OP e Must be immediately connected to the relevant alarm message area e Must have exactly the same polling time and e Can have the same maximum length as the corresponding alarm message area If an alarm message is acknowledged at the C7 OP the corresponding bit is set in the acknowledgement area C7 OP C7 CPU Thus the S7 can recognize that the alarm message has been acknowledged The acknowledgement area C7 OP C7 CPU can have the same maximum length as the corresponding alarm message area The acknowledgement areas may not be larger than the corresponding alarm message area It can however be configured to be smaller
174. he bus processing time in the PROFIBUS DP network e The response time of the DP slave Overview This section describes the main information about the bus processing times in the PROFIBUS DP network The description in this section refers to the operation of the C7 DP CPU as a master in the PROFIBUS DP network The bus processing times are always dependent on the number of slaves the transmission rate and the number of RS 485 repeaters You can use a programming device to display the bus processing time in your PROFIBUS DP network see STEP 7 documentation An example is used to show you how to estimate the bus processing time without a programming device o calculate the response time of the C7 DP CPU as a master please read tol3 7 41 To calculate the response times of a DP slave please read the documentation for the corresponding DP slave C7 626 C7 626 DP Control Systems 3 36 C79000 G7076 C627 01 Controlling with the C7 CPU 3 8 1 Components of the Response Time with the C7 DP CPU as DP Master Response Times Figure 3 5 shows the components of the response time in a PROFIBUS DP within PROFIBUS network These times together produce the average response time which DP elapses between a change in state on an input and the associated change in state on an output
175. he trend value or the whole trend buffer as a result Trends of a trigger bit being set You set this in your configuration Bit triggered trends are normally used for displaying rapidly changing values One example of using bit triggered trends is injection pressure in the manufacture of plastic components When you are configuring you have to create suitable areas in your configuration by choosing Area Pointers from the menu and on the C7 CPU to initiate bit triggered trends The C7 OP and the C7 CPU use these areas to communicate with each other The areas required are trend request area trend transfer areal trend transfer area2 required with switch buffer only The same bit is permanently assigned to every trend in these configured areas In this way every trend can be clearly identified in every area Switch Buffer The switch buffer is a second buffer for the same trend that you can create in your configuration While the C7 OP is reading values from buffer 1 the C7 CPU writes to buffer 2 While the C7 OP is reading buffer 2 the C7 CPU writes to buffer 1 It prevents trend values from being overwritten by the C7 CPU while the trend is being read by the operator panel Partitioning The individual areas trend request trend transfer 1 and 2 can be Data Areas partitioned into separate data areas with a specified maximum number and length Table 8 4 Table 8 4 Partition of Data Areas Data Areas
176. he type of printer and the transfer parameters can be specified on the C7 with the standard screen entitled Printer Settings The printer and the C7 must have the same transfer parameters The standard settings are listed below Transmission rate 9600 Data bits 8 Stop bits 1 Parity None C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Operating the C7 General Printer Screen This standard screen can be used to set the following parameters Printer Settings General Hardcopy IF number Printout Baud rate 00 Color Data bits Bold Stop bits Density Timeout s Matrix prt Parity Type Printer type ESC Figure 6 4 C7 Standard Screen for Printer Settings 6 5 3 Blanking Circuit Lifespan of CCFL Tubes Blanking Circuit Canceling the Blanking Circuit The background illumination of the display uses a CCFL tube Cold Cathode Fluorescent Lamp For technical reasons the brightness of these CCFL tubes decreases with use The average lifespan is given as 20 000 hrs by the manufacturer of the display An automatic blanking circuit can be used to increase the useful life of CCFL tubes This blanking circuit can be configured via ProTool If no key is pressed within a configured period of time the display background illumination is switched off automatically The background illumination goes on again automatically when any key is pressed C7 62
177. hese keys and fields A protected function cannot be used without first entering a password with a certain password level This password level determines the access rights of the operator The required password level is specified during configuration and can be a number from 0 lowest level to 9 highest level This super user has a level 9 password which is especially specified for this purpose during configuration It permits all operator actions The super user password can be changed in the configuration A standard screen called Password Processing is available for entering passwords and assigning passwords levels You can look at the passwords in a password list C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 6 21 Operating the C7 General 6 7 1 Logging In on the C7 There are two ways to log in on the C7 e Using the standard screen e Using a login window which is displayed automatically Login via Proceed as follows Plandard screen 1 Call up the standard screen Password Processing Password Processing Login Edit ESC Password List Figure 6 5 Standard Screen Password Processing 2 Enter your personal password in the Login field After you have entered a valid password and your entry has been accepted the assigned password level is indicated You can now use all functions assigned to this level or a lower pass
178. iable can be evaluated in the C7 CPU program You then have to acknowledge in the C7 CPU program whether the transfer was error free or erroneous Error free bit 2 is set to 1 Erroneous bit 1 is set to 1 5 Reset bit 0 in the C7 CPU program 6 The C7 OP resets the bits set in step 3 and step 4 8 24 C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Data Areas for Communication between the C7 OP and the C7 CPU 8 9 4 Synchronization During Transfer Special Cases Transfer C7 OP gt C7 CPU initiated by C7 CPU Transfer C7 CPU gt C7 OP initiated by C7 OP Step 1 Step 2 Step 3 Step 4 Step 5 Make sure with this type of transfer that the current variables on the C7 OP are transferred The values are not read directly from the data medium Table 8 6 Procedure for Transmission Explanation In the control program request the data mailbox lockout by setting bit 6 to If lockout is possible the C7 OP sets bit 0 to 1 and simultaneously resets bit 6 to 0 In the program inform the C7 OP via the data mailbox which data record it should transfer To do this enter the IDs of the recipe in the data mail box Set bit 4 to 1 request data via data mailbox in the program The C7 OP reads the data mailbox The C7 OP resets bit 4 and transfers the data record or the variable as described for case 1 from step 2 onwards A direct transfer from the C7 CPU to the C7 OP is not
179. ield texts do not exist for the symbolic actual value 25 Field type not permitted 8 20 Internal error 632 Message with one variable 1 4 Information text not available 2 Information text identifier not available for messages 12 Process screen does not contain entries 3 6 7 Internal errors 8 11 13 C 20 Enlarge LED image area according to configured bit offsets Enlarge image area according to configured bit offsets Add to configuration and repeat download Add to configuration and repeat download C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 C7 OP Functionality Standard Screens Control Jobs System Messages C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 634 Message with one variable Add to configuration and repeat 18 Screen title not configured download Oto 8 Internal errors 34 635 Configuration error in x Add to or modify configuration and Variable x repeat download 1 The screen or recipe entry is only set up symbolically 3 The field is only set up symbolically 6 The message entry or information text is not configured for the current language TOs Internal errors 19 28 41 43 18 The screen or recipe title is not configured 20 The process connection is only set up symbolically 21 The information text is only set up symbolically 22 The symbolic field is only set up symbolically 23 Fewer than 2 field texts are configured for
180. if it is not necessary to acknowledge every alarm message Figure 8 4 clarifies this case Alarm message area Reduced alarm message Alarm messages acknowledgement area that can be acknowledged Bit O Bit 0 EN EN wogs Alarm message Bit m that cannot be acknowledged Figure 8 4 Reduced Acknowledgement Area Note Allocate important alarm messages whose acknowledgement is to be signalled to the C7 CPU in the alarm message area from bit 0 in ascending order C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 8 7 Data Areas for Communication between the C7 OP and the C7 CPU 8 4 Keyboard and LED Image Application Prerequisite Transfer Value Assignment 8 8 Key actions on the C7 OP can be transferred to the C7 CPU and evaluated In this way an action for instance switching on a motor can be triggered in the C7 CPU The LEDs in the C7 s function keys can be controlled It is therefore possible to signal the user via a lit up LED which key they should press depending on the situation In order to make use of this option you must configure the appropriate data areas so called images in the C7 CPU and declare them as area pointers during the configuration The keyboard image is spontaneously transferred That means the transfer always happens if a change is registered at the C7 OP In this case you do not need to configure a polling time A maximum of two simultaneou
181. iggered hardware interrupt 1 when universal input 4 has triggered hardware interrupt Figure 4 7 Additional Information Z2 Additional Additional information Z3 is not used and is set to 0110p Information Z3 Evaluation in User The evaluation of hardware interrupts in the user program is described in the Program manual 120 C7 626 C7 626 DP Control Systems 4 26 C79000 G7076 C627 01 Addressing Assigning Parameters and How the C7 I O Works 4 4 4 Counters Counters Actual Value of Counter Counting Up Counting Down Exceeding the Threshold Frequency aS The counter calculates the value of the count from the count pulses up or down You can assign parameters with the STEP 7 function Hardware Configuration for whether Counter pulse is triggered by a rising or falling edge at the corresponding universal input e Counting should be up or down The counter calculates the actual value according to the following formula Actual value up counter number of edges or Actual value down counter start value number of edges Counting up starts at zero or continues from the last counter value and until the selected comparison value is reached The start value after resetting the counter is always zero The comparison value is set by the user program Counting down starts from the selected start value back or continues from the last counter value until the value zero is reached Start valu
182. ing Device Functions 1 6 All messages and texts for screens can be stored in the C7 in up to three different languages This permits international use even when operating personnel speak different languages The Status Force Variable programming device functions are available for testing and troubleshooting They can be used on the C7 OP to specify and change address areas in the C7 CPU This makes on site troubleshooting fast even without a programmer C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Introduction 1 3 Overview of C7 The SIMATIC C7 626 C7 626 DP control systems consist of several components that are optimally tuned to one another A CPU from the SIMATIC S7 300 PLC range C7 CPU A graphic oriented COROS OP C7 OP with printer port Integral digital and analog I O C7 I O An integrated IM 360 module C7 IM for expanding the C7 626 or C7 626 DP with S7 300 modules An interface for communicating with programming devices PCs and further S7 CPUs C7 control systems and OPs A DP interface to connect DP slaves C7 C7 PLC CPU memory OP memory C7 OP C7CPU C70P kK C7 _ DP interface i Printer 1 1 i 1 k 1 i port k gt C7VO C7 IM MPI STEP 7 ProTool
183. ing sublists can be evaluated in addition to those in Table B 1 by Sublist Module status information of a module Index ID of the Individual Records of the Sublist Module start address the C7 626 DP in its function as DP master Sublists of the System Status List of the C7 626 DP as DP Master Record Contents Sublist Excerpt Features parameters of the module Status information of module rack or stations in DP network Target status of racks in central configuration or of stations in a subnet Actual status of racks in central configuration or of stations in a subnet 00004 Subnet ID Information of status of racks in central configuration Information of status of stations in a subnet Module diagnostics Complete module dependent record of the module diagnostic information Complete module dependent record of the module diagnostic information C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Module rack and slot number Module start address Module dependent diagnostic information B 7 C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 C7 OP Functionality Standard Screens C Control Jobs System Messages Summary of You WiFi Control Jobs and Their Parameters C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 C7 OP Functionality Standard Screens Control Jobs System Messages C 1 Table with List of Functions Table C 1
184. ion Down If counter activated then define the edge to be used Rising for counting Falling If counter activated then the counter can trigger a Yes No hardware interrupt after reaching the comparison No value when counting up or a zero transition when counting down 0 1 s Is If frequency counter selected then select the gate time for the frequency counting ls 10s No further parameters for period time counter Digital Inputs 4 24 If the universal inputs are deactivated in the parameter block default setting then the inputs react as digital inputs However no automatically updated process image will be made available to the user program for these inputs The current state of the input can only be read by means of a direct T O access Sed Table 4 15 of 4 16 for address C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Addressing Assigning Parameters and How the C7 I O Works 4 4 3 Interrupt Inputs Introduction Assignable Events Hardware Interrupt OB Declaration Section of OB40 Additional Information Z1 If universal inputs are used as interrupt inputs then a hardware interrupt will be generated at every corresponding assigned edge at one of the inputs The parameter assignment can be performed with the STEP 7 function Hardware Configuration If a hardware interrupt is sent from the I O to the C7 CPU then the hardware interrupt OB OB40 will be called by the C7 C
185. ion Exection No Time 33 SSTI_TIM Convert S5 TIME data format to TIME data format approx 80 us 40 TIM_SSTI Convert TIME data format to S5 TIME data format approx 160 us Duration STEP 7 provides the following IEC functions for operations with times FC Name Description Execution No Time 1 AD_DT_TM Add a duration in the TIME format to a time in the DT format The 0 75 ms result is a new time in the DT format 35 SB_DT_TM Subtract a duration in the TIME format from a time in the DT format 0 75 ms The result is a new time in the DT format 34 SB_DT_DT Subtract two times in the DT format The result is a duration in the 0 7 ms TIME format C7 626 C7 626 DP Control Systems A 6 C79000 G7076 C627 01 SFCs and SFBs in the C7 CPU Compare STEP 7 provides the following IEC functions for comparing the contents of DATE_AND_TIME variables in the DATE_AND_TIME data format Execution Time Compare the contents of two variables in the 190 us DATE_AND_TIME format for equal to Compare the contents of two variables in the 190 us DATE_AND_TIME format for greater than or equal to Compare the contents of two variables in the 190 us DATE_AND_TIME format for greater than Compare the contents of two variables in the 190 us DATE_AND_TIME format for less than or equal to Compare the contents of two variables in the 190 us DATE_AND_TIME format for less than Compare the contents of two variables in the 190 us DATE_
