Home
"user manual"
Contents
1. 1 PIPELINE IS STALLED 2 Sul 1 NIOS II LATE RESULT WN RI WwWHN PY I Regarding the NIOS II multiplier performance it mostly depends on the hardware used if the FPGA has dedicated multipliers on chip or not If a instruction has a late result penalty it means that the result is available two cycles afterwards if the result is needed in the next instruction The penalty may depend on the lack of data forwarding in the part of the pipeline which is associated with the instructions that have the specified penalty If the pipeline has to be flushed it takes four cycles to complete Since the NIOS II does not have any dedicated double load or store instructions dealing with data types larger than a word will take at least twice as long time as the single load or store takes 3The pipe line is stalled until the load is completed Comparison of Synthesizable Processor Cores 5 INSTRUCTION PERFORMANCE 5 1 Branch Delay Slot vs Dynamic Branch Prediction This section contains a short comparison of the different branch handling methods both processor cores uses respectively The aim of a pipelined processor architecture is to keep the pipeline full of instructions all the time If not the performance will decrease by increasing the Cycle Per Instruction CPI When the pipeline depth increases the cost of a conditional branch will also increase if the branch is taken Branch Delay Slot The LEON2 uses the branch delay slot feature
2. Memory Controller SRAM 1 1 MBYTE ALU MULTIPLIER SOFTWARE SORTWARE 2 DIVIDER SOFTWARE SOFTWARE 12Emulated in software 26 Comparison of Synthesizable Processor Cores 9 MINIMUM AREA Configuration Comments All configurable options were chosen to consume as few gates and cache bits as possible The multiplication and division are emulated in software it decreases the number of gates used but the performance is affected in a negative manner The caches on both processors are direct mapped since it has a simple implementation and therefor less gates are being used The memory system consists of I MB SRAM which is enough to the benchmarks that is going to be executed on them later on These configurations have been at both frequencies 25 MHz and 50 MHz respectively 9 2 Synthesis Results In the table 9 below the synthesis results can be seen The Total Mem bits section contains both cache bits and the register file bits that each processor core utilizes The number of LE s used is without the debug unit each processor core uses respectively The number inside the parenthesis is the percentage of the maximum available option Table 9 Minimum Area Synthesis Results PROCESSOR CORE LEON2 NIOS II LEON2 NIOS II FREQUENCY 25 MHz 25 MHz 50 MHz 50 MHz LE s 5189 25 2167 10 5259 25 2181 10 M4K BLOCKS 10 15 10 15 10 15 10 15 TOTAL MEM BITS 34688 11 13 872 4 34 688
3. The arithmetic diagnosed appears to be Excellent T ISFLAW lack s of guard digits or failure s to correctly round or chop 40 Comparison of Synthesizable Processor Cores 12 SUMMARY 12 Summary Analyzing synthesizable processor cores performance is not an obvious task since there are several things depending on each other The hole synthesis chain which is complex begins with the processor VHDL source code and ends up with the netlist after the place and route part has finished All steps included in the synthesis affects the overall system performance but the major impact of the final performance is probably depending on the software compiler and the application that is going to be executed on the target Syntesizable processor cores are in general configurable in some way Mainly both the instruction and the data caches sizes and the multiplier size and latency could be customized since they affect the overall performance most Another feature they have is that hardware migration is possible which make them reusable and flexible A disadvantage is that some of the processor cores are software tool dependent and hardware dependent as well Which will force one to use certain software tools and FPGA s In the Minimum Area section each processor core has been configured to utilize as few gates and cache bits as possible To save gates multiplication and divide was emulated in software Regarding the res
4. 11 13 888 4 Synthesis Result Comments Concerning the LEON2 Total Mem Bits Synplify Pro and Quartus II reports different number of memory bits used In the table 9 above the number used is that the Quartus II reports The Mem bit section contains the memory bits used by the caches and the register file As shown in table 9 the LEON2 is almost two and a half times bigger than the NIOS II core The NIOS II core is vendor optimized with respect to the FPGA which have been used The difference in number of LE s used for each processor at the two different frequencies mostly depends on the the timing criteria which could be harder to fulfil with the same number of LE s used 13On Chip RAM Total 64 Blocks Block size 128 x 36 Bits 27 Comparison of Synthesizable Processor Cores 9 MINIMUM AREA 9 3 Benchmarking This section contains the benchmarking results and conclusions As mentioned in section 8 1 all benchmark sets have been executed in two frequencies 25 MHz and 50 MHZ respectively It is important to notice that the NIOS II caches are only 0 5Kbytes each in this Minimum Area part of the complete benchmark set therefore the numbers in this section should not be taken at face value 9 3 1 Dhrystone In table 10 below the Dhrystone results are shown Table 10 Dhrystone Results Minimum Area PROCESSOR CORE LEON2 NIOSII LEON2 NIOSII FREQUENCY 25 MHz 25 MHz 50 MHz 50 MHz 1 ITER
5. 56 158 976 53 167 168 56 158 976 53 Result comments Concerning the LEON2 Total Mem Bits Synplify and Quartus II reports different numbers of memory bits used In the table above the number used is that the Quartus II reports The Total Mem Bits includes both instruction and data cache bits and the register file As shown in the table 14 above the LEON2 uses more than two times more LE s than the NIOS II where the LEON2 s multiplier divider two cache controllers and the windowed register file consumes a lot of LE s compared to the vendor optimized NIOS II The difference between the number of LE s used by each processor at the two different frequencies is because of the new timing criteria to fulfil which may affect the place and route part of the synthesis chain 4On Chip RAM Total 64 Blocks Block size 128 x 36 Bits 34 Comparison of Synthesizable Processor Cores 10 MAXIMUM PERFORMANCE 10 3 Benchmarking This section contains the benchmark results and conclusions for the maximum performance part of the work Both processor configurations have been executed in two frequencies 25 MHz and 50 MHz respec tively 10 3 1 Dhrystone In table 15 below the execution result of Dhrystone on both processor cores at both frequencies can be seen Table 15 Dhrystone Results Maximum Performance PROCESSOR CORE LEON2 NIOSII LEON2 NIOSII FREQUENCY 25 MHz 25 MHz 50 MHz 50 MHz 1 I