186. ipes ORANGE GRAPEFRUIT and LEMON are run parallel on these production lines Each of the recipes contains a drink data record These three data records make up the parameter record called drink At the beginning of a shift for example each of the three production lines must be set to produce a special drink You can do this with just one load operation A parameter record is processed in the Data Record Processing screen in the same manner as a data record The following can be performed on a parameter record e Select e Store set up e Load e Delete Parameter Record must be selected as the recipe name in the Recipe symbolic field Note When parameter record is selected as the recipe all data records of all recipes are indicated after the SELECT softkey is pressed in the data record selection window Parameter records data records which exist more than once with the same name are identified with an asterisk preceding the name You enter the message level by pressing 7 E C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Standard O I Functions Saving Setting Up Loading Deleting Editing There are two ways to set up that is to save on a data medium a parameter record in the Data Record Processing screen a Save a data record for each recipe 1 Select Parameter Record as the recipe 2 Specify data record name and data medium 3 Save parameter r
187. isplayed at the same time you can scroll through the display with the cursor keys C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Operating the C7 General 6 8 Hardware Test Calling the Test Program Test Sequence Exiting the Test Program The following function units can be tested with the C7 OP hardware test e Internal memory and memory module interface e Serial interfaces e Keyboard and display e Internal function units for example watchdog or real time clock While turning on the power supply of the C7 press the V pressed until the test menu is indicated cursor keys simultaneously and keep them The test program provides a series of individual tests each of which can be started with a function key F9 to F14 and K1 to K10 The test results appear on the display after an individual test is concluded OK No errors DEF The tested function unit is defective The test program can only be exited by switching off the power supply of the C7 C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 6 25 C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Standard O I Functions Summary of Sections Fis sists x TAA Standard Screens 7 2 Messages 121 Event and Alarm Messages Current Messages Stored Messages Standard Screen Message Processing System Messages Recipes Processing and Transferring Data Records Setting Up and Editin
188. ist is not deleted 125 Language changed by standard screen or control job 131 Mode change 133 Mode change 135 Mode change 136 No response from controller Check program execution in controller or physical connection 138 Data block no x not available in controller memory Create memory space C7 626 C7 626 DP Control Systems C 12 C79000 G7076 C627 01 C7 OP Functionality Standard Screens Control Jobs System Messages Message Cause Remedy 200 Back up battery voltage has fallen below minimum Replace battery value or wrong battery type inserted 201 Error during clock chip write hardware error Return device for repair 202 Error reading date Re enter date return C7 for repair 203 Error reading time Re enter time return C7 for repair 204 Error reading day Re enter day return C7 for repair 205 Printer not ready and internal storage of print jobs is Ready printer or disable message log no longer possible capactity exceeded 206 Printer not ready print job will be stored temporarily Ready printer 207 Print job aborted Check printer cable and connector 210 Internal error Refer to remedy for internal errors 212 Internal error Refer to remedy for internal errors 213 Off line mode not possible at present Try mode change again later 214 The job number configured by the C7 CPU or ina Check user program and screen is too large configured p
189. l input 2 set Bit 0 universal input 2 reset Bit 2 Bit 1 universal input 3 set Bit 0 universal input 3 reset Bit 3 Bit 1 universal input 4 set Bit 0 universal input 4 reset Bit 4 Bit 1 Counter counting Bit 0 Counter stopped Bit5 Bit 1 Counter2 counting Bit 0 Counter2 stopped Bit 6 Bit 1 Counter3 counting Bit 0 Counter3 stopped Only relevant when universal input is assigned as counter input C7 626 C7 626 DP Control Systems 4 20 C79000 G7076 C627 01 Addressing Assigning Parameters and How the C7 I O Works Output Range If the universal inputs are used as counters then the behavior of the counters is controlled via the output range Table 4 17 Addresses and Weighting of the Output Range of the Counter Inputs Address Control of Counter 1 3 PQW274 Start comparison value counter 1 PQB276 BitO 0 Counter1 disabled 1 Counter enabled Bit 1 0 New start comparison value not valid 1 Set new start comparison value PQW277 Start comparison value counter 2 PQB279 BitO 0 Counter2 disabled 1 Counter 2 enabled Bit 1 0 New start comparison value not valid 1 Set new start comparison value PQW280 Start comparison value counter 3 PQB282 BitO 0 Counter3 disabled 1 Counter 3 enabled Bit 1 0 New start comparison value not valid 1 Set new start comparison value Initial value for down counter comparison value for up counter
190. l interrupt preparation time conversion time The internal interrupt preparation time of the analog input modules can be neglected Please refer to the data sheet of the respective analog input module for conversion times Hardware interrupt processing begins when the hardware interrupt OB OB40 is called Higher priority interrupts cause the hardware interrupt processing to be interrupted Direct access to the I O is made when the instruction is processed When the hardware interrupt processing has finished either cyclic program execution continues or further interrupt OBs of higher priority or the same priority are called up and executed To recap the hardware interrupt response time consists of e The hardware interrupt response time of the CPU e The hardware interrupt response time of the signal module Example In the example the C7 I O is to be used exclusively C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 3 33 Controlling with the C7 CPU Calculation For the example the hardware interrupt response time is calculated from the following times e Hardware interrupt response time of the C7 CPU approx 1 1 ms e Hardware interrupt response time of the module Internal interrupt preparation time 0 2 ms Input delay 0 1 ms The hardware interrupt response time is calculated from the sum of the times below Hardware interrupt response time 1 1 ms 0 2 ms 0 1 ms approx 1 4 ms This hardw
191. lator 1 of the level 45 us causing the error Status Changes You can influence the CPU status with the following system functions Name Description Execution Time oa WAIT Implementing waiting times a us Address For allocating the free address of a module to the associated rack and slot you Assignment can use the following SFCs SFC No Name Description Execution Time SFC 5 GADR_LGC Determining the free address of channel x of the signal module in slot y SFC 49 LGC_GADR Converting a free address into the associated slot and rack 140 us number of a module SFC 50 RD_LGADR Calculating all the predefined free addresses of a module 190 us C7 626 C7 626 DP Control Systems A 4 C79000 G7076 C627 01 SFCs and SFBs in the C7 CPU Diagnostic Functions information You can use the following system functions to read and write diagnostic buffer Description Execution Time Read the information out of the system status list 280 us 200 us data set Write specific diagnostic information into the diagnostic 110 us Module The C7 CPU places the following system functions at your disposal for Initialization writing and reading initial module parameters Functions SFC No Name Description Execution Time SFC 55 WR_PARM Writing dynamic parameters to a module 1 6 ms SFC 56 WR_DPARM Writing predefined parameters to a module 1 75 ms SFC 57 PARM_MOD Assigning parameters to a modu
192. le 2 2 ms SFC 58 WR_REC Writing a module specific data record 1 4 ms 32 us byte RD_REC Reading a module specific data record 0 49 ms Functions for the DP Master aa DPNRM_DG Read slave diagnostics coded according to DP standard DPRD_DAT Read consistent user data from DP standard slaves with a DP standard identifier gt 4 bytes DPRWR_DAT Write consistent user data from DP standard slaves with a DP standard identifier gt 4 bytes Description The C7 DP CPU provides the following system functions as DP master Execution Time approx 180 us approx 180 us approx 180 us C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 A 5 SFCs and SFBs in the C7 CPU A 2 IEC Functions DATE_AND_TIME STEP 7 provides the following IEC functions for operations with the data formats DATE TIME_OF_DAY and DATE_AND_TIME FC Name Description Exection No Time 3 D_TOD_DT Combine the data formats DATE and TIME_OF_DAY TOD and approx convert to data format DATE_AND_TIME 680 us 6 DT_DATE Extract the DATE data format from the DATE_AND_TIME data approx format 230 us 7 Extract the day of the week from the data format approx DATE_AND_ TIME 230 us 8 DT_TOD Extract the TIME_OF_DAY data format from the approx DATE_AND_TIME data format 200 us Time Formats STEP 7 provides the following IEC functions for converting the time formats S5 Time and Time FC Name Descript
193. lection Field SFB SFC Signal Module Softkeys STARTUP Start Up Test Glossary 10 A personal computer with a special compact design suitable for industrial conditions A programming device is completely equipped for programming the SIMATIC programmable logic controllers The Random Access Memory or RAM is a read write memory in which each memory location can be addressed individually and have its contents changed RAM is used as a memory for data and programs Reference data are used to check your C7 CPU program and include the cross reference list the I Q M reference list the program structure the list of free addresses and the list of missing symbols The STEP 7 User Manual describes how these data can be displayed Retentive data areas and retentive timers counters and bit memory retain their contents in the case of a complete restart or power off Field provided for assigning values to a parameter values can be selected from a list of permissible values System Function Block System Function Signal modules C7 I O form the interface between the process and the C7 There are digital input and output modules and analog input and output modules Keys with variable assignments depending on the current display entry The C7 CPU goes through the STARTUP mode during the transition from the STOP mode to the RUN mode Checking the CPU status and the memory status each time the C7 is powered up C
194. lel to display output Module parameters are values with which the behavior of the module can be set A distinction can be made between static and dynamic module parameters Multipoint Interface The multipoint interface is the programming device interface in SIMATIC S7 It allows a number of programmable modules text display operator panels and operator panels to be accessed from a central unit The nodes on the MPI can communicate with each other Each node is identified by an address MPI address C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Glossary 7 Glossary N Nesting Level Network Normal Operation OB OB Priority Operating System of the C7 CPU Organization Block OB Output Field Glossary 8 A block can be called from another block by means of block calls The nesting level is the number of simultaneously called logic blocks A network is a number of C7 systems and or S7 300 systems and further terminals such as programming devices linking together by connecting cables for the purpose of data communication Operating mode of the C7 in this mode messages are displayed and entries can be made in screens Organization Block The operating system of the C7 differentiates between various priority classes for example cyclic program processing hardware interrupt controlled program processing gt Organization blocks OBs are assigned to each priority cla
195. lue The method of entry varies depending on the type of field See the following subsections for information on handling the individual fields 3 Confirm the entry with the ENTER key The following means of correction are available before the entry is applied e Using the INS DEL key insert delete single characters where the cursor is positioned Then use the ENTER key to confirm the correct value e Cancel the entry with the ESC key The original value is then automatically rewritten in the field Enter the correct value and confirm with the ENTER key An edit function is available which can be used to edit existing entries 1 Position the cursor on the desired input field 2 Activate edit mode by pressing the INS DEL key In contrast to input mode the indicated value is retained 3 Move the cursor to the appropriate position of the input field Using the INS DEL key insert delete characters where the cursor is positioned 4 Confirm the entry with the ENTER key The entry can be canceled with the ESC key The old value is indicated again C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Operating the C7 General 6 3 1 Numeric Fields Input Mode The shape of the cursor changes in input mode Input starts at the right hand edge of the input field Digits are shifted to the left similar to a pocket calculator
196. lues in the respective value range e The influence of errors on the analog I O Influence of the The input and output values of the analog I O are dependent upon the supply Supply Voltage voltage of the analog I O and the operating mode of the C7 and the Operating The triggering of a diagnostic interrupt is dependent upon the parameter Mode assignment Table 4 11 gives an impression of these inter relationships Table 4 11 Dependencies Between Analog Input and Output Values upon the Operating State of the C7 and upon the Supply Voltage L Operating State of C7 Input Value of the Analog Input Output Value of the Analog Output POWER ON Process value C7 value Process value Substitute value or retain last value configurable Influence of the The behavior of the analog input is dependent upon the area of the value Value Range on range in which the input value lies Table 4 12 illustrates these dependencies the Input for the analog input values Table 4 12 Behavior of the Analog Input in Relation to the Position of the Analog Input Value in the Value Range Process Value lies in Input Value Diagnostics Interrupt Nominal range Process value Upper range lower Process value range Overflow underflow 7FFFy Message Diagnostic interrupt 1 According to parameter assignment C7 626 C7 626 DP Control Systems 4 16 C79000 G7076 C627 01 Addressing Assigning Parameters and How the C7 I O Works
197. ly The actual update time improves if you configure one large area as opposed to several small areas e The total performance is unnecessarily compromised if the polling times are too small Set the polling time according to the changing speed of the process values The change in temperature of an oven for example is significantly more sluggish than the change of rotary speed in an electrical drive The approximate value for the polling time is around 1 second e Avoid cyclic transfer of the user data area Polling time 0 Instead use the control jobs to allow event controlled transfer of user data areas only if necessary e Place the variables of a message or a screen without gaps in one data area e In order that changes in the C7 CPU are recognized by the C7 OP they must at least be impending during the actual polling time Screens If in the case of bit triggered trends the communication bit is set in the trend transfer area the C7 OP updates all those trends every time whose bit is set in this area Thereafter it resets the bit If the bit is reset immediately in the program the C7 OP is busy the whole time updating the trends Operation of the C7 OP is then virtually no longer possible C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 8 27 C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 SFCs and SFBs in the C7 CPU A Summary of You Wal Fi C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 A
198. mode STOP is valid only for the C7 CPU It is not valid for the C7 OP Further processing with the C7 OP is possible MRES F12 Memory reset Resetting the C7 CPU erase memory reload user program from flash memory requires a special operating sequence of the modes STOP and MRES see Section 2 3 If data that are required by the configuration are destroyed during the memory reset then a corresponding error message is issued by the C7 OP Note The MRES position is not a momentary contact state which means that the MRES status persists For the C7 CPU the MRES status is only a control mode When this mode is set permanently the C7 CPU does not function properly This mode must therefore always be reset prior to exiting the menu with STOP RUN or RUN P C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 2 9 Commissioning Startup DI DO Status Table 2 2 explains the status display Display Table 2 3 Explanation of the DI DO Status Display in Figure 2 5 Point Explanation Signal state of the DI DO e 1 DI DO set e 0DI DO reset Pin number from to See also pin assignment in Section 2 5 of Volume 1 Note The values of the DI DO are read and displayed every 500 ms unless otherwise configured Changes which occur between these times are not displayed Mode Change To prevent uncontrolled C7 CPU mode changes during process control Protected by operations
199. n Johanneslandsvagen 12 14 00 46 8 7 28 14 64 Fax 00 46 8 7 28 18 00 Switzerland 1020 Renens Lausanne Siemens Albis SA Systemes dautomation VHRL Mrs Thevenaz 5 Av des Baumettes BP 1 53 0041 21 6 31 83 09 Fax 00 41 21 6 31 84 48 8047 Z rich Siemens Albis AG VHR 3 Mr Engel FreilagerstraBe 28 40 T 0041 1 495 58 82 Fax 0041 1 4 95 31 85 Turkey 06680 Ankara Kavaklidere SIMKO ANKARA Mr Ensert Atat rk Bulvari No 169 6 00 90 312 4 18 22 05 80040 Findikli Istanbul SIMKO TIC ve SAN A S AUT 1 Mrs Yargic Meclisi Mebusan Cad No 125 B00 90 212 251 17 06 Fax 0090 212 2 52 39 16 Ukraine 252054 Kiew 54 Siemens Representative AUT Mr Liebschner UI Worowskowo 27 007 044 2 16 02 22 Fax 007 044 2 16 94 92 C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Siemens Worldwide SIMATIC Contact Outside Europe Africa Algeria 16035 Hydra Alger Siemens Bureau d Alger Division Energie Mr Bennour 44 rue Abri Areski P O Box 112 T 213 6 60 40 88 Fax 213 2 60 65 98 Egypt Zamalik EGY Cairo ELETECH AUT Mr W Y Graiss 6 Zarkaria Rizk Street P O Box 90 B 20 2 3420371 Fax 20 2 3 42 03 76 Ivory Coast Abidjan 15 R C Siemens AG SEMEN Mr Hellal 16 P O Box 1062 B 2 25 37 46 57 Fax 2 25 27 10 21 Libya Tripoli Libya S P L A J Siemens AG Branch Libya Mr Wahab Zat EL Imad Building Tower No 5 Flo
200. n a memory double word as a floating point number to the corresponding hexadecimal pattern analog value which must be output to a peripheral output word For this purpose a simple calculation using the rule of three is programmed 1 First the setpoint is related to the total range RANGE_DEC resulting from the difference upper limit lower limit The result is a percentage of the absolute setpoint value This is identical in the floating point number and in the hexadecimal representation 2 Then the total range RANGE _DEC resulting from the difference UL LL is calculated in hexadecimal representation depending on whether the measuring range is unipolar or bipolar 3 Now the percentage PERCENT calculated before is related to the total hexadecimal range RANGE_HEX The result is the absolute value to be output 4 Finally the lower limit LL is added to this value as offset 5 The resulting bit pattern is output PERCENT setpoint lower limit upper limit lower limit RANGE_DEC upper limit lower limit RANGE_HEX UL LL Channel PERCENT RANGE_HEX LL C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Addressing Assigning Parameters and How the C7 I O Works FC127 Sequence of Statements The FC127 function block contains the following statement lines FUNCTION FC 127 void var_input lower limit DWORD upper limit DWORD setpoint DWORD end_var var_temp LL DWOR
201. n screen with a softkey On the C7 OP the display is split into two lines Status Variable 12 DB DBB 100 10 BIN 00000000 00000000 1 22222 0 222222222 0 1 22222 0 22222222 0 1 22222 0 222222222 0 1 222222 0 222222222 0 Status ESC Update running Start Stop update Return to the main screen Figure 7 8 Status Variable Screen of C7 OP and SIMATIC S7 C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Standard O I Functions Addresses Figure 7 9 shows an example of the layout of a line 001 DB DBD 12 1438 DEZ 1820 L Address value Data format Address For data types DBB DBW and DB DBD DB number of the DB DD DB number Only applicable to data types DBB DBW DBD and DBX Data type MPI address Entry of the address of the controller Figure 7 9 Example of the Controller Addresses Operating To view address values in the controller proceed as follows Procedure for STATUS VAR Key Description Softkey Enter After the screen is selected status processing is in status Status stop address indicated in the center of the bottom of the screen 1 Enter data type for first address symbolically via pop up window 2 Enter address and DB number for data types DB DW and DB and DP 3 Enter data format symbolically via pop up window 4 Repeat entries for the 2nd to the n addresses Note A system mess
202. n the Edit Window C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 7 23 Standard O I Functions Using the edit window es De 1 Select the value to be changed the comment field with the cursor key optional Note Comments entered in the data record transmission screen are not included in the edit window 4 Accept new EJ A safety prompt appears values ENTER 0 Yes New values will be entered in the data record and the edit window closed 1 No Continue to use edit window A safety prompt appears Or cancel entry ESC 2 Enter new Only decimal numbers and strings are value permissible 3 Enter comment Starting from the top input field you can reach C7 626 C7 626 DP Control Systems 7 24 C79000 G7076 C627 01 Standard O I Functions Accepting Values from the Controller Copying Data Records If you want your data records to contain the current values from the controller perform the following steps in the Data Record Processing screen 1 Select recipe to which a data record is to be assigned 2 Enter data record name and comment comment is optional 3 Select a data medium on which you want the data record stored 4 Store the data record The current values from the controller will now be transferred to the C7 OP and stored as a data record on the data medium you have selected The time at which the storage to
203. nal will be transferred Y to the outputs here Pll Operating 1 system Ev ati Sa Bus processing times in the PROFIBUS DP network _ Figure 3 4 Longest Response Time C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 3 27 Controlling with the C7 CPU Calculation The longest response time can be calculated as follows e 2x process input image transfer time e 2 x process output image transfer time e 2x operating system execution time e 2x program execution time e Processing time for S7 timers e Input and output delay times The input delays are not marked in the diagram Depending on the module however you have to take into account the following delay times e For digital inputs input delay time e For digital outputs negligible delay times e For analog inputs scan cycle time of the analog input e For analog outputs response time of the analog output Extending the As a rule you should remember that the scan cycle time of a user program Scan Cycle Time will be increased by e Time controlled processing e Hardware interrupt processing e Diagnostics and error processing e Communication via the multipoint interface Reducing the You will achieve faster response times by means of direct access to the I Os Response Time in the user program for example with L PIB or T PQW This method helps you avoid prolonged scan cycle times as described in Figure 3 4 C7 626 C7 626 DP Cont
204. ndex 3 Index Data mailbox Data record C7 CPU gt C7 OP C 8 C7 OP gt C7 CPU C 8 edit window selecting 7 22 Data record processing 7 19 Data record transferring 7 20 Data records addressing copying editing recipes setting up 7 23 transferring synchronization Data records processing 7 23 Date 8 17 setting Date and time Default password 2 10 DELETE A 8 Deletion message buffer Description OB 3 6 DI DO status display explanation DIL_STRNG Diagnostic entry Meen 4 17 Diagnostic area layout 5 5 Diagnostic pur Basis layout 5 Diagnostic channel specific standard Diagnostic data Diagnostic errors permanent temporary 5 3 Diagnostic evaluation Diagnostic events Diagnostic interrupt CPU 3 7 Diagnostic interrupt response time calculating 3 35 calculation example 3 35 Index 4 Diagnostic messages display incorrect parameter 5 10 overflow 5 10 possible elimination 5 9 reason response sending underflow wire break Diagnostics analog input analog output C7 I O enabled parameter assignment 5 2 parameter block 4 7 4 7 4 9 Digital inputs 3 4 universal inputs a Digital SER T Direct 8 22 Ba Display blanking circuit brightness contrast Down counter DP address assignment DP address space of the CPU DP addresses universal inputs DP interface C7 DP CPU DP master ad
205. nge juice It is similarly possible to fetch data from the C7 CPU and to store them on the C7 OP as a data record to save say a favorable assignment of values Note With graphic displays only the variables are used for transferring data records To transfer a data record to the S7 from a data medium flash it must first be loaded to the variables To insure a coordinated procedure for transferring data records and to prevent any uncontrolled overwriting of data bits are set in the control and checkback byte 3 of the interface area C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 8 21 Data Areas for Communication between the C7 OP and the C7 CPU 8 9 1 Transferring Data Records Definition Direct Transfer Indirect Transfer Data records can be transferred by two different methods from the C7 OP to the PLC or from the PLC to the C7 OP The two methods of transfer are direct and indirect When a data record is written the variables in the data record are written directly to the defined addresses concerned With direct reading the variables are read into the C7 OP from the system memories of the C7 CPU With ProTool the variables must have a direct link to the C7 CPU and the write directly attribute for direct transfer Variables not having an assigned address on the C7 CPU are not transferred All the variables in the data record are written to a clipboard known as the data mailbox on
206. nt 7FFF is Assign correct parameters Parameter checking the parameter after set in the incorrectly reading and processing the parameter area configured measurement channel and the corresponding diagnostic bit set or for an output channel 0 V 0 mA is output and the corresponding bit set If the module had not been assigned a parameter and the parameter is corrected then the bit incorrect parameter is reset and if diagnostic interrupt yes a diagnostic interrupt reported to the C7 CPU 5 10 C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Operating the C7 General Summary of sraon C TT C CS CSc SA CE C a E Note The explanations in this chapter relate to the so called standard screens which are supplied in a standard configuration with the configuration tool ProTool The special screens are called up via the standard screens The standard screens may be redesigned for a customized operator interface However the special screens are stored permanently in the C7 firmware and can therefore not be modified C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 6 1 Operating the C7 General 6 1 Screen Layout Overview One screen takes up the entire display An example of a possible layout is shown below Fixed window Main screen area Icons for softkey functions Figure 6 1 Screen Layout for the C7 Fixed Window The fixed window provides th
207. nterface module L screen no Enter first parameter screen no into T DBW 6 job area of the interface module L Input number Enter 2nd parameter into T DBW 8 job area of the interface module L Field no Enter 3rd parameter field no into T DBW 10 job area of the interface module L 51 Enter the job no into the job area of the T DBW4 interface module and activate the job Figure 8 6 Example for a C7 CPU Program 8 20 C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Data Areas for Communication between the C7 OP and the C7 CPU 8 9 Recipes Definition Transferring Data Records Synchronization A recipe is a group of variables for a fixed data structure You set this structure in your configuration and assign data to it on the C7 OP You cannot modify the structure on the C7 OP later Since the data structure can be assigned several times we refer to data records These data records are stored created loaded deleted and modified on the C7 OP The data are stored on the C7 OP thus saving memory on the C7 CPU The use of recipes insures that when a data record is transferred to the C7 CPU several items of data are transferred to the C7 CPU together and in a synchronized fashion Data records can be transferred from the C7 OP to the C7 CPU or from the C7 CPU to the C7 OP You transfer data records from the C7 OP to the C7 CPU to set specific values on the C7 CPU for example to produce ora
208. ntive Because of their retentive nature any new Data Blocks settings made in the data blocks are ineffective while the back up battery is supplying enough power C7 626 C7 626 DP Control Systems 3 16 C79000 G7076 C627 01 Controlling with the C7 CPU Parameter Block Table 3 11 lists the parameters of the parameter block Retentive Areas Retentive Areas The retentive area for all areas bit memory timers counters and data bytes may not be larger than for the sum of all the parameters listed in Table 3 11 Table 3 11 Parameter Block Retentive Areas Parameter Explanation Value Range Default C7 Setting Memory bytes The parameter value entry is the number of retentive 0 to 256 16 memory bytes from memory byte 0 Timers The parameter value entry is the number of retentive S7 0 to 128 0 timers from timer 0 space required 2 bytes timer Counters The parameter value entry is the number of retentive S7 0 to 64 8 counters from counter 0 space required 2 bytes counter Data areas Max 8 data areas may be retentive with a maximum of Data block number 4096 bytes The start address of the data area the From 1 1 number of data bytes may not exceed 8191 to 127 Number of bytes From 0 0 to 4096 Byte address start From 0 0 address of the data to 8191 area 3 6 5 Parameter Block Hardware Interrupts Parameter Block Table 3 12 lists the parameters of the parameter block Hardware Interrupts Har