6. A branch delay slot is a single cycle delay that comes after a conditional branch instruction has begun execution The compiler could insert a instruction in the delay slot that does not depend on the branch instruction if it is impossible a no operation instruction is inserted there This feature improves performance by having the processor to execute other instructions while waiting for the branch target and condition to be calculated Dynamic Branch Prediction The NIOS Il uses a dynamic branch prediction scheme which is based on a 2 bit branch history table By using a dynamic predictor it is possible to look at the outcome of earlier branches to determine whether or not to take coming ones The efficiency of a dynamic branch predictor depends not only on its precision but also on the cost of a branch especially if the prediction was wrong and the pipeline has to be flushed the longer pipeline the bigger penalty In section 3 3 3 the NIOS II branch prediction cycles can be seen Comparison of Synthesizable Processor Cores 6 QUICK REVIEW 6 Quick Review This section contains a quick summary of the configuration possibilities for both processors FEATURE LEON2 NIOS Uf Integer Unit ARCHITECTURE 32 BIT RISC 32 BIT RISC ISA SPARC V8 NIOS I ISA CUSTOM INSTRUCTIONS Yes Yes PIPELINE STAGES 5 6 ENDIANESS BIG LITTLE REGISTER FILE WINDOWED FLAT NR OF GLOBAL REGISTERS 8 32 REGISTERS WINDOW 16 NR OF WINDOWS 2 32
7. INTMM 50 67 17 33 ms Mm 1183 1338 583 667 ms PUZZLE 400 384 184 192 ms QUICK 50 61 34 30 ms BUBBLE 67 78 33 39 ms TREE 367 105 183 54 ms FFT 1483 1543 733 772 ms COMPOSITES NONFLOATING 184 125 93 62 FLOATING 1188 1201 589 600 COMPOSITE SUM 1372 1326 676 662 In order to make the comparison of the Stanford benchmark set easier a graphical overview has been made it can be seen in figure 4 on the next page 36 Comparison of Synthesizable Processor Cores 10 MAXIMUM PERFORMANCE Stanford Execution Times 450 T T T T T T 1600 Mmmm LEON2 25 Mmmm LEON2 25 E NIOS I 25 E NIOS 11 25 400 F GBI LEON2 50 Jo pen IS de 1400 LEON2 50 E NIOS 11 50 E E NIOS 11 50 1200 1000 Time ms N o o T L Time ms 00 o o i i 600 150 4 400 100 Fo i J sol i 200 Perm Towers Queens Intmm Puzzle Quick Bubble Tree Figure 4 Maximum Performance Stanford Execution Times In figure 4 the integer program times can be seen to the left and the emulated floating point times to the right Notice the different time scales Stanford Result Comments When comparing the results of the first three programs Perm Towers and Queens with the result of same three programs in the minimum area section 9 3 2 the difference is not as big as one may assume It is because of the caches have not been filled up yet and they do not take advantage of the multiplier nor divider which is incl
8. Paranoia k rdes enbart p Minimum Area konfiguration vid en frekvens F r att g ra prestandautv deringen m jlig m ste ett korskompilatorsystem anv ndas f r de b da processorerna Till sist har prestandautv rderingsresultaten har diskuterats och utv rderats De b da processorerna har likv rdig prestanda p Minimum Area f r Dhrystone och Stanford medan LEON2 r snabbare p Styrapplikationen Vid Maximal Prestanda r NIOS II snabbare p Dhrystone och Stanford n LEON2 medan LEON2 r snabbare p Styrapplikationen Acknowledgments I would like to thank my supervisor Jiri Gaisler Edvin Catovic and the other Gaisler Research staff for supporting me during this thesis work At last I would also thank my examiner Lars Bengtsson at the Department of Computer Engineering at Chalmers for undertaking my thesis work Klas Westerlund Gothenburg August 2005 Contents 1 Initial Architecture Analysis 2 LEON2 2 1 System Overview sio a e ae SSR ELS 2 2 Instruction Set Architecture so oo oo ee se sr rr rr rr rr rr rss sees 2 3 Inte se Unit os dne ye e rr ee ts A A ic 231 Pipeline Architectures a2 sosse bee a D E S a a a E 2 3 2 Multiply and Divide Options soo eos se e e e 2A Cache System o ma alee A a a SR AAA we De a Ra RifR 24 1 Instruction Cache time Se Pe Ge Ba Mate BBG Se Ee Gs DAD Mata Cache secs rias oe Shay ee AP becca atte ike Ne ao ES 2 5 Internal Bu
9. The LEON2 supports optional signed and unsigned MAC instructions 16 x 16 bit multiplier with 40 bit accumulator it executes in one cycle but have two latency cycles A program that is going to use the MAC instructions should be written in assembly language A radix 2 hardware divider non restoring is also available with the following characteristics Input data 64 32 Bits producing a 32 bit result and takes 35 cycles to compute 2 4 Cache System Separate multi set instruction and data caches are provided each of them are configurable with 1 4 Sets 1 64 Kbyte set 16 32 Bytes Line Sub blocking is implemented with one valid bit per 32 bit word There are a several replacement policies provided LRU LRR and Random It is possible to mix the policies e g LRU on the instruction cache and random on the data cache The instruction set provides instructions to flush the caches if it is necessary 2 4 1 Instruction Cache The instruction cache uses streaming during line refill to minimize refill latency Instruction cache tag layout 1 Kb set 32 bytes line ATAG 31 10 LRR 9 LOCK 8 VALID 7 0 Only the necessary bits will be implemented in the cache tag depending on the configuration The LRR field is used to store the replacement history if the LRR replacement algorithm was chosen LOCK indi cates if a line is locked or not 2 4 2 Data Cache The data cache uses write through policy an
10. 2 LEON2 This section contains a description of the architecture of the processor core cache hierarchy the instruction set available peripherals and configuration options 2 1 System Overview The LEON 8 implements a 32 bit single issue SPARC V8 9 compatible processor core It is designed for embedded applications with the following features on chip Separate Instruction and Data Caches Harvard Architecture Hardware Multiply and Divide Flexible Memory Controller Parallel 16 32 Bits I O Port Ethernet MAC PCI Interface Two UARTs Interrupt Controller Two 24 bit Timers Debug Support Unit with Trace Buffer Watchdog Power down Function Is Fully Synthesizable VHDL Code Can be implemented on both FPGA and ASIC Support for Different Floating Point Units Not included in this work In figure 1 on next page a typical LEON2 system can be seen Comparison of Synthesizable Processor Cores 2 LEON2 Debug Debug Support Unit Serial Link Co CPU Data Cache Instr Cache T Ethernet gt AMBA AHB Memory Controller AMBA APB UART s Timers IrqCtrl 8 16 32 64 Bits Memory Bus SDRAM SRAM 1 0 PROM AHB eee APB eee AHB Controller Figure 1 LEON2 System Overview 2 2 Instruction Set Architecture LEON2 is a SPARC V8 9 IEEE 1754 single issue compliant RISC with a simple five stage pipeline implementation 32 Bit
11. Additional UNUS S ie sec 6 Gok Swe i a ee SAS ee Pe 14 3 81 JTAG Debus Module si pes sty a he Bs Pa el Eee a E E 14 38 2 Exception Controller a4 ok rt ee PR REE EOE ee A x 14 3 8 3 Interrupt Controllers 2 4 fh Awe Obed ae Be Ge Mee ead 14 4 Bus Comparison 15 5 Instruction Performance 16 5 1 Branch Delay Slot vs Dynamic Branch Prediction o o 17 6 Quick Review 18 7 Development Tools 20 Tele HardWare gece seaside 0 bene rk d r Bho Sk O ALGER MA Aa Mor isin wk 20 1527 s SOMWALC 5 4 0 eee he do Ae oh ewe RS Bye ae dot ted Gye ele ble Oa 21 TILL MEBOND os ar la ey OB at aed ey a tb 21 A NIOS IE ic ese es tht ete aed ohh ae Socks Royo de Ree FY RT ha ously Go sata Bape 21 Lo Implementation eee He idee bee ee ee oe art See Bed 21 8 Benchmarking 22 8 1 Benchmarking considerations ooo se ere er er reser rr eee 22 8 1 1 Floating point Emulation rr rr rr res es 23 8 2 The Different Benchmarks Used o aTe p OE ARNE a G 24 82 1 DITYStOME st pe ie sarge Be eee ee a ee Se E 24 8 22 27 Stanford sc q al a ed es eee GP ee td Wale a YG 24 2 3 O E vie amp ee Rs O Res Aad EE RE BOS Ow Bek x 25 8 2 4 Control Application 0 000 000 0000000000 25 9 Minimum Area 26 9 1 Processor Configurations 44 se is ewe da ee Bw ee Ag 26 OD Synthesis Results seit gos are e ek Seek ia de a Le AL sp sa de RI VR oe BO Re 27 9 3 Benchmarking 2 ov 22