209. o nz The menu with the C7 CPU Operating Modes RUN P RUN STOP MRES will be displayed 3 Select the STOP function by pressing the corresponding function keys The STOP LED lights up 4 Select the MRES function memory reset and wait approximately three seconds until the STOP LED lights up again 5 Immediately after the STOP LED lights up again select STOP with the corresponding function keys and then MRES a second time Result Ifthe STOP LED flashes for approximately three seconds and then lights up again everything is O K the C7 CPU has been completely reset Ifthe STOP LED does not flash or other indicators light up or flash exception BATF LED repeat steps 4 and 5 perhaps evaluate the diagnostic buffer of the C7 using the programming device Ifthe BATF and the SF LEDs on the C7 light up the back up battery is missing If a back up battery is indeed fitted then you must search the diagnostic buffer of the C7 CPU for additional error entries 6 In order to be able to continue working you must set the C7 CPU to STOP or RUN RUN P Note The contents of the flash memory remain see alsq Section 3 10 C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Commissioning Startup Procedure in the C7 CPU During Memory Reset What Remains after Resetting the C7 CPU The STOP LED flashes during the memory reset of the C7 CPU and the following process is
210. oad memories in the C7 CPU e Layout of the load memory e Number and area for the inputs outputs timers counters and bit memory e Area for local data e C7 system behavior C7 626 C7 626 DP Control Systems 3 40 C79000 G7076 C627 01 Controlling with the C7 CPU List of Test Table 3 22 lists the test functions of the C7 CPU Functions Table 3 22 Test Functions of the C7 Test Functions User Status variable Observe selected process variables inputs outputs bit memory timers counters data at a specified position in the user program start of cycle end of cycle transition RUN STOP Force variable Assign a value start of cycle end of cycle transition RUN STOP to selected process variables inputs outputs bit memory times counters data at a specified position and thus control the user program directly Block status Observe a block with regard to the program sequence to aid commissioning and fault finding Block status offers the possibility of observing certain register contents during the execution of statements for example ACCUs address register status register DB register C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 3 41 Controlling with the C7 CPU 3 10 Loading Erasing the C7 CPU Flash Memory Overview During transmission of a user program to the C7 CPU it is transferred only to the load memory and not automatically into the C7 CPU flash memory ROM as well
211. ok place is also included Note If the recipe does not yet contain a data record with the same name the record is stored immediately Otherwise you will be asked if you really want to store the record before it is overwritten 5 To set up additional data records repeat steps to 4 for each data record Copying means that you use the current values in the C7 OP as your basis and transfer these values to the data medium under different data record names You can then edit or adjust these data records later Proceed as described below in the Data Record Transmission screen 1 Select recipe 2 Enter data record name and comment comment is optional 3 Transfer data record from the C7 OP to the data medium 4 Repeat steps to 3 for each new data record C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 7 25 Standard O I Functions 7 3 3 Parameter Records Definition Example Processing Selection Selecting Message Level 7 26 The parameter record is a combination of one data record each from various recipes with a common name The data records of a parameter record contain all values required to set a machine or plant For example you can use a parameter record to load the basic settings for machines which are identically equipped but produce different products We will now expand our example of a fruit juice plant to include three identically equipped production lines The rec
212. onfiguring computer programming device PC to the C7 OP This procedure is described in the ProTool User s Guide Note The transmission rate is fixed at 187 5 Kbps With serial transfers the transfer of the configuration is carried out via a V 24 connection between the programming device PC and the C7 OP To load the configuration proceed as follows 1 Connect the V 24 interface of the C7 OP with the configuring computer programming device PC using a suitable standard cable 2 Switch on the C7 power supply 3 During startup press the key combination a T se 2 to switch to the transfer mode of the C7 OP In the top line of the display the following line appears Trans Mode 4 Transfer the configuration from the programming device PC to the C7 OP The existing configuration in the C7 OP will then be overwritten with the new configuration Once the transfer has been successfully completed the C7 OP will restart and display the start up screen of the loaded configuration C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 2 7 Commissioning Startup 2 5 Selecting the C7 CPU Operating Mode and the DI DO Status Display System Function Menu Selecting the System Function Menu 2 8 You can select the system function menu from all operating modes From this menu the following functions can be selected RUN P RUN STOP MRES The DI DO status
213. ontroller Check the configuration 551 Controller address cannot be found C 18 C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 C7 OP Functionality Standard Screens Control Jobs System Messages Message Cause Remedy 600 Wrong parameter transferred by ProTool Lite Set required value by means of overflow warning standard screen or controller 601 Wrong parameter transferred by ProTool Lite Set required value by means of message log standard screen or controller 602 Wrong parameter transferred by ProTool Lite Re configure and repeat download of remaining buffer size required value 603 Recipe setpoint is only set up symbolically 604 Message not configured for a set message bit Configure messages and repeat download 605 Process connection only configured symbolically 606 Too many message variables are configured 607 Configured data type does not exist 608 Screen number does not exist 609 Special object control operator object for message text does not exist or is not allowed 610 Control operator object for header or footer does not exist or is not allowed 611 Special operator object for buffer printout does not exist 613 Data block does not exist or is too short Create DB or required length in controller 614 The layout of the listing had not been configured when the print job was issued 615 Line to be output is larger than the reserved print
214. or No 9 P O Box 91 531 B 218 21 415 34 Fax 218 21 4 79 40 Morocco Casablanca 05 SETEL S A AUT Mr El Bachiri Immeuble Siemens km 1 Route de Rabat Ain Sebaa 212 2 35 10 25 Fax 212 2 3401 51 Namibia windhoeke eed T aoe iemens td Mr J rgen Hot 9 Albert Mak Street 2 Industries North P O B 23125 B 2 64 61 6 13 58 59 Fax 2 64 61 6 13 77 South Africa RSA 2001 Braamfontein Siemens Ltd AUT Mr E Hillermann Siemens House SH 401 Corner Wolmarans amp Biccard Streets P O Box 4583 2000 Johannesbur B 27 11 407 41 11 B 27 11 407 48 15 Fax 27 11 4 07 46 82 Tunisia TN 2062 Romana Le Bardo FAZE Sarl Electrotechnique Mr Fantar Immeuble Cham 216 1 519091 Fax 2 16 1 50 19 32 TN 2035 Charguia II Tunis SITELEC S A Mr Mouelhi 16 Rue de l Usine Zone industrielle A roport BP 115 1050 Tunis Cedex B 216 1 700099 Fax 2 16 1 71 70 10 Zimbabwe Electro Technologies Corp Pvt Ltd Siemens Zimbabwe Mr Ron Claassens Savoy House cnr Inez Terrace J Moyo Ave P O Box 46 80 B 263 4 79 18 66 Fax 263 4 75 44 06 America Argentina 8000 Bahia Blanca Prov de Buenos Aires Siemens S A Mr S Duran Rudriguez 159 T 54 91 55 61 41 Fax 54 91 55 61 71 1650 San Martin rov de Buenos Aires Siemens S A PEI AUT Gral Roca 1865 Ruta 8 km 18 C C B 54 1 7 38 71 92 7 15 B 54 1 7 38 71 85 Fax 54 1 7 38
215. ostic Area of the Module This section describes the C7 analog I O and universal inputs with regard to their module specific diagnostic messages Table 5 1 provides an overview of the channel specific diagnostic messages of the analog input The diagnostic information is allocated to the individual channels Table 5 1 Diagnostic Message of the Analog Input Diagnostic Message Analog Input Parameter assignment error Synchronization error P short circuit M short circuit Wire break only for 4 20 mA by software Reference channel error Underrange underflow Overrange overflow Yes No No Yes Yes Only one collective error exists for the analog output Possible causes of the collective error could be e Parameter error e Substitute value is connected The diagnostic area consists of e Data set 0 the standard diagnostic bytes 0 3 e Data set 1 the channel specific diagnostic bytes for enabled diagnostics Bytes 4 7 and bytes 8 11 channel and individual information analog input AJ diagnostics Bytes 12 15 channel information analog output AO diagnostics C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 VO Diagnostics Table 5 2 illustrates the layout of the diagnostic area and the meaning of the individual entries Table 5 2 Layout of the Diagnostic Area Range 0 Module fault 1 error occurrence 0 everything OK
216. ows 2 seconds 7 days 286 ms day consequently you have to set a correction factor of 286 C7 626 C7 626 DP Control Systems 3 18 C79000 G7076 C627 01 Controlling with the C7 CPU 3 6 7 Parameter Block Time Of Day Interrupts Overview The C7 CPU can trigger time of day interrupts which you can activate and assign parameters to via the parameter block Time Of Day Interrupts Priority The priority of OB10 is fixed at 2 You cannot change this value Parameter Block Table 3 14 lists the parameters of the parameter block Time Of Day Time Of Day Interrupts Interrupts Table 3 14 Parameter Block Time Of Day Interrupts Explanation Value Range Default Setting Active OB10 Activation of OB10 Yes No No Execution OB10 Here you set the execution intervals in which the None None time of day interrupt should be triggered The Once only execution interval refers to the start date and the Every minute start time setting Every hour Every day Every week Every month Every year Start date OB10 The start date on which the time of day interrupt 1994 01 01 should be triggered Start time OB10 The start time at which the time of day interrupt 00 00 00 should be triggered The start time can only be entered in hours and minutes C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 3 19 Controlling with the C7 CPU 3 6 8 Parameter Block Cyclic Interrupts Overvi
217. password protection is activated when a configuration has been Password loaded The procedure is as follows 1 If the C7 CPU mode is to be changed the active password level is checked password level gt 8 is necessary 2 If the password level is not sufficient the Login screen for password entry is automatically displayed see Section 6 7 1 3 Enter password e You can only change the C7 CPU mode with a valid password e If no keys are operated within a time specified in the configuration an automatic log off is initiated reset of the current password level to 0 lowest level e Ifa password for level 8 has not yet been allocated you can only change the C7 CPU mode by means of the configured superuser password default 100 4 Ifthe password has been recognized as valid you can now change the C7 CPU mode Exiting the You exit the C7 CPU Operating Modes menu by pressing eee Mode F14 ESC The basic screen is then displayed again enu C7 626 C7 626 DP Control Systems 2 10 C79000 G7076 C627 01 Commissioning Startup 2 6 Resetting the C7 Overview Resetting the C7 OP What Remains after a Memory Reset of the C7 OP If you wish to achieve a neutral state of the C7 you must completely erase the C7 CPU and possibly also the C7 OP The C7 must be switched off To reset the C7 OP proceed as follows A 1 Depress and hold the following keys simultaneously V gt
218. period From this a period time can be calculated tp number of counted increments 0 5u1s In addition for every rising edge a counter is started that increases its value by 1 every 0 5 us until the next positive edge occurs The period time counter can be defined with a resolution of 0 5 us To obtain a measuring accuracy of lt 1 the optimal measuring procedure should be selected depending on the frequency involved Recommendation for using period time frequency counter Table 4 23 Period Time Frequency Counter Frequency Measuring Procedure 10 100 Hz Frequency counting Gate width 10 s 100Hz 1 kHz Frequency counting Gate width 1 s 1 10 kHz Frequency counting Gate width 0 1 s C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Addressing Assigning Parameters and How the C7 I O Works Explanation of Figure 4 10 illustrates a simple transducer The transducer delivers 1 when Principle Based the light passes through one of the slots in the disc If the discs rotates then upon a Simple the transducer delivers the signal shown in the diagram Transducer Signal p A s c Slot disc Signal 1st period 2nd period 3rd period 1 a goa lt 0 1 1 1 Increments l t A t L pan lt 1 bi tzi 0 5us Period Time Counter 4 44 o o SITA Gh picai a il z S Counter
219. polar or bipolar Now the percentage PERCENT calculated before is related to the total floating point number range The result is the absolute read in value Finally the lower limit LL is added to this value as offset The resulting floating point number is output C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 4 43 Addressing Assigning Parameters and How the C7 I O Works Summary of PERCENT channel LL UL LL Formulae RANGE_HEX UL LL actual value PERCENT upper limit lower limit lower limit FC126 Sequence The FC126 function block contains the following statement lines ofsiatements FUNCTION FC 126 void var_input lower limit DWORD upper limit DWORD channel DWORD end_var var_output actual value DWORD end_var var_temp LL DWORD RANGE_HEX DWORD PERCENT DWORD end_var BEGIN Case unipolar or bipolar measuring range L lower limit lower limit negative L 0 0 yes gt bipolar measuring range lt R JC bipo L DW 16 000_00000 unipolar range lower limit TLL JU comp bipo NOP 0 L W 16 9400 bipolar range lower limit ITD TLL Computing the range hexadecimal comp NOP 0 L W 16 6C00 upper limit for unipolar and bipolar range identical ITD LLL D T RANGE_HEX buffer difference C7 626 C7 626 DP Control Systems 4 44 C79000 G7076 C627 01 Addressing Assigning Parameters and How the C7 I O Works Calling
220. procedure finished Juice in the mixer 5000 1 The operator would now like to start the bottling procedure but has forgotten to open the filling valve The controller automatically stops the bottling procedure and outputs an alarm message The alarm message might look something like this Bottling procedure terminated Filling valve is closed Because of their urgency alarm messages must be acknowledged to ensure that the operator has noticed the message Acknowledgement can also be performed by the controller C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Standard O I Functions 7 2 2 General Features Available Methods of Indication Message Line Message Window Event Message Page Alarm Message Page Message Buffer Indication Priorities The C7 offers the following ways of indicating event and alarm messages You can indicate a current event or alarm message in a message line or in a message window You can configure one of the following combinations e Indicate an event or alarm Message Line message in the message line Event or Alarm Message e Indicate an event message in Message Line the message line and an Event Message alarm message in the Alarm Message Window message window Alarm Message e Indicate an event alarm message in the appropriate message window Event Message Window Alarm Message Window The opera