12. TIMING WAIT STATES SUPPORT OPERATING FREQUENCY MULTIPLE MASTER MULTIPLE SLAVE PIPELINED BURSTING NON TRI STATE SPLIT TRANSACTIONS AHB gt APB 8 128 BITS 1 OR MORE SYNCHRONOUS YES USER DEFINED Recommended max 256 Bits 2 Asynchronous IP blocks could be connected to the bus SINGLE MASTER MULTIPLE SLAVE UNPIPELINED NO BURSTING NON TRI STATE 8 32 BITS 2 SYNCHRONOUS No USER DEFINED MULTIPLE MASTER MULTIPLE SLAVE PIPELINED STREAMING BURST TRI STATE LATENCY AWARE TRANSFERS AVALON gt AHB AVALON TRISTATE 8 32 BITS 1 OR MORE SYNCHRONOUS ASYNCHRONOUS YES FIXED OR PERIPHERAL CONTROLLED USER DEFINED Comparison of Synthesizable Processor Cores 5 INSTRUCTION PERFORMANCE 5 Instruction Performance In this section the instruction cycle performance for each processor is evaluated Since both processors are RISC almost every instruction take one cycle to execute Some instructions have penalties associated with their execution and takes several cycles to complete In table 6 below a summary of the instruction performance can be seen Table 6 Instruction Cycle Performance Instruction Type Cycles on LEON2 Cycles on NIOS II f Penalties MULTIPLY 1 2 4 5 35 1 5 11 NIOS II LATE RESULT DIVIDE 35 4 66 NIOS II LATE RESULT JUMP 2 3 DOUBLE LOAD SINGLE STORE DOUBLE STORE ATOMIC LOAD STORE RET CALLR CALL LOAD STORE READ CONTROL REGISTER
13. accuracy will also affect the execution times especially when it predicts wrong There is a noticeable execution difference concerning the Tree program which includes recursion iteration and selection The recursive part causes register window overflow on LEON by spending much time in the trap routine which has a negative impact on the performance Every time the same function is called after the first overflow has occurred the trap function will be executed The bigger the tree is the more time is spent in the trap routine Deeply recursive algorithms is a disadvantage for a processor with a windowed register file compared with a processor that uses a flat register file 30 Comparison of Synthesizable Processor Cores 9 MINIMUM AREA The equal execution times of the sorting algorithms Quicksort and Bubblesort on the NIOS II probably depends on the small caches Since the array contains 5000 random numbers combined with a data cache of only 512 bytes This combination will cause a high load on the memory system and the system bus as well which will increase the execution times Concerning the floating point programs Mm and FFT where the floating point arithmetics have to be emulated in software the LEON2 execution times are roughly 30 shorter One obvious reason is of course the cache size difference But to try to find out other possible reasons the assembly code from the two compilers were compared and evaluated The assembly code
14. ae bade sata wae tae ee ewe dee ate ee ee bee Me 28 O34 sDEPYSIONE 2 08 o o EE Geek eS BP a eee Ge ae 28 932 Stanford ais as e Meets ee aa oe ys Ge ee a E A 29 9 3 3 Control Application sar SAGER AEA RE a ta a e eS 32 9 4 Minimum Area Conclusions 0 00 e 32 10 Maximum Performance 33 10 1 Processor Configurations o s s e s toere ee 33 10 2 Synthesis Results 2 if dere eR AR Bo eng a ee ie e de 34 10 3 Benchmarking ai geek dae A we ted ir de A is 35 LOB DIEYStONE 2 score a hee aoe BAN ole a a esas 35 103320 Stanforda ts paolo de ti asa da Sahat Me pts ed ls lee aa da 36 10 3 3 Control Application sosse rr rr rr e 39 10 4 Maximum Performance Conclusions res ss vs sa 39 11 Paranoia 40 11 1 Results NIOS Ml o a eg de BE deg AN Wal id eR NS E 40 11 2 Results LEON2 2 200 is Rak de doe Ghee ee Atak od Tea Rt 40 12 Summary 41 13 Appendix 43 14 References 44 List of Tables 1 LEON2 Multiply Options go s cs ce Sao se RR RE ee i E 3 2 LEON2 Supported Memories and Sizes 2 2 o a 5 3 NIOS II Multiply and Divide Options o o e e 10 4 NIOS II Branch Prediction Cycles o o e e e o 10 5 Bus Comparsa AAA amp Gel det 15 6 Instruction Cycle Performance e 16 7 Floating point operations and their corresponding number of integer instructions when emulated in software ee fre 23 8 Minimum Area Processor Configurations oso sees ers sr rss ss
15. algorithm Bubble Sort a random array using the Bubblesort algorithm Tree Sort a random array using the Treesort algorithm FFT Calculate a Fast Fourier Transform After the execution has finished a kind of mean value is computed one where all eight integer program execution times are included Non floating composite and a second where all ten execution times are included Floating composite 24 Comparison of Synthesizable Processor Cores 8 BENCHMARKING 8 2 3 Paranoia Paranoia is the name of a program written by William Kahan in the early 80 s The program used in this benchmark is version 1 4 and converted to C by David M Gay and Thos Sumner Paranoia is designed to characterize floating point behavior of computer systems Here is a part of the tests that Paranoia does Small integer operations Search for radix and precision Check normalization and guard bits in x and Check if rounding is done correctly Check for sticky bit Tests if VX X for a number of integers If it will pass monotonicity If it is correctly rounded or chopped Testing powers Z for small Integers Z and i Search for underflow threshold and smallest positive number Testing powers Z at four nearly extreme values Searching for overflow threshold and saturation It also tries to compute 1 0 and 0 0 When all tests have been done Paranoia prints out a detailed result summary which tel
16. applications a graphical overview was made to make it easy to compare their execution times it can be seen in figure 3 on the next page 29 Comparison of Synthesizable Processor Cores 9 MINIMUM AREA Stanford Execution Times 800 6000 Mmmm LEON2 25 E NIOS I 25 Ea LEON2 50 E NIOS 11 50 Mmmm LEON2 25 E NIOS II 25 700 f niak a Ea LEON2 50 C NIOS 11 50 5000 600 4000 500 Time ms A 3 Time ms 3 3 300 2000 200 1000 100 Perm Towers Queens Intmm Puzzle Quick Bubble Tree Figure 3 Minimum Area Stanford Execution Times In figure 3 the integer program times are to the left and the emulated floating point programs Mm and FFT times to the right Notice the different time scales Stanford Result Comments As mentioned before the NIOS II caches are only 0 5 Kbytes each Regarding the first three programs Perm Tower and Queens the LEON is the fastest due to its windowed register file which speeds up execution of programs containing a few function calls compared with the flat register file that the NIOS II uses Concerning the Intmm and Puzzle results when two matrices are to be multiplied or dealing with matrices and loop intensive algorithms in general will cause a lot of both instruction and data transactions This will stress both caches the memory system and the system bus quite a lot If the processor is equipped with a branch predictor its
17. baud rate parity start stop and data bits and optional RTS CTS flow control signals 3 7 2 JTAG UART The JTAG UART core provides communication between a host PC and a Altera FPGA Master peripherals communicate with the core by reading and writing control and data registers The core provides bidirec tional FIFOs to improve bandwidth over JTAG connection The FIFO depth is configurable could be either in memory or build with registers 3 7 3 SPI SPI is a industry standard serial protocol commonly used in embedded systems to connect the processor to a variety of off chip devices The SPI core can implement either the master or the slave protocol If 1t is configured as a master the SPI core can control up to sixteen independent SPI slaves The core also provides an interrupt output which can flag an interrupt whenever a transfer completes 3 7 4 Parallel I O Port The parallel I O provides a memory mapped interface between an Avalon slave port and general purpose T O port The I O ports connect either to on chip user logic or to external devices Each core can provide up to thirty two I O ports A bidirectional mode is available with tristate control The core can be configured to generate a interrupt request on certain inputs Comparison of Synthesizable Processor Cores 3 NIOS II 3 8 Additional Units 3 8 1 JTAG Debug Module The NIOS II core supports a JTAG debug module to provide JTAG interface to software debugging too
18. cache sizes has increased multiplication and divide is performed in hardware The size of the LEON2 multiplier was set to 16 x 16 with a latency of 5 cycles which gained the best timing Regarding the data cache bytes line option on the LEON2 it was chosen to 16 since it will improve the associativity but it consumes more gates which is not a problem on this FPGA Concerning the replacement policy the LRU and the random algorithms were tested they performed quite equal but the LRU had the best performance in the Control Application part The NIOS II configuration options are limited to the FPGA used since it does not have any dedicated multiplier on chip and there was only one LE based multiplier available The cache sizes are the only part which is configurable 33 Comparison of Synthesizable Processor Cores 10 MAXIMUM PERFORMANCE 10 2 Synthesis Results The synthesis results can be seen in table 14 below The LE part of the table contains the processor core timer UART and the memory controller The debug unit which each processor uses is not included in the numbers The number inside the parenthesis is the percentage of the maximum available option Table 14 Maximum Performance Synthesis Results PROCESSOR CORE LEON2 NIOS II LEON2 NIOS II FREQUENCY 25 MHz 25 MHz 50 MHz 50 MHz LE s 7389 36 3057 15 7554 37 3058 15 M4K BLockKs 42 65 43 67 42 65 43 67 TOTAL MEM BITS 167168
19. controller which acts like a slave on the AHB bus The function of the controller is programmed through three memory configuration registers through the APB bus The controller decodes a 2 Gbyte address space according to the table 2 below Table 2 LEON2 Supported Memories and Sizes Type Size PROM 512 MB 1 0 512 MB S D RAM 1024 MB Burst Cycles To improve memory bus bandwidth access to sequential addresses can be performed in burst mode Burst transfers will be generated when the memory controller is accessed using an AHB burst request These requests includes instruction cache line fills double loads and double stores 2 6 1 SRAM The memory controller can handle up to 1 GByte SRAM divided on up to five RAM banks The bank sizes could be programmed in binary steps from 8 KByte to 256 MByte while the fifth bank handles the upper 512 MBytes A read access to the SRAM consists of two data cycles and zero to three wait states A write access is similar to the read but takes at least three cycles 2 6 2 PROM The PROM banks can be configured to operate in 8 16 or 32 bit mode Because of a read access to the PROM is always done in 32 bit mode a read access to the 8 or 16 bit mode is done by bursting in four and two cycles respectively A write access will only write the necessary bits 2 6 3 I O Devices The I O device section can be configured to operate in 8 or 16 bit mode A I O device can only be acc
20. register 2 8 Additional Units and Features The following units and features are provided 2 8 1 Debug Support Unit The Debug Support Unit DSU allows non intrusive debugging on target hardware The DSU allows to insert breakpoints and watchpoints and access to all on chip registers from a remote debugger The DSU has no performance impact on the system Communication to outside debuggers is done by using a Dedicated Communication Link DCL e g UART RS232 or through any AHB master e g Ethernet The registers of a FPU or Co processor can also be accessed through the DSU 2 8 2 Trace Buffer A trace buffer is provided to trace the executed instruction flow and or AHB traffic A 30 bit counter is also provided and stored in the trace as time tag Its operation is controlled through the DSU control register and the trace buffer control register The default size is 128 lines 2kbyte could be configured to 8 4096 lines 2 8 3 Timers The timer unit implements two 24 bit timers one 24 bit watchdog and one 10 bit shared prescaler The prescaler is clocked by the system clock and decremented on each clock cycle When it underflows the prescaler is reloaded from the prescaler register and restarted 2 8 4 Watchdog A 24 bit watchdog is provided on chip it is clocked by the timer prescaler When the watchdog reaches zero an output signal is asserted The signal could be used to generate system reset Comparison of Synthesiz
21. 2 PCI RS232 SPI J2C PCI Software Tool Chain COMPILER GCC 3 2 3 GCC 3 4 1 LIBRARY NEWLIB 1 12 0 NEWLIB 1 12 0 Supported OS es ECOS 4CLINUX SNAPGEAR LINUX RTEMS RTOS puC OS II pCLINUX KROS NORTi NUCLEUS PLUS prKERNEL Comparison of Synthesizable Processor Cores 7 DEVELOPMENT TOOLS 7 Development Tools This section contains a presentation of the hardware and software tools which have been used to implement each processor system on the same target FPGA 7 1 Hardware In this section the target hardware is presented Altera Cyclone Development Board The development board which both processor systems have been executed on is based on a Altera Cyclone FPGA 14 since the NIOS II cannot be used on other FPGA s than Alteras own The board consists of the following features FPGA Cyclone EP1C20F400C7 20060 LEs On chip RAM 294912 Bits Two PLL Memories 1 Mbyte SRAM 16 Mbytes SDRAM 8 Mbytes Flash Compact Flash Interface Interfaces 10 100 Mbps Ethernet PHY MAC 2 x Serial Ports RS232 Several Expansion Prototype Connectors JTAG Miscellaneous 50 MHz Oscillator Push buttons LEDs 7 Segment LEDs A LE is equal to a Xilinx LUT 1064 Blocks Block Size 128 x 36 Bits 20 Comparison of Synthesizable Processor Cores 7 DEVELOPMENT TOOLS 7 2 Software In this section the different software tools are evaluated The different program versions can be seen in Appendix A