221. protection Performance characteristics of the C7 CPU DP address space DP slave load memory 3 4 work memory B Period Period time counter assigning parameters parameter 4 23 Period time measurement assigning parameters counter overflow principle 4 34 threshold frequency Period times clocks Permanent diagnostic error PLC job language switchover C 6 message log ON OFF C 6 POWER ON 3 13 Power supply error CPU B 7 Printer settings Printing hardcopy 7 29 screen list 7 28 Printing screen list by job 85 Priority hardware interrupt Process image update Process image area Process image transfer time 3 23 Process manipulation 1 5 PROFIBUS DP bus processing time 3 36 response time Program errors Programming device functions 1 6 Programming devices 1 3 Index 9 Index Programming error CPU B 8 Programming languages 3 3 Programming tool 3 Protocols hardcopy 7 28 screen list 7 28 R R_STRNG Rack monitoring 3 29 Range overshoot 4 7 Range undershoot 4 7 Ready bit Real time clock correction factor parameter block synchronization Recipes 1 5 addressing definition transferring data records 8 21 Reduced response time Reference channel error Reference functions REPLACE Resetting the C7 CPU Resetting the C7 OP Resolution analog ranges Response to diagnostic message 5 9
222. puts with the STEP 7 program The counters are implemented to count up until the comparison value is reached They are reset when the comparison value is reached and counting is restarted beginning with zero Due to the immediate reset the specified comparison value can never be read out In the following program example the universal inputs are assigned parameters as follows UI counter C1 UI2 counter C2 UI3 counter C3 UI4 standard digital input not used in the example The three counters are assigned parameters as follows interrupt yes counting direction up edge rising Execution of block 1 First all three counters are stopped during startup This is necessary so that the counter will start counting from zero after a complete restart If this is not required that is if the counter must continue after a restart with its old value the counters must not be stopped 2 After a waiting time of about 10 ms a comparison value is written for each counter This waiting time is required so that the STOP command for the counters can become effective on the C7 module In the complete restart OB OB100 the times are not critical since the cycles are not monitored 3 Immediately after the comparison value has been written the comparison values are declared valid and the counters are started 4 OB1 The counter values can be read cyclically in OB1 The counter status bits are evaluated to ensure that the counters a
223. r job parameters Modify job on controller 305 Data block number x missing Create the data block that is missing 306 Temporary driver error 307 Counter x not present on controller Modify configuration variable 308 Timer x not present on controller Modify configuration variable 309 Input x not present on controller Modify configuration variable 310 Output x not present on controller Modify configuration variable 311 Memory bit x not present on controller Modify configuration variable 312 Print job rejected because similar job now being executed Wait until previous job terminated initiate again 313 Print job will be processed later because printer now busy 315 Information text has not been configured for highlighted object that is message setpoint 316 Current password level too low for required operator Log in at higher password level 317 input 318 Login attempted with invalid password 319 You entered and tried to edit an existing password 320 Enter password first and then specify 321 level 322 Password must contain at least 3 characters 323 In a buffer mask you pressed message text though an entry does not exist for the current message 324 The screen number or entry number in your input does not exist 335 Confirmation of alarm message inhibit Printer cannot be addressed Check printer and connection to C7 Communication
224. r panels we recommend the brochure ProTool Made Easy An Introduction 62B5370 OCF01 0BA1 Summary of Sections RAT Syston Keyboardinage A E Ro Trend Requestand Dames feo feces A 8 9 2 Addressing Recipes and Data Records and the Required Data Areas Synchronization during Transfer Normal Case Synchronization during Transfer Special Cases Writing Variables Indirectly Notes on Optimization C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 8 1 Data Areas for Communication between the C7 OP and the C7 CPU 8 1 Communication Parameters in a Configuration Parameters Configuration Tool C7 Feature 8 2 In the configuration software the following parameters are to be set for communication via the MPI Note The following parameters are already assigned generally applicable default values and need not be modified unless the C7 is used in connection with any other S7 C7 or OP units in a network Table 8 1 Parameter Explanation CPU type Control CPU The S7 300 is to be set for the C7 CPU If further CPUs are connected they must be set with S7 300 or S7 400 CPU address MPI address of the C7 CPU in the network configuration The address has a default setting but can also be assigned by the user It must be unique in a network Slot subrack Here you must set the slot and subrack For the C7 the valid setting is Slot 2 Subrack 0 C7 OP address MPI address of the C7 OP in the netwo
225. rates the process image input table PII e The program is processed step by step taking into account all counter and timer values and bit memories e The processor stores the signal states resulting from program execution in the process image output table PIQ The states are then transferred to the outputs The C7 CPU is independent of the C7 OP It has a separate MPI address and is connected to the C7 OP via the multipoint interface At present the C7 CPU generally supports two programming languages e STL Statement List consists of a series of statements Each statement in your program contains instructions which mnemonically represent a function of the C7 CPU e LAD A Ladder diagram is a graphic programming language that resembles electrical circuit diagrams Other programming languages are for example SCL and HiGraph C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Introduction What to Program With Which Devices to Use The tool with which you create user programs is STEP 7 for Statement List Ladder Logic and IDE Integrated Development Environment You can find the operation notes necessary for programming in the User Manual 231 Use the manuals listed in the preface for the individual languages STEP 7 and C IDE run on a programming device or PC You can operate these devices independently of the C7 You should connect the programming device PC to the C7 via the multipoint interface only when
226. re active OB1 is ended if not all counters are activated If all counters are active the read counter values are reassigned This is an optional feature which can be useful for specific applications If the same value must always be used within an OB1 cycle reassignment is recommended for example in the case of high counting frequency and relatively long cycles gt more than one access in OB1 might supply different values C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Addressing Assigning Parameters and How the C7 I O Works Programming Device On Line Function OB100 Statement Sequence 5 OB40 This block is used for interrupt evaluation A jump is executed by evaluating the information of the interrupt vector register from the start up information of OB40 LB 8 A memory byte is incremented as a function of the counter which has triggered the interrupt OB40 is programmed to recognize even several quasi parallel interrupts 6 OB35 OB35 is used to generate the counter pulses The following wiring is required to execute the example Connect digital output 1 2 with DI X1 Connect digital output 1 3 with DI X2 Connect digital output 1 4 with DI X3 In OB35 the output bits of the C7 digital outputs are toggled and the effect is a period time of 200 ms at each output correponding to a frequency of 5 Hz This value results from the 100 ms default interrupt time of OB35 This means that each output is set to logic
227. responding to 0 5 Hz Figure 3 1 Clock Period Times in the Clock Memory Byte Parameter Block Table 3 8 lists the parameters of the parameter block Clock Memory Clock Memory Table 3 8 Parameter Block Clock Memory Parameter Explanation C7 CPU Default Setting Value Range Clock memory For Clock memory yes a memory Yes No No byte must be defined Memory byte Memory byte that should be used for the From 0 to 255 clock memory byte C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 3 13 Controlling with the C7 CPU 3 6 2 Parameter Block Start Up Characteristics Parameter Block Start Up Characteristics Table 3 9 lists the parameters of the parameter block Start Up Characteristics Table 3 9 Parameter Block Start Up Characteristics Parameter Self test after power on and reset Explanation Value Range Default Setting For Self test on cold restart yes the C7 CPU Yes tests its internal RAM after every power on e Automatic Startup Only Complete restart can be set for the Restart e Manual C7 CPU Restart Module time limits e Parameter assignment during startup in ms Module time limits Ready message after power on in ms Tip 3 14 Maximum time for the distribution of the From 1 to 10 000 parameters to the modules within the rack Maximum time for the ready message of
228. rk configuration The address can be freely issued It must be unique in the network configuration The default value is address 2 Interface Here you determine which interface of the C7 OP the C7 CPU is connected to Transmission rate The data transmission rate between the C7 OP and the C7 CPU is fixed at 187 5 Kbps All settings can be made with ProTool and ProTool Lite under the menu System PLC The first controller in the list must always be the C7 CPU since the C7 system function DI DO status display always accesses the digital I O of the first controller in the list C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Data Areas for Communication between the C7 OP and the C7 CPU 8 2 Overview of User Data Areas User Data Areas User data areas are used to exchange data between the C7 CPU and the C7 OP It is by means of these data areas that the C7 CPU and the C7 OP communicate The communication process consists of writing and reading information into and out of the data areas Upon evaluation of the data the C7 CPU and the C7 OP are triggered into the various actions The user data areas can reside in any required memory area in the C7 CPU Functionality The following user data areas are possible e Event messages e Alarm messages e Recipes e Control jobs e System keyboard image e Function keyboard image e LED image e Date and time e Screen number area e User version e Trend reques
229. rocess screen 217 The addresses of two variables overlap Modify configuration variable 218 220 Printer buffer overflow messages have been lost 221 222 Event buffer full to remaining buffer space Delete buffer or configure smaller remaining buffer space 224 Event buffer full buffer partially deleted and forced printout initiated 225 Alarm buffer full to remaining buffer space Delete buffer or configure smaller remaining buffer space 227 Alarm buffer full buffer partially deleted and forced printout initiated 229 Keyboard connector faulty or loose hardware fault Return device for repair C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 C 13 C7 OP Functionality Standard Screens Control Jobs System Messages Message Cause Remedy 250 Changeover to required OP mode not possible via job This message may occur for example when trying to change over to loop through mode during communications via FAP 252 Recipe functions of the TD OP cannot be carried out simultaneously Two examples for situations where message 252 may be issued The selected function is already active for example in the background used by the controller The operator tries to transfer or delete a data record after selecting it 256 Insufficient memory space for executing the selected function Select the function again If the message is still output simplify the s
230. rol Systems 3 28 C79000 G7076 C627 01 Controlling with the C7 CPU Operating System The operating system execution time is caused by various sequences in the Execution Time C7 CPU System Execution Table 3 18 lists all times relevant for determining the operating system Times execution times of the C7 CPU Table 3 18 Operating System Execution Times of the C7 CPU C7 CPU Cycle control Approximately 870 us Communication via the multipoint interface Block functions load delete copy extend the cycle by up to 10 Communication via the MPI may load the cycle by up to 50 depending on the parameter assignment in STEP 7 sed Section 3 6 9 Updating the S7 timers 7 us x number of timers currently running C7 CPU self test From 0 to 65 000 us depending on parameter assignment se Section 3 6 9 Rack monitoring Per rack 50 us Process Image Table 3 19 contains the C7 CPU times that are applicable to the process Update image update The quoted figures are ideal values which can be increased by interrupts or communications via the multipoint interface of the C7 CPU Table 3 19 Process Image Update of the C7 CPU Process Image Update Times 1 C7 16 bytes PII approx 0 3 ms C7 3 racks 64 bytes PII approx 1 4 ms C7 3 racks 128 bytes max configuration PII approx 1 7 ms C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 3 29 Controlling with the C7 CPU 3 7 1 Calculation Example
231. rror C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 VO Diagnostics Diagnostic Information I O Read Diagnostic Messages In the diagnostic information a distinction can be made between permanent and temporary diagnostic errors e Permanent diagnostic errors cannot be influenced by the user program and can only be removed by resetting the C7 CPU complete erase restart or equipment exchange after a fault e Temporary diagnostic errors disappear automatically after a renewed measurement ADC error overrange or underrange error can be removed by the user program perhaps by parameter assignment during the process operations via SFC55 or by means of a manual entry at the connectors correction of the wiring Diagnostic messages will be entered into the diagnostic buffer only if the diagnostic interrupt OB OB82 occurs The precondition is that the parameter diagnostic interrupt enable yes was assigned Then you can read out the detailed diagnostic messages in addition to the standard diagnostic information using STEP 7 see manual 231 No entry is made in the diagnostic buffer of the C7 CPU in the other cases The diagnostic message cannot therefore be read out C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 5 3 I O Diagnostics 5 2 Diagnostic Data of the C7 Analog I Os and Universal Inputs Overview Analog Input Diagnostics Analog Output Diagnostics Layout of Diagn
232. s 2 8 ms C7 626 C7 626 DP Control Systems 3 30 C79000 G7076 C627 01 Controlling with the C7 CPU 3 7 2 Calculation Example for the Response Time Response Time To recap the response time is a total of 2 x process input image transfer time 2 x process output image transfer time 2 x operating system execution time 2 x program execution time Processing time for S7 timers Input and output delay times Example It is based on a C7 control system including I O CPU Parameters These are based on the data from the calculation example for the scan cycle time Calculation The response time for the example is as follows Process image transfer time Process input image PII approx 0 85 ms Process output image PIQ approx 0 6 ms Operating system execution time Cycle control 0 87 ms Rack monitoring approx 0 1 ms CPU self test 0 5 ms User program execution time 2 6 ms 1st subtotal As a time basis for calculating the Execution time for the timers and the Cycle load due to communication the sum of all the times listed below is valid 2 x 0 8 ms Process input image transfer time 2x 0 6 ms Process output image transfer time 2 x 0 87 ms 0 1 ms 0 5 ms Operating system execution time 2x 2 6 ms User program execution time 11 ms C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 3 31 Controlling with the C7 CPU e Execution time for the S7 timers