22. 7 2 1 LEON2 Very extensive configuration tool all necessary details are available through it E g multiplier sizes and latencies number of cache sets set sizes replacement policies and different memory controllers among others In order to run programs on the target hardware the BCC 15 a GNU based cross compiler system has been used It is based on the GNU GCC 3 2 3 compiler and uses newLib 16 1 12 0 as C library 7 2 2 NIOS II The configuration of a NIOS II based system is done through SOPC which is a integrated part of Quartus II SOPC Good but it would have been much better if the sizes and latencies of the arithmetic options were available explicitly Now it is like a black box you know that you get a hardware based multiplier or divider but you do not know its input and output sizes features and latencies Also the NIOS II uses a GNU based tool chain with a Eclipse 17 based GUI The compiler version is GNU GCC 3 4 1 The newLib 16 1 12 0 is used as the C library Compiler Comments Due to the different compiler versions 18 each processor system uses the NIOS II may take advantage of the higher optimization level introduced in the newer one 7 3 Implementation A few things have been done based on the changes done by De Nayer Instituut 19 on the LEON2 to make it run on the development board Technology specific ram and the PLL were instantiated and a new port map was created The compiling and map
23. ATION MS 68 2 69 8 33 4 34 9 DHRYSTONES SEC 14 652 14 301 29 925 28 653 DHRYSTONES SEC MHZ 586 572 599 573 Dhrystone Result Comments The bigger caches on the LEON2 shows that the performance impact on the execution time is roughly 4 for such a big cache system compared to the NIOS II Since the caches are small and despite the fixed sequence of instructions there will be a lot of accesses to the main memory which will affect the execution time in a negative manner The frequency doubling increased the performance on LEON2 but the NIOS II has almost the same performance at both frequencies 28 Comparison of Synthesizable Processor Cores 9 MINIMUM AREA 9 3 2 Stanford The Stanford benchmark set was executed on both processor cores at two frequencies The results can be seen in table 11 below In this benchmark set the execution times should be as short as possible Table 11 Stanford Results Minimum Area PROCESSOR CORE LEON2 NIOS II LEON2 NIOS II FREQUENCY 25 MHz 25 MHz 50 MHz 50 MHz PROGRAM UNIT PERM 66 80 33 40 ms TOWERS 116 150 66 82 ms QUEENS 50 52 33 26 ms INTMM 316 707 150 345 ms Mm 3633 5281 1816 2727 ms PUZZLE 483 498 266 249 ms QUICK 66 120 33 60 ms BUBBLE 84 120 50 60 ms TREE 500 198 250 98 ms FFT 3417 5003 1734 2687 ms COMPOSITES NONFLOATING 270 279 137 140 FLOATING 2848 4043 1397 2129 COMPOSITE SUM 3118 4322 1534 2269 Since the Stanford benchmark set contains various types of
24. CHALMERS Comparison of Synthesizable Processor Cores KLAS WESTERLUND Master s Thesis Electrical Engineering Program CHALMERS UNIVERSITY OF TECHNOLOGY Department of Computer Science and Engineering Division of Computer Engineering G teborg 2005 All rights reserved This publication is protected by law in accordance with Lagen om Upphovsratt 1960 729 No part of this publication may be reproduced stored in a retrieval system or transmitted in any form or by any means electronic mechanical photocopying recording or otherwise without the prior permission of the authors Klas Westerlund G teborg 2005 Abstract The purpose of this thesis work has been to compare two synthesizable processor cores the LEON2 from Gaisler Research and the NIOS II provided by Altera The work consists of three parts 1 Initial Core Analysis 2 Implementation on a FPGA 3 Performance evaluation by Benchmarking In the analysis part the processor architecture of each core and characteristics like pipeline depth cache sub system and configurability have been evaluated Both processor cores have been implemented on the same target FPGA board In the benchmark part Dhrystone Stanford a typical control application and Paranoia The first three programs have been executed on two different processor configurations Mini mum Area and Maximum Performance respectively and in two different frequencies Paranoia was only exe
25. ICITY INC SYNPLIFY PRO VERSION 8 0 BUILD 189R BUILD JAN 17 2005 ALTERA QUARTUS II 4 2 BUILD 157 12 07 2004 SJ FULL VERSION GAISLER RESEARCH GRMON 1 0 6 PROFESSIONAL EDITION Appendix B Stanford Weight Values The Non Floating point composite is calculated as the sum of the execution time for each program multi plied by each program s weight value and divided by the number of integer programs eight of ten The floating point composite is calculated in the same way but the values of all ten programs are included Program Weight PERM 1 75 TOWERS 2 39 QUEENS 1 83 INTMM 1 46 MM 2 92 PUZZLE 0 50 QUICK 1 92 BUBBLE 1 61 TREE 2 50 FFT 4 44 43 Comparison of Synthesizable Processor Cores 14 References 1 LEON2 Processor Overview Url http www gaisler com products leon2 leon html 2 Gaisler Research F rsta Langgatan 19 Gothenburg Sweden Url http www gaisler com 3 NIOS II Processor Overview Url http altera com products ip processors nios2 cores ni2 processor _cores html 4 Altera Corporation 101 Innovation Drive San Jose California 95134 USA Url http www altera com 5 The GNU LGPL License form Url http www gnu org copyleft lesser html 6 The LEON2 Full Source Code Url http www gaisler com products leon2 leon_down html 7 NIOS II Licensing Info Url http www altera com products ip processors nios2 featuresfni2 q_and_a html 8 The LEON2 Processor User s Manual XS
26. T Edition Version 1 0 27 January 2005 9 The SPARC Architecture Manual Version 8 Revision SAVO80SI9308 SPARC International Inc 535 Middlefield Road Suite 210 Menlo Park CA 94025 415 321 8692 Url http www sparc org 44 Comparison of Synthesizable Processor Cores 10 AMBA AHB and APB Specification Rev 2 0 ARM IHI0011A 1999 Url http www arm com 11 The OpenCores Ethernet MAC Url http www opencores com projects cgi web ethmac overview 12 The NIOS II Processor Reference Handbook NI5V1 1 2 September 2004 13 The Avalon Bus Specification Reference Manual version 2 3 July 2003 14 Additional Development Board Info Url http altera com products devkits altera kit nios_1c20 html 15 BCC A GNU based Cross Compiler System Used by LEON2 Url http www gaisler com doc libio bcc html 16 Newlib a C Library Supported by Redhat Url http sources redhat com newlib 17 The Eclipse IDE GUI Url http www eclipse org 18 The GNU GCC Release History and Change Logs Url http gcc gnu org releases html 19 LEON2 Changes Done by De Nayer Instituut Belgium Url http emsys denayer wenk be project empro amp page cases amp id 14 ls 20 GRMON A Combined Debug Monitor and Simulator for LEON Processors Url http www gaisler com products grmon grmon html 45
27. TERATION MS 26 8 23 6 13 1 11 8 DHRYSTONES SEC 37 383 42 299 76 433 85 030 DHRYSTONES SEC MHZ 1495 1692 1529 1701 Dhrystone Result Comments The results are shown in table 15 above A processor system with a big cache and a program where the main part is a loop with a fixed sequence of instructions the cache hit rate will go towards 100 Increasing the cache size will not give a better result in this benchmark Requiring no main memory access thus becoming more representative of the processor rather than system performance If the results are compared with the execution times in the minimum area section one can see that the cache impact on integer programs are enormous almost three times faster see table 10 One interesting question is How much does the compiler affect the execution times No assembly code study has been done in this section since it is a very complex and time consuming task to evaluate the compiler efficiency 35 Comparison of Synthesizable Processor Cores 10 MAXIMUM PERFORMANCE 10 3 2 Stanford The Stanford benchmark set has been executed on both processors at both frequencies The results can be seen in table 16 below The shorter execution times the better performance is achieved Table 16 Stanford Results Maximum Performance PROCESSOR CORE LEON2 NIOSI LEON2 NIOSI FREQUENCY 25 MHz 25 MHz 50 MHz 50 MHz PROGRAM UNIT PERM 66 79 33 39 ms TOWERS 100 95 50 47 ms QUEENS 50 49 33 25 ms
28. TOTAL NR OF REGISTERS 40 520 32 BRACH HANDLING BRANCH DELAY SLOT BHT gt FPU SUPPORT YES N A MMU YES N A Multiply Options SIZE AND LATENCY 32 x 32 1 32 x 16 2 32 x 32 1 2 32 x 8 4 16 x 16 4 32 x 16 5 2 16 x 16 5 ITERATIVE 35 32x 4 1142 MAC YES N A Divide Options TYPE RADIX 2 RADIX 2 SIZE AND LATENCY 64 32 35 32 32 4 66 Continues on next page 4Could be added as a Co Processor instruction 5Branch History Table Dynamic prediction 616 x 16 multiplier and a 40 bit accumulator 7 Could be implemented as a custom instruction 8The latency depends on the hardware used Comparison of Synthesizable Processor Cores 6 QUICK REVIEW FEATURE LEON2 NIOS U f Cache Options INSTRUCTION CACHE NUMBER OF SETS 1 4 1 SET SIZE 1 64 KBYTE 0 5 64 KBYTE POSSIBLE CACHE SIZES 1 256 KBYTE 0 5 64 KBYTE LINE SIZE 16 32 BYTES 32 BYTES WRITE POLICY STREAMING CRITICAL WORD FIRST REPLACEMENT POLICIES DATA CACHE NUMBER OF SETS SET SIZE POSSIBLE CACHE SIZES LINE SIZE WRITE POLICIES DURING LINE REFILL LRU LRR RANDOM 1 4 1 64 KBYTE 1 256 KBYTE 16 32 BYTES WRITE THROUGH WRITE BUFFER N A 1 0 5 64 KBYTE 0 5 64 KBYTE 4 BYTES WRITE BACK WRITE ALLOCATE REPLACEMENT POLICIES LRU LRR RANDOM N A Supported Memory Interfaces SRAM SDRAM SRAM SDRAM PROM FLASH Supported System Interfaces MEMORY MAPPED I O MEMORY MAPPED I O ETHERNET JTAG ETHERNET JTAG RS23
29. able Processor Cores 2 LEON2 2 8 5 Interrupt Controller The interrupt controller manages a total number of fifteen 15 interrupts originating from internal and external sources Each interrupt can be programmed to one of two priority levels A chained secondary controller for up to thirty two 32 additional interrupts is also available There are a several unused inter rupts that can be utilized by other IP cores and peripherals 2 8 6 Parallel I O Port A partially bit wise programmable 32 bit I O port is provided on chip It is splited into two parts the upper 16 bits can only be used when all areas ROM RAM and I O of the memory controller is in 8 or 16 bit mode If the SDRAM controller is enabled the upper 16 bits cannot be used 2 8 7 Power down The processor can be powered down by writing an arbitrary value to the power down register Then the processor will enter the power down mode on the next load or store instruction During power down mode the Integer Unit IU will effectively be halted All instructions that are inside the pipeline will be there until the mode will be terminated If the mode will be terminated the Integer Unit IU will be re enabled when an unmasked interrupt with higher level than the current processor interrupt level PIL become pending All other functions and peripherals operate as normal during the power down mode 2 9 Co Processors 2 9 1 FPU The LEON2 processor model provides an in
30. application has been executed on both processors This application reveals more about their floating point performance The results can be seen in table 12 below Table 12 Control Application Results Minimum Area PROCESSOR CORE LEON2 NIOSH LEON2 NIOS II FREQUENCY 25 MHz 25 MHz 50 MHz 50 MHz PROGRAM UNIT CONTROL APPLICATION 487 1250 251 620 SEC Control Application Result Comments Floating point emulation in software as mentioned in section 8 1 1 causes a lot of instructions to be executed by the integer part of the processor In table 12 above the LEON2 is almost 2 5 times faster than the NIOS II This program includes more instructions than the floating point programs included in the Stanford benchmark set do The combination of many instructions and a relatively small cache system will cause a high load on each processor and on the cache and memory system as well In this situation the data handling capabilities of the processor cores are revealed In this case the LEON is the better one 9 4 Minimum Area Conclusions Concerning the results in this Minimum Area section their performance are quite equal while comparing their integer performance In the floating point part of the benchmarks the performance on the LEON is the better one The difference may depend on the bigger cache system and the write buffers that LEON2 uses A relatively small cache combined with multiplication and divide emulated in software while e
31. aside Buffer 0 000000 00 2 eee rt NAYNAYAAYAAYAAYNAYNAYIAYNNDDDDDADADADAAMNMANAAKHAPSPPPHPWWWWNNN pa 3 NIOS II 8 Sil System OVenview e wi heh em ee O aa hoe o ies a te STS 8 3 2 Instruction Set Architecture re er rr rr rr rr rr rr rr ee 9 33 Intese Unit ve als a E see ee a td See ate ee ee ben ae 9 33 1 Pipelme Architectite as a ae REP Se EER ODA ee a S R as 9 3 3 2 Multiply and Divide Options o e rr rr rr es es 10 3 3 3 Branch Prediction ssd ste fe o Sa GUS Ble Ae ee ee eS 10 3A Cache Systm o oo e sedel bd e Ay Eo ele BR Eee Be ee 8 11 3AL Instruction Cache sae ses Bese how Sete RRP A a hele es 11 342 Data Cache si 65 406 toh 4 OG Poe a a E he he See oe SE A 6 11 3 9 InternalBusses i keda ne le a ee BA SRA a AY Se et ee ae s 12 3 5 1 Avalon On chip Bus sve So a ve RN ee Oe A 12 3 0 Memory Interfaces meto bea e wae ae Bob be e a ee eee ees 12 3 6 1 SDRAM rin a a ae the ES Soe ee ae eb e RED a 12 3162 DMA a a 8 28 Su ees oa he Re PE ete BE ATS N 12 316 35 CBD 6 0 A Behe eae Mes fot eo PR A eS id a 12 A EPES ec s body dae Be Be ee ee B bd as RP Pw ee as 12 3 7 System Interfaces siii bie ah SS A Be eR BPs Sk SA ee Se ees 13 IL SUARE o tic ea ta ee hed ele EI bik E ps 13 3 7 2 JTAGUART 654 Sauget A hls Se AS eee eS 13 Sa SPTO soe wit eee te AGRE MEARS Son Rn ede d a RV Sima 4 13 3 74 Parallel WOPort ooo cita of he o poe os re a Re ee es 13 3 8
32. ating point test program Paranoia can be seen 11 1 Results NIOS II When Paranoia was executed on the NIOS II the program reported one failure in the multiplication part of the test A part of the output from Paranoia on NIOS II Multiplication is neither chopped nor correctly rounded Sticky bit used incorrectly or not at all The number of FLAW s discovered 1 The arithmetic diagnosed seems Satisfactory though flawed Possible Failure Sources The failure is probably caused by the code generation in the soft float part of the compiler There where no error when the program was executed when it was compiled without optimizations But the performance will drop by a certain amount without optimizations which is not satisfactory Especially when it will be used to do a lot of emulated floating point calculations Result without optimizations No failures defects nor flaws have been discovered Rounding appears to conform to the proposed IEEE standard P754 except for possibly Double Rounding during Gradual Underflow The arithmetic diagnosed appears to be Excellent T 11 2 Results LEON2 When Paranoia was executed on the LEON2 neither failures nor flaw s were detected A part of the output from Paranoia on LEON2 No failures defects nor flaws have been discovered Rounding appears to conform to the proposed IEEE standard P754 except for possibly Double Rounding during Gradual Underflow