233. s key actions can be transferred at one time e All keys except SHIFT key As long as the corresponding key is pressed the assigned bit in the keyboard image has the value 1 otherwise it has the value 0 Bit value Key pressed 0 gt t ae SHIFT key When the SHIFT key is first pressed the assigned bit in the keyboard image receives the value 1 This state remains also after letting the key go until the SHIFT key is pressed again Bit value 1 SHIFT key gt t pressed C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Data Areas for Communication between the C7 OP and the C7 CPU 8 4 1 System Keyboard Image Layout The system keyboard image is a data area with a fixed length of two data words Every key of the system keyboard is assigned exactly one bit in the system keyboard image with the exception of the DIR key and the cursor keys The system keyboard image must also be declared as area pointer type system keyboard in the configuration This image can be assigned once only and in one CPU Keyboard image Bit number 7 6 5 4 3 2 1 07 6 54 3 2 1 0 Yz wxXs T p HOTA SHLD S sk 4st word E Fe PABK JG Ha Ro PM N UY ond word reserved 3rd word Keyboard group bit Note Unused bits may not be overwritten by the user program Keyboard Group The keyboard gro
234. s the structure of the data mailbox 1st word Identification 1 2nd word Identification 2 3rd word Identification 3 4th word Reserved 5th word Length of data record in bytes 6th word Data record value 1 Data record value nth word Data record value m C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 8 23 Data Areas for Communication between the C7 OP and the C7 CPU 8 9 3 Synchronization During Transfer Normal Case Transferring Data The control and checkback bits in the interface area synchronize data record Records transfer A transfer is normally initiated by an operator input on the C7 OP Transfer C7 OP gt The following description shows the procedure by which the C7 OP sets C7 CPU initiated synchronizing bits and the manner in which the C7 CPU program has to react on C7 OP to them Table 8 5 Procedure for Transmission Step Explanation 1 Bit 0 is checked by the C7 OP If bit 0 is set to 1 data mailbox disabled the transfer is terminated with a system error message If bit 0 is set to 0 the C7 OP sets the bit to 1 2 The C7 OP enters the IDs in the data mailbox With an indirectly transferred data record the data record values are also written to the data mailbox With a directly transferred data record the values of the variables are written to the configured address 3 The OP sets bit 3 to 1 data transfer terminated 4 The data record or the var
235. s the transfer always happens if a change is registered at the C7 OP In this case you do not need to configure a polling time The screen number area is a data area with a fixed length of two data words The layout of the screen number area for the C7 OP in the control memory is represented below 7 0 7 0 1st word Current screen type 2nd word Current screen number 3rd word Reserved Ath word Current input field number 5th word Reserved Entry Assignment Current screen type 1 Screen 3 Function screen 4 Fixed window 5 Alarm message window 6 Event message window Current screen number 1 to 65535 Current input field number 1 to 65535 With function screens the current screen number is assigned as follows Value Meaning 1 Alarm message screen 2 Event message page 3 Alarm message buffer 4 Event message buffer C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Data Areas for Communication between the C7 OP and the C7 CPU 8 6 Trend Request and Transfer Areas Trends A trend is a graphic display of a value from the PLC Depending on the configuration a trend is triggered by a clock pulse or a bit Time Triggered The C7 OP reads in the trend values upon a clock pulse set during Trends configuration Time triggered trends are suitable for displaying continuous variations such as the operating temperature of a motor Bit Triggered The C7 OP reads in either t
236. sages and logging for point to point connection for operator interfacing COROS for bus connections SINEC for diagnostics and mass storage applications C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Glossary Complete Restart Compress Configuration Configuring Configuration Memory Control Job Counters C Cyclic Interrupt D Data Block DB When a CPU starts up for example when the mode selector is moved from STOP to RUN or when power is turned on before cyclic program processing starts OB 1 the organization block OB100 complete restart is processed first In a complete restart the process image input table is read in and the STEP 7 user program processed starting with the first statement in OB1 The programming device on line function Compress is used to shift all valid blocks in the RAM of the C7 CPU evenly and without any gaps to the beginning of the user memory All gaps caused by deleting or correcting of blocks are thus removed The assignment of modules to racks slots and addresses for example with signal modules Defining plant specific basic settings messages and displays using the ProTool configuration software The configuration memory is a flash memory integrated in the C7 OP It is used for storing the configuration data Used for triggering a function in the C7 Handling control jobs is explained in Volume 2 of the manuall Section 8 8 3 Counters ar
237. ser Version anicca aoas nia ccc cece tte ttn 8 8 nterface Area viccswce ag ras caw ep heMade bee habeas eo aa i aaa 8 8 1 Control and Checkback Bits 00 0 cece cee ene eens 8 8 2 Data Areas in the Interface Area ce ccc cece 8 8 3 Example for Activating a Control Job 0 cece eens 8 9 FRECIDOS eaa ee ate ireat cia pans N ciao E oie aah ae ean alee areata 8 9 1 Transferring Data Records 0 c cece cette eee 8 9 2 Addressing Recipes and Data Records and the Required Data Areas 8 9 3 Synchronization during Transfer Normal Case 000005 8 9 4 Synchronization during Transfer Special Cases 0005 8 10 Writing Variables Indirectly 0 cece eects 8 11 Notes on Optimization 0 eet eee A SFCs and SFBs in the C7 CPU cece eee eens A 1 SFCs and SEBS 22 0 agaec andy rr rute E dees Sees oats A 2 IEC FunctionS 0 0 cc cece n eee nent nnees B System Status List in the C7 CPU 2 cece eens Cc C7 OP Functionality Standard Screens Control Jobs System Messages C 1 C 1 C7 OP Functionality 0 cece een eee ae C 2 C 2 Control Jobs and Their Parameters 0000 c cece e eee eee eee C 5 C 3 System Messages 00 cece eee eee ee eee eee C 9 C 4 Internal Errors o sccuc anes phi be eed aaa bee added dey wid nate dom Rad mw ee C 25 SIMATIC C7 and S7 Literature List 00 cece eee cece eee eens
238. splays which can contain graphics texts and values Process values in a system are often related in some way Displays show this relationship and thus represent an image of the process The C7 enables you to represent machines and plants as full graphic screens This improves operator orientation You can show current process values for example filling level and speed as numeric values or symbolically as text or bars Curves are a particularly good way of showing changeable process values for example changes in temperature over a period of time Symbolic graphics are another way to indicate process values Symbolic graphics are graphic elements that is bit maps which are indicated alternately to show different process states for example valve open or closed C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Introduction Process Manipulation Messages Information Texts Recipes Password Protection The operator can use the integrated keyboard in the C7 to intervene in the process sequence For example you can control actuators for example valves by specifying process values for example setpoints Features important to operator control include ease of handling short training periods and a high degree of reliability You can configure the structure of the C7 operating environment as required in other words you can tailor operator control to your particular application A few features
239. ss in which the S7 user can program a reaction The OBs have different priorities which allow them to be processed in the correct sequence when two occur at the same time and allow OBs with higher priority to interrupt those with lower priority The operating system of the C7 CPU organizes all functions and processes of the C7 which are not linked to a special control task Organization blocks form the interface between the operating system of the C7 CPU and the user program The sequence in which the user program is processed is specified in the organization blocks Field for the display of an actual value C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Glossary Parameters Parameters Dynamic Parameters Static Password Password Level PG PLC Process Image Programmable Logic Controllers 1 A parameter is a variable of a STEP 7 logic block 2 A variable for setting the behavior of a module one or more per module Every configurable module has a basic parameter setting when it is supplied from the factory but this can be changed using STEP 7 There are two types of parameter static and dynamic parameters Parameters Dynamic or Parameters Static Dynamic parameters of modules in contrast to static parameters can be changed by the user program during operation by calling an SFC for example limit values of an analog signal input module Static parameters of modules in contrast
240. ssages ceeeee eee teen teen ees 7 2 2 General Features 0 0 cece ccc nents 7 2 3 Current Messages 0 0 c cece cece ete e eee eee 7 2 4 Stored Messages ccc cece cece eee e eee eee 7 2 5 Standard Screen Message Processing 00eeeeee eee eaee 7 2 6 System Messages 00 cece cece eee eee eee 7 3 RECIPE Siru 2 sage water a bend a reed nate a oiai dba ee pees 7 3 1 Processing and Transferring Data Records 0 eee aeeee 7 3 2 Setting Up and Editing Data Records naana ccc eee eee eee 7 3 3 Parameter Records cece eect eens 7 4 PINUNO ioiii ioiai Gane da dawns ia aayi dh baled a ii aand a Eai aes 7 5 Status Force with the C7 0 0 cece eee eee ee 8 Data Areas for Communication between the C7 OP and the C7 CPU 8 1 Communication Parameters in a Configuration 004 8 2 Overview of User Data Areas 0 00 c cece 8 3 Event and Alarm Messages 2 2 ceeeee eee e eee e eens 8 4 Keyboard and LED Image 0 cece eee tee e teens 8 4 1 System Keyboard Image 2 cece eect eects 8 4 2 Function Keyboard Image 0c cee eee teenies 8 4 3 LED IMAJ ici cierto nie ended eG ae ee Oho 8 5 Screen Number Area 0 0000 c cece eee e eee 8 6 Trend Request and Transfer Areas 00 cece eee eee C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 vV Contents 8 7 U
241. ssigning Parameters and How the C7 I O Works 4 3 7 Conversion Scan Cycle Settling and Response Times of the Analog Outputs Introduction Conversion Time Scan Cycle Time Settling Time Response Time This section contains the definitions and relationships between relevant times for the analog output The conversion time includes the acceptance of the analog output values from the internal memory and the digital analog conversion The scan cycle time that is the elapsed time before an analog output value is converted the next time is equal to the time for the conversion of the one analog output The settling time t2 to t3 that is the elapsed time between the creation of the converted value and the attainment of the specific value at the analog output is load dependent A distinction must be made between resistive capacitive and inductive load The response time that is the interval between providing the digital output value and attaining the specified value at the analog output is between 100 us and 2 ms C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 4 15 Addressing Assigning Parameters and How the C7 I O Works 4 3 8 Behavior of the Analog I Os Overview This section decribes e The relationship of the analog input and output values to the supply voltages of the analog I O and the operating modes of the C7 e The behavior of the analog I O in relation to the position of the analog va
242. sturbance on the analogI O bit 0 of byte 0 0 xx A group error is set if a substitute value is assigned for the analog output and this value is used C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 5 7 I O Diagnostics 5 3 Constraints and Responses of the Diagnostic Evaluation Overview Constraints for Error Entry 5 8 The diagnostic entries are interdependent For example the message for the error wire break can only become effective if the diagnostic entries external error and channel error are set simultaneously These interactions are illustrated in Table 5 3 Table 5 3 Constrants and Interactions of the Error Entries Byte0 BitO 1 Module error ByteO Bit 1 1 Internal error Byte2 Bit3 1 Watchdog Byte3 Bit 2 1 EEPROM error Byte3 Bit 4 1 ADC error M R ByteO Bit2 1 External error ByteO Bit3 1 Channel error Byte7 Evaluate channel vector if required Wire break Byte 8 9 10 11 Bit 4 1 channel specific diagnostic bytes AI E P Underrange Byte 8 9 10 11 Bit 6 1 channel specific diagnostic bytes AI E P M Overrange Byte 8 9 10 11 Bit 7 1 channel specific diagnostic bytes AI E P M Byte 0 Bit7 1 Incorrect parameter Byte 8 9 10 11 Bit 0 1 channel specific diagnostic bytes AI P Byte15 Bit 0 1 Group error AO Byte 0 Bit 6 1 Module not assigned parameters Leg
243. t OB number Data identifier Z2 3 Data identifier Z1 Additional information Z1 Additional information Z2 Additional information Z3 Time stamp of event 16 18 Additional The start address of the C7 I O module is contained in the additional Information Z1 information Z1 bytes 6 7 Address 272 or 0110y or address with assigned parameters Additional The serial number of the universal inputs that triggered the hardware Information Z2 interrupt can be found in byte 8 of the additional information Z2 Byte 9 is irrelevant C7 626 C7 626 DP Control Systems 4 30 C79000 G7076 C627 01 Addressing Assigning Parameters and How the C7 I O Works You can find the additional information Z2 broken down into bits in Figure 4 8 Byte 8 765432 0 0 al ol of o 9 L 1 when counter input 1 has triggered hardware interrupt 1 when counter input 2 has triggered hardware interrupt 1 when counter input 3 has triggered hardware interrupt Figure 4 8 Layout of Additional Information Z2 in the Declaration Section of OB40 Additional Additional information Z3 is not used and is set to 0110p Information Z3 Evaluation in User The evaluation of hardware interrupts in the user program is described in the Program manual 280 C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 4 31 Addressing Assigning Parameters and How the C7 I O Works 4 4 6 Overvie
244. t area e Trend transfer area C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 8 3 Data Areas for Communication between the C7 OP and the C7 CPU 8 3 Event and Alarm Messages Message Messages are triggered by setting a bit in one of the message areas in the Triggering C7 CPU The position of the message area is defined by the configuration tool The corresponding area is also to be established in the C7 CPU As soon as the bit in the event or alarm message area of the C7 CPU is set and transferred to the C7 OP the message is recognized as having arrived Conversely after resetting the same bit in the C7 CPU the message is registered in the C7 OP as having departed Message Areas Table 8 2 represents the number of message areas for event and alarm messages and alarm acknowledgement areas as well as the total length of all areas for both the C7 626 and the C7 626 DP Table 8 2 Message Areas of the C7 OP Device Event message bit area Alarm message area and alarm message acknowledgement area Number Length words Number of Total length of each each type type words C7 626 C7 626 DP Message Bit and A message can be configured for every bit in the configured message area Message Number The bits are assigned to the message numbers in ascending sequence Assignmen seignment Example The following event message area is configured for the C7 CPU DB 60 Address 42 Length 5 in words Fig
245. tart address of the module and all other addresses of this module are based on this start ad dress Free address assignment is only supported on S7 300 systems with the C7 626 DP Example of a digital I O module mounted in slot number 9 on rack 0 e When slot oriented adressing is used STEP 7 allocates the addresses starting from 120 0 and Q20 0 to the inputs and outputs e When free address assignment is used you can allocate different addresses to the inputs and outputs for example the input addresses starting with I10 0 and output addresses starting with Q6 0 Advantages of free address assignment e Optimum utilization of the address areas available since address gaps will not occur between the modules e When generating standard software you can program addresses which are independent of the S7 300 configuration In order to address DP standard slaves with a data consistency of 3 bytes and gt 4 bytes you must call up SFCs in the user program see Appendix A and reference manual System and Standard Functions C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Addressing Assigning Parameters and How the C7 I O Works C7 Configuration Figure 4 1 shows an example of a C7 configuration with a customer specific module and the connection of additional S7 300 modules
246. te When starting up the C7 without configuration data you must load the configuration data via the V 24 serial interface Load the basic configuration so that the explanations in this manual relate to this configuration Proceed as follows 1 Connect the V 24 serial interface of the C7 OP see Figure 2 8 in Volume 1 to the programming device PC using a suitable standard cable 2 Switch on the C7 power supply As no configuration is loaded the C7 automatically goes into transfer mode and waits for a data transfer 3 Transfer the basic configuration from the programming device PC to the C7 OP The firmware of the C7 OP is automatically transferred as well Note The exact procedure is explained in the ProTool description After a successful transfer the C7 OP is restarted 4 The displayed message can be removed by pressing ESC C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Commissioning Startup 339 Startup complete Basic C7 626 picture Figure 2 3 C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Basic C7 Picture with Message 339 2 5 Commissioning Startup 2 4 Reloading a Configuration Overview There are two ways of loading a configuration onto the C7 OP e via the multipoint interface see Figure 2 9 Volume 1 e via the V 24 serial interface Below you will find a description of how to replace an existing
247. tics Interrupt time parameter block 4 7 J Job area 8 18 K Key assignment function keyboard image Key functions Keyboard group bit function keyboard 8 10 system keyboard image 8 9 Keys cursor keys C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Index L LAD Language switchover Languages 1 6 Languages switching 6 15 LE_DT LE_STRNG LED assignment condition LED assignment bit number 8 11 LED image 8 11 LEN LIMIT Load control program Load memory Loading erasing flash memory 3 42 Local data Logging in as super user Login Login window Logout 6 23 Lower threshold period time LT_DT LT_STRNG M short circuit Main screen Main screen area 6 2 MAX A 9 Maximum scan cycle time Measured value analog input Measured value resolution Measurement parameter block type of 4 7 Measurement period frequency calculation k 32 Measurement ranges Measuring overrange overflow Measuring underrange underflow Memory byte Memory reset C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Message log ON OFF C 6 triggering Message areas 8 4 Message bit 8 4 Message buffer deleting Message buffer page Message indication Message indicator 7 Message level selecting Message line Message logging 6 15 switching off 6 15 switching on Message number M
248. tion on bottling station Fixed text Semigraphic corresponding to tank Bar shows filling level of the tank graphically Symbolic input field to open and close the valve Symbolic graphic shows the status of the valve that is open or closed Numeric output field Icons for the softkey functions Figure 7 2 Figure 7 2Sample Screen for a Mixing Station C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Standard O I Functions 7 1 3 Selecting a Screen Overview Via Function Key Via Input Field Via Job from the Controller You can select a screen in the following ways e Via a function key softkey e Via an appropriately configured input field e Via a job from the controller You can open a certain screen by pressing a function key or a softkey A screen is opened after an entry has been executed in an input field configured for the selection of this screen When the state of the process plant requires the controller causes a screen to be selected on the C7 C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 7 5 Standard O I Functions 7 1 4 Standard Screens The C7 comes already equipped with standard screens You can use these standard screens for your configuration or adapt them to fit your application Main Screen The standard screens are called from a main screen via softkeys Basic C7 626 picture Softkeys for e rm e
249. tion Execution Time No LIMIT Limit a number to a defined limit 0 45 ms value MAX Select the largest of three numeric variables 0 43 ms Emm MIN Select the smallest of three numeric variables 0 43 ms Select one of two variables 0 32 ms C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 A 9 C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 System Status List in the C7 CPU Overview The C7 CPU is able to provide you with certain information The C7 CPU stores this information in the system status list This appendix contains the sublists of the system status list provided by the C7 CPU C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 B 1 System Status List in the C7 CPU Definition Reading the System Status List Sublists Structure of the Sublists B 2 The system status list contains data describing the current status of a C7 CPU You can use it at any time to gain an overview of the following e The current parameter assignment of the CPU and the signal modules which can be assigned parameters e The current statuses and sequences in the CPU and the signal modules which can be assigned parameters See the STEP 7 Standard and System Functions reference manual for a detailed description of the structure of the system status list and all possible entries You can use SFC51 RDSYSST from the user program to read out the entries in the system status list se
250. tion introduction Receive data Send data Send message block Function end Internal error Time out error Parity error Framing error Overrun error Line interruption Receive buffer overflow 0 Wrong control character 1 Logging error 1 3 5 6 7 8 9 1 1 No response from controller Cable defective or not plugged in Check physical connection Temporary driver error Restart PC Download configuration 043 Error in data transfer With this message a variable is Repeat the data transfer Check the given as the cause of the error physical connection or the configured 0 Time out rror interface parameters beforehand if necessary 1 Framing error receive 2 Overrun error 3 Parity error 4 No connection possible 5 Checksum error receive 6 Unexpected receipt of characters 7 11 Internal error see Section C 3 1 12 Receive data block too large 13 Memory area in C7 CPU does not exist C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 C 11 C7 OP Functionality Standard Screens Control Jobs System Messages Message Cause Remedy 100 Invalid RAM contents 104 Download mode canceled by pressing a key 106 Serious error eliminated and key pressed 108 Mode change 110 Mode change 114 Controller cold restart 115 Establishment of logical link 117 Connection to controller OK again following a fault 119 Automatic start of C7 password l
251. tion key or via a job from the PLC C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Standard O I Functions Restrictions Printing is performed in ASCII mode in other words graphic elements in the screens such as full graphic screens curves and bars are not printed No hardcopies are possible during the printing procedure Printing Several You can define and print several different screen lists by embedding this Screen Lists function several times for example by assigning it to several function keys or by passing on PLC job 85 several times C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 7 29 Standard O I Functions 7 5 Status Force with the C7 Overview Status Variable Force Variable Status Variable Standard Screen 7 30 The C7 OP is equipped with the Status Variable and Force Variable functions This permits you to use standard screens to indicate address values from the connected controller in a screen and to change them in a second screen Controller addresses can be processed directly on the C7 OP during on line operation A programming device does not need to be connected to the con troller You can use Status Variable to display the status of addresses of a SIMATIC S5 or S7 You can control addresses of a SIMATIC S5 or S7 with Force Variable by modifying the variable values and transferring them back to the PLC The Status Variable standard screen is selected in the mai
252. to dynamic parameters cannot be changed by the user program but only using STEP 7 for example the input delay of a digital signal input module A password with a defined password level is required for accessing a protected function The password level corresponds to the authorization level allocated to the operator At the configuring stage the necessary password level can be preset in the range from 0 lowest level to 9 highest level Programming Device Programmable Logic Controllers The process image is a component part of the gt system memory of the C7 CPU At the beginning of the cyclic program the signal states of the input modules are transferred to the process image input table At the end of the cyclic program the process image output table is transferred to the output modules as signal state Programmable logic controllers PLCs are electronic controllers whose function is stored in the control device as a program The structure and the wiring of the device are therefore not dependent on the function of the controller A programmable controller has the structure of a computer it consists of a CPU with memory I O modules and an internal bus system The I O and the programming language are set up according to the requirements of control engineering C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Glossary 9 Glossary Programming Device RAM Reference Data Retentivity S Se
253. tor can look at all still queued event messages or alarm messages on the appropriate message page The C7 OP stores all messages in a battery buffered memory The operator can look at these stored messages Each message is given a priority during configuration This priority determines the importance of the message e When several messages are queued the message with the highest priority is indicated first e When several unacknowledged alarm messages are queued either the first that is the oldest or the last that is the latest message is indicated The operator can change the configured type of indication firs last e When several event messages with the same priority are queued the latest is indicated C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Standard O I Functions Message States Message Indicator Acknowledge Alarm Messages Acknowledgement Groups Message occurrences may assume the following states Arriving Marks the occurrence of the message Departed Cause of the message no longer exists Acknowledged Only for alarm messages The operator or the controller has recognized the message and confirmed it The C7 acquires these message states with the precise time and outputs them when a message page or the message buffer is indicated At least one alarm message is still queued when this symbol appears on the C7 display ZN Alarm messages must be acknowledged by either the oper
254. ts created by patentgrantorregistration of a utility model or design are reserved Siemens AG Automation Group Industrial Automation S ystems Postfach 4848 D 90327 N rnberg Disclaimer of Liability We have checked the contents of this manual for agreement with the hardware and software described Since deviations cannot be precluded entirely we cannot guarantee full agreement However the data in this manualare reviewed regularly and any necessary corrections included in subsequent editions Suggestions for improvement are welcomed Siemens AG 1996 Technical data subject to change Siemens Aktiengesellschaft C79000 G7076 C627 Contents 1 Ta itcere 1 Ce 0 9 Jemappes h 1 1 1 Controlling with C7 saxastotavcdaakiesswadyadeedanaphatadananeanes 1 2 Operating and Monitoring with C7 ssassssaeusaeuun ae eee 1 4 1 3 Overview Of C7 1 kee cent e eee eee 1 7 2 Commissioning Startup sce cece cece eect e eee eee e ee eeneees 2 1 Starting UD miniseries iiaia he awl Shae histev staan pee aka cand 2 2 With a Loaded Configuration inthe C7 OP 6 22 eee eee ee 2 3 Without a Loaded Configuration in the C7 OP 0 cece eee ee 2 4 Reloading a Configuration 00 cee eee 2 5 Selecting the C7 CPU Operating Mode and the DI DO Status Display 2 6 Resetting the C7 0 cece eect tenets 2 13 3 Controlling with the C7 CPU 00sec eee ee cece eee eee teens B 1 3 1
255. ual to Var 410 Upper limit for input ignored Enter a value smaller than or equal to Var 411 Selection of special screens is not permissible in this case If necessary modify the configured interface parameters 442 Thie message indicates a data block error The x andy Either correct the block size or the variables identify the cause of the error X variable and block number or send the correct data the number of the affected receive block y variable block Variable x O Invalid block size entered in receive block no y 1 Invalid block number entered in receive block no y C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 C 17 C7 OP Functionality Standard Screens Control Jobs System Messages Message Cause Remedy 500 Download to C7 CPU not possible at present 501 C7 CPU overloaded 502 Standard FB not called for more than 1 5 s 503 Check user program 504 505 Data records cannot be transferred either because the Send the data record again after the C7 recipe disable bit is set in the C7 CPU or because a recipe CPU has enabled the recipe mailbox is already being sent 506 Too many message blocks having the same block Error occurs when C7 CPU sends too number in transit overloading many jobs within a certain time with Fetch message bit area 507 A data record transfer has not been acknowledged by the Speed up the DB check on th
256. up bit serves as the control bit It is set to the value 1 for Bit each transfer of the keyboard image from C7 OP to C7 CPU After evaluation of the data area by the user program it should be reset By regular reading of the group bits you can determine in the user program whether the image of the system keyboard has been newly transferred C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 8 9 Data Areas for Communication between the C7 OP and the C7 CPU 8 4 2 Function Keyboard Image Data Areas The image of the function keyboard can be categorized into separate data areas e Maximum number of data areas 8 e Total length of all data areas words 8 Key Assignment The assignment of the individual keys to the data area bits is defined during the configuration of the function keys The number within the image area is declared for every key The function keyboard image must also be declared in the configuration under area pointer type function keyboard Keyboard Group The most significant bit in the last data word of every data area is the Bit keyboard group bit It serves as a control bit This bit is set to 1 for every transfer of the keyboard image After evaluation of the data area by the user program the keyboard group bit should be reset You can determine whether a block is newly transferred by regularly reading the group bits using the user program C7 626 C7 626 DP Control Systems 8 10 C79000 G