33. aware peripherals streaming peripherals and multiple bus masters The advanced features allow multiple units of data to be transferred between pe ripherals during a single bus transaction Avalon masters and slaves interact with each other based on a technique called slave side arbitration Slave side arbitration determines which master gains access to a slave if at least two masters attempt to access the same slave at the same time Both the instruction and data buses are implemented as Avalon master ports The data master port connects to both memory and peripheral components while the instruction master port only connects to memory components Every peripheral mentioned in the following sections uses the Avalon bus In figure 2 on page 10 a bus overview can be seen 3 6 Memory Interfaces The processor core is capable to access up to 2 GBytes of external address space Both data memory peripherals and memory mapped I O are mapped into the address space of the data master port on the Avalon interface Multibyte numbers are stored as little endian When sharing memory the highest performance is achieved when the data master port has been as signed higher arbitration priority on any memory that is shared by both instruction and data master ports 3 6 1 SDRAM The SDRAM controller provides an interface to off chip SDRAM The controller supports the standard SDRAM PC100 specification The controller handles all SDRAM protocol requirements T
34. contained a lot of load branch and multiply instructions and a emulated floating point multiplication or divide will need some extra instructions since they both have to be emulated due to no hard multiplier nor divider is available in these configurations All load instructions will stall the NIOS II pipeline due to its load delay of two cycles The small cache system causes a lot of replacement conflicts then there will be a higher load on the system memory and on the system bus as well In this program the branch handling capabilities has a impact on the execution performance especially on the NIOS II if its predictor predicts wrong the pipeline has to be flushed Pipeline flushing could be time consuming if it happens too often since the execution has to restart from the instruction that comes after the branch instruction Finally their non floating composite values are quite equal despite the cache size differences but the difference concerning the floating point composite is approximately 30 in this case the cache sizes and the write buffers that LEON2 uses speeds up the execution and the load delay as mentioned above affects the execution times on the NIOS II 31 Comparison of Synthesizable Processor Cores 9 MINIMUM AREA 9 3 3 Control Application To find out how good each processor is when dealing with soft float operations and as a complement to the floating point programs in the Stanford benchmark set the control
35. cuted on the Minimum Area configuration in one frequency To make the benchmark part possible a cross compiler tool chain for each processor system have been used The benchmark results are discussed and evaluated Both processor cores perform equal on Dhrystone and Stanford on the Minimum Area configuration but LEON2 is the fastest one on the Control Ap plication On the Maximum Performance configuration NIOS II is fastest on Dhytstone and Stanford LEON2 performs best on the Control Application again Sammanfattning Syftet med detta examensarbete har varit att j mf ra tv syntetiserbara processorer LEON2 som Gaisler Research har utevecklat och NIOS II som Altera tillhandah ller Arbetet best r av tre delar 1 J mf relse av processorerna 2 Implementering p ett FPGA utevecklingskort 3 Prestantautv rdering med hj lp av benchmarkprogram I den f rsta delen av arbetet har processorernas arkitektur karakt ristiska delar s som antalet pipeline steg cachesystem och konfigurerbarhet j mf rts och utv rderats De b da processorerna har implementer ats p samma utvecklingskort baserat p en Altera Cyclone FPGA Som prestandautv dering har fyra program k rts p de b da processorerna Dhrystone Stanford en typisk styrapplikation och Paranoia De tre f rsta programmen har k rts p tv olika processorkonfigurationer Minimum Area respektive Max imal Prestanda vid tv olika frekvenser
36. d implements a double word write buffer It can also perform bus snooping on the AHB bus A local scratch pad ram can also be added to the data cache controller to allow O wait states access without requiring data write back to external memory Data cache tag layout 4 Kb set 32 bytes line ATAG 31 12 Not Used 11 10 LRR 9 LOCK 8 VALID 7 0 Only the necessary bits will be implemented in the cache tag depending on the configuration The LRR field is used to store the replacement history if the LRR replacement scheme has been chosen LOCK indicates if a line is locked or not Cacheable Memories PROM and RAM Non cacheable I O and Internal AHB Comparison of Synthesizable Processor Cores 2 LEON2 Write buffer Consists of three 32 bit registers to temporarily store data until it is sent to the destination acts like a FIFO Cache line locking If the lock bit in the cache is set to 1 it prevents the cache line to be replaced by the replacement algorithm LRR LRU or Random CCR Cache Control Register The operation of the instruction and data caches is controlled through a common CCR Each cache can be in three modes disabled enabled or frozen The register is 32 bit wide Disabled No caching all Load Store requests are passed to the memory controller directly Enabled Both instruction and data is cached Frozen As enabled but no new lines are allocated on read mis
37. elow a list of approximately corresponding number of integer instructions can be seen The numbers have been taken from the NIOS II instruction set simulator when a hardware based multiplier and divider were available The numbers of integer instructions on LEON2 may differ due to the difference in their instruction set Table 7 Floating point operations and their corresponding number of integer instructions when emulated in software FLOATING POINT OPERATION NR OF INTEGER INSTRUCTIONS NR OF CYCLES ADDITION 350 600 SUBTRACTION 350 600 MULTIPLICATION 550 1300 DIVIDE 1550 2000 The numbers in table 7 above shows that floating point emulation takes roughly 50 200 times longer compared to regular integer arithmetics If no hardware multiplier or divider is available the number of integer instructions will increase since the multiplication and division instructions themselves have to be emulated 11 4 GNU GCC specific compilation flag 23 Comparison of Synthesizable Processor Cores 8 BENCHMARKING 8 2 The Different Benchmarks Used In this section the four different benchmarks used is presented 8 2 1 Dhrystone Dhrystone is a benchmark invented in 1984 by Reinhold P Weicker The benchmark was first published in ADA today the C version of the benchmark is mainly used The current version of Dhrystone version 2 1 was created in 1988 has been used to measure the integer performance on both processors The origi nal purp