257. upt inputs a hardware interrupt will be triggered at the C7 CPU for the assigned rising or falling edge at the input The default is the rising edge The universal inputs 1 3 can be assigned as e Counter input e Period time counter input 3 only e Frequency meter input 3 only The counter values are made available to the user program as 16 bit values and the frequency and period time counter as 24 bit values C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 4 23 Addressing Assigning Parameters and How the C7 I O Works Table 4 18 lists the parameters for the above mentioned functions Table 4 18 Parameter Block of the Counter Inputs Parameter Counter input 1 Counter input 2 Counter input 3 Explanation Value Range Default Setting Define the count direction Up Up Down Select counter edge to be used for counting Rising Falling Counter can trigger a hardware interrupt after reaching the comparison value when counting up or zero transition when counting down Define the counter direction Down Select counter edge to be used for counting Rising Falling Counter can trigger a hardware interrupt after reaching the comparison value when counting up or zero transition when counting down Activate the counter input and assignment of the Deactivated Deactivated counter type Counter Frequency counter Period time counter If counter activated then define the counter Up direct
258. ure 4 2 shows how the addresses of the individual channels of the digital I O are laid out Digital inputs Bottom view of C7 O 0 0 Ae Address 0 0 0 1 Ie Address 0 1 Byte address 0 2 le Digital I Os 0 3 e Start address 0 4 lol le Byte 0 0 5 9 0 6 9 0 7 e Ie Address 0 7 _ 1 0 o Address 1 0 1 1 o e Address 1 1 1 2 jo Jo Byte address 1 3 o Jo Digital I Os 1 4 Jol lo Start address 1 5 e Byte 1 1 6 o Je 1 7 o Jo Address 1 7 F x Bit address 5 Digital outputs Pin number ae i Inputs with this shading are O not relevant to this example Figure 4 2 Digital I O Addresses C7 626 C7 626 DP Control Systems 4 4 C79000 G7076 C627 01 Addressing Assigning Parameters and How the C7 I O Works 4 3 Overview This section contains Use and Function of C7 Analog I Os e Descriptions of the basic terminology for analog value processing e How to address and assign parameters to analog I Os e How you allocate measuring ranges to analog input channels e The behavior of the individual analog input channels and the analog output channel 4 3 1 Analog Function Addresses Addressing the Analog I Os The address of an analog channel is always a word address An analog input output has the same start address for the analog input and output channels Figure 4 3 shows which channel
259. ure 8 1 shows the assignment of all 80 5 x 16 message numbers to the individual bit numbers in the control event message area The assignment follows automatically in the C7 OP 7 O 7 0 DB60 DBW42 16 1 DB60 DBW50 80 65 Message number Figure 8 1 Assignment of Message Bit and Message Number C7 626 C7 626 DP Control Systems 8 4 C79000 G7076 C627 01 Data Areas for Communication between the C7 OP and the C7 CPU Acknowledgement Acknowledgement Area As alarm messages indicate faulty behavior of some sort these must be acknowledged Acknowledgement follows either by e Appropriate action on the C7 or e By setting a bit in the acknowledgement area of the C7 CPU If the C7 CPU is to be informed about an acknowledgement of an alarm message at the C7 OP itself or if the acknowledgement should be given by the C7 CPU the corresponding acknowledgement areas are to be configured in the C7 CPU e Acknowledgement area C7 OP C7 CPU The controller is informed when an alarm message is acknowledged by an operation at the OP e Acknowledgement area C7 CPU C7 OP The alarm message is acknowledged via the C7 CPU These acknowledgement areas are to be allocated in the configuration when using ProTool under Area Pointers Figure 8 2 shows schematically the individual alarm message and acknowledgement areas The acknowledgement procedure
260. ured Use the programming device to read the scan cycle time of the user program on the C7 CPU see programming manual 280 An example is used to show you how to calculate the scan cycle time The response time is of greater interest however This section includes a detailed description of how to calculate the response time If you use the C7 DP CPU as a master in the PROFIBUS DP network you must also take into account bus processing times The scan cycle time is the time that passes during a program cycle The scan cycle time comprises the following elements e Process image transfer time PII and PIQ e Operating system execution time e User program execution time Communication via the multipoint interface Figure 3 2 shows the elements of the scan cycle time PII S Operating l i system Can be interrupted lt 2 2 i by various interrupts E ee eee a Figure 3 2 Elements of the Scan Cycle Time C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 3 23 Controlling with the C7 CPU Definition Response Time Factors Variation Range 3 24 The response time is the time that elapses between the recognition of an input signal and the change to the associated output signal The response time is dependent upon the following factors Process image transfer time Operating system time User program execution time Communication
261. ution irrespective of the value set for this parameter Example block status displaying system data STEP 7 continuous loops Cycle loading due to self test ins For Cyclic self test 4 0 the C7 CPU tests its From 0 0 internal RAM during the program cycle This to 65000 self test consumes cycle time You can define the time by which the program cycle may be Maximum scan cycle time in ms If the scan cycle time exceeds the maximum From 1 150 scan cycle time then the C7 CPU reverts to to 6000 STOP mode if no OB80 is loaded for error handling The maximum scan cycle time can be exceeded due to e communications processes e accumulation of interrupt events e errors in the user program for example lengthened in multiples of 10 us 0 no cyclic self test C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 3 21 Controlling with the C7 CPU 3 6 10 Parameter Block MPI Addresses Multipoint The characteristics of the multipoint interface MPI of the C7 CPU can be Interface MPI assigned parameters with the parameter block MPI addresses You need only process this parameter block if several C7 or S7 M7 devices are networked via the multipoint interface Values after The parameters of the parameter block MPI Addresses have a special Memory Reset feature the parameter values are preserved even after a memory reset Reason the communications ability of an erased C7
262. ution time Operating the C7 what you require Organization block Output special inputs Output range addresses parameter block 4 9 Output ranges analog outputs P P short circuit Parameter analog I O A 6 analog input analog output Parameter assignment of the C7 CPU universal inputs Parameter assignment error Parameter assignment tool universal inputs 4 23 Parameter block basic settings clock memory 3 13 counter inputs cycle behavior cyclic interrupt diagnostics 4 7 4 9 5 4 hardware interrupt interrupt cycle measurement 4 7 MPI addresses output range 4 9 real time clock retentive areas start up characteristics substitute value 4 9 system diagnostics time of day interrupts C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Index Parameter block for C7 analog I O and universal inputs diagnostic interrupt 4 37 diagnostics direction end of cycle interrupt 4 38 gate time 4 38 measuring range output range output type parameter data sets 4 37 C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 scan cycle time wire break 4 37 Parameter characteristics analog inputs 4 8 analog outputs Parameter records creating 7 27 Parameters for the C7 CPU B 12 Password 100 2 10 Password assignment 6 23 Password entry Password level Password list Password management Password
263. value Counter value first period second period tp Counter value 0 5us Figure 4 10 Simple Transducer such as a Slot Disc on a Shaft If you know the number of pulses that are delivered by the transducer for each revolution of the barrel extruder then you can calculate the speed at which the barrel extruder is rotating An example follows N 16 pulses are generated per revolution of the barrel extruder N is also known as the slot number of the transducer The interval between 2 pulses is 50000 increments fixed time interval The rotational speed of the barrel extruder is calculated as follows 1 E 1 N xti 16 x 50 000 x 0 5 us v 2 51 1502 x min C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 4 35 Addressing Assigning Parameters and How the C7 I O Works Lower Threshold The period time counter generates a 24 bit counter value These 3 bytes can represent values up to FF FF FFy 16777214 decimal From this the lower threshold frequency for N 1 is when taking into account the period time stated below tp 8 39 s fu tp 16777214 0 5us 8 39s fu 0 119Hz And for N 1 the lower threshold rotation speed 1 FTES EEEE PE a Y Wx Ix839s 0 119 7 147 Upper Threshold The upper threshold frequency results from the condition that the universal inputs are designed for a maximum frequency of 10 kHz The minimum period time of 0 1 ms follows Therefore the upper threshol
264. via the MPI Input and output delay times Additional bus processing times in the PROFIBUS DP network only C7 DP CPU The actual response time lies between the shortest and the longest response time During the configuration of your system you must always assume the longest response time The shortest and longest response times will be considered below so that you can form a picture of the variation range of the response time C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Controlling with the C7 CPU Shortest Response Figure 3 3 illustrates the conditions for the shortest response time Time Response time po ee ee ee eee eee eee SEROE EHS DR MENOre 2 2 Pil Operating system Pil Operating system The state of the observed input changes immediately before reading the PII The change in the input signal will still be considered in the PII The change in the input signal will be processed here by the user program The response of the user program to the change in the input signal is sent to the outputs here Poe ee ee eee eee er eee Bus processing times in the PROFIBUS DP network Bute peeves leet ec A hae Ft eae Ee ol Figure 3 3 C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Shortest Response Time 3 25 Controlling with the C7 CPU Calculation The shortest response time c
265. w Application Frequency Calculation Measurement Period Example of Frequency Calculation Frequency During First Measurement Period 4 32 Frequency Counters The universal input 3 assigned as frequency meter provides you with the possibility of continuously counting identical edges within a selected time period for a frequency 10 kHz Calculation of high frequencies The frequency meter calculates the frequency from the measured value and the measurement period The signal to be measured is to be connected to the universal input 3 see Sections 4 4 1 and 4 4 2 of the C7 The frequency counter counts the rising edges of the signal to be measured within a time period that can be assigned using parameters From this the user program can derive the actual frequency using the following formula Number of positive edges Measurement period Frequency The measurement period can be selected using the STEP 7 function Hardware Configuration You can choose between the measurement periods 0 1 s 1 s or 10 s The measuring process is immediately restarted after the measurement period has elapsed so that an updated frequency counter value is always available The measurement period is s During a measurement period 6500 rising edges of the signal to be measured are counted The value 6500 is made available to the user program Frequency er 6500 Hz s After starting up the C7 OB1 is processed and the
266. with controller resumed 340 You cannot operate the C7 with status function running on programming device C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 C 15 C7 OP Functionality Standard Screens Control Jobs System Messages 342 This message indicates a data block error Variables x and y are used to identify the cause of the error variable x and the number of the receive block variable y Variable x 0 Wrong block length entered in receive block no y 1 Wrong number entered in receive block no y Correct the required block length or block number or send the correct data block 385 386 Recipe transfer in progress During this time the operator panel is not ready for operator inputs Possible cause The PLC has not reset the corresponding control checkback bit which cancels the recipe inhibit state in the DB TDOP C 16 C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 C7 OP Functionality Standard Screens Control Jobs System Messages Message Cause Remedy 400 Invalid key pressed Entered value does not match display format Operating error in STATUS VAR or FORCE VAR screen after pressing INS when 10th variable line already assigned Incorrect time input Incorrect time input Operating error in STATUS VAR or FORCE VAR screen Abort updating ESCAPE key Lower limit for input ignored Enter a value greater than or eq
267. word level Login via A login window appears automatically if you want to make an entry or use a Login Window function which requires a higher password level than the current one After you have entered a valid password a jump is made back to the place at which you attempted to make an entry or use a function You can now repeat your entry C7 626 C7 626 DP Control Systems 6 22 C79000 G7076 C627 01 Operating the C7 General 6 7 2 Logging Out on the C7 Logout Logout via Standard Screen Automatic Logout Call the standard screen Password Processing Enter any character string in other words an invalid password in the Login field After your entry has been accepted you can only use functions with password level 0 The operator is automatically logged out if no operator actions are performed on the C7 within a period of time specified during configuration 6 7 3 Password Management Login Access Rights Define New Password Password management includes the following activities e Assigning up to 50 different passwords e Assigning a password level to each password e Changing existing passwords and password levels e Deleting passwords e Viewing the passwords already assigned in a password list Enter a valid password in the password screen After the entry has been accepted you can assign change and delete passwords in the Edit field You only have access rights to passwords whose level is
268. you wish to load your user program into the C7 C7 626 C7 626 DP Control Systems C79000 G7076 C627 01 Introduction 1 2 Operating and Monitoring with C7 Machine Type Monitoring and Control C7 Devices with Graphics C7 OP Displays Full Graphic Plant Screens Bars and Curves Symbolic Graphics Electronically controlled machines are usually supervised and controlled on the spot Depending on the size and complexity of the machine or system the requirements for O I systems differ greatly The C7 626 and the C7 626 DP are control systems with graphics capability These devices enable you to e Visualize processes machines and systems as semigraphic or full graphic images e Intervene in the process flow using the integrated keyboard The C7 OP processes the O I functions configured for the C7 It is independent of the C7 CPU and is still operable for example if the C7 CPU is in STOP mode The C7 OP is assigned a separate MPI address and connected to the C7 CPU via the multipoint interface This interface forms the link between the C7 OP and the computer used for configuring programming device PC One picture is worth a thousand words goes the familiar saying This is particularly true of machine and system monitoring where it is important to provide the operator with clear and easy to understand information about the state of the process Process values and process sequences are shown by di

4 - Siemens

Contents

Download Pdf Manuals

Related Search

Related Contents