38. eme depends not only on the accuracy but also on the cost of a branch if the prediction was wrong In section 5 1 a comparison of their two different branch handling methods can be seen Static prediction In the NIOS II s core Static branch prediction is implemented using the branch offset direction A negative offset predict taken A positive offset predict not taken Dynamic prediction In the NIOS If core Dynamic branch prediction is implemented using a 2 bit branch history table Branch Cycles In the table 4 below the NIOS II branch cycles are shown Table 4 NIOS II Branch Prediction Cycles Prediction Cycles Penalty CORRECTLY PREDICTED TAKEN 2 NO PENALTY CORRECTLY PREDICTED NOT TAKEN 1 NO PENALTY MISPREDICTED 4 PIPELINE IS FLUSHED Comparison of Synthesizable Processor Cores 3 NIOS II 3 4 Cache System The NIOS II f processor core supports both instruction and data caches Both caches are always enabled at run time Data cache bypass methods are available via software Cache management and coherency are handled by software the instruction set provides instructions for cache management The core supports the 31 bit cache bypass method for accessing I O on the data master port 3 4 1 Instruction Cache The instruction cache has the following features Direct mapped implementation Critical word first 32 Bytes Eight words per cache line Configurable size 512 bytes to 64 Kbytes The instructi
39. essed in a single access in 32 bit mode 2 6 4 SDRAM SDRAM access is supported to two banks of PC100 133 compatible devices The controller supports 64 512 MByte devices The SDRAM controller contains a refresh function that periodically issues an AUTO REFRESH command to both SDRAM banks the refresh period could be programmed in the memory controller register The SDRAM can also be write protected Comparison of Synthesizable Processor Cores 2 LEON2 2 7 System Interfaces 2 7 1 UART Two identical UARTs are provided for serial communications The UART support data frames with 8 data bits one start bit one optional parity bit and one stop bit Hardware flow control is supported through the RTSN CTSN hand shake signals The two UARTs are possible to run in loop back mode to ensure a working connection 2 7 2 Ethernet MAC A 10 100 Mbps Ethernet MAC is available it is based on the core from OpenCores 11 with tw AHB interfaces one master and one slave The AHB master interface is used by the MAC DMA engine to transfer Ethernet packets to and from memory The slave handles all configuration Interrupt generated by the Ethernet MAC is routed to the interrupt controller 2 7 3 PCI Primary used for debugging purposes it supports DSU communications over the PCI bus if the develop ment board used has a PCI connector The interface consists of one PCI memory BAR occupying 2 Mbyte of the PCI address space and an AHB address
40. going to compare It is important to understand how different features affect each other and how the performance is affected both in a positive and a negative manner In this case regarding the minimum area configurations each processor core have been configured to be as small as possible with respect to the number of LE s and the total number of cache bits used Multiplication and division is emulated in software Concerning the maximum performance configurations the idea was to use as much as possible of all available resources The multiplier and divider was chosen to give as good timing as possible and the num ber of cache bits which can be used is set to the maximum available on the FPGA It is important to keep in mind that benchmark performance will vary depending on the processor con figuration implementation tools targeted FPGA architecture device speed grade the software compiler and library used 8 1 1 Floating point Emulation Since both processor cores are intended to be used in embedded applications no floating point unit FPU is included by default To be able to execute programs that contain floating point arithmetic in the high level source code the floating point part has to be emulated The compiler has to be informed about it during compilation by using the msoft float flag The compiler then inserts a specified sequence of integer instructions which behaves like it was done by a FPU In table 7 b
41. guage Which Benchmark Program Version is Used Which Tool Chain Compiler Library Which Optimization Level is Used Which Hardware is Used and How the Processor Core is Configured Nn FB WN Which Processor Frequency Regarding the benchmarks in this report one must keep in mind that the NIOS II processor is optimized with respect to both FPGA and development board used There might be some features the LEON2 could not utilize good enough on the FPGA or on the development board used In the following tests all programs have been compiled with the GCC 02 flag and the msoft float flag All maximum performance executables were compiled with their hardware multiplication and divide specific flags respectively If some of these benchmarks are going to be executed on the same target hard ware it is plausible that the results may differ by 1 since the processor behavior is not deterministic All benchmark sets have been executed on both processor cores at two frequencies 25 MHZ and 50 MHz Two different frequencies was chosen to see how the execution times are affected when the frequency is doubled If the frequency is doubled the execution times are not always halved depending on the new timing criteria 22 Comparison of Synthesizable Processor Cores 8 BENCHMARKING When a comparison of two or more devices are to be done one must be sure that the comparison is relevant you must be very careful of what you are
42. he core can access SDRAM subsystem with the following data widths 8 16 32 64 bits various memory sizes and multiple chip selects Up to 4 banks of memory is supported Because the Avalon interface is latency aware pipelined read transfers are allowed 3 6 2 DMA The DMA controller performs bulk data transfers reading data from a source address range and writing the data to a different address range An Avalon master peripheral such as the NIOS II can provide memory transfer tasks to the DMA controller independently of the processor The controller is also capable of performing streaming Avalon transactions 3 6 3 CFI The common flash interface core CFI controller provides connection to external flash memory The Avalon tristate bridge creates an off chip memory bus that allows the flash chip to share address and data pins with other memory chips Avalon master ports can perform read transfers directly from the CFI controller s Avalon port 3 6 4 EPCS The EPCS device controller core allows NIOS II systems to access an Altera EPCS serial configuration devices The EPCS device is able to store non volatile program data and FPGA configuration data Boot loading is also provided Comparison of Synthesizable Processor Cores 3 NIOS II 3 7 System Interfaces 3 7 1 UART The UART core provides a register mapped Avalon slave interface which allows communication with master peripherals such as NIOS II It provides configurable
43. hen a more computing intensive program is executed it will reveal a more realistic work load on the processor as well as on the memory system As the numbers in table 17 shows the LEON2 performs about 30 better than the NIOS II The difference could depend on the multiplier latency which is six more cycles on the NIOS II and the load delay which is one cycle on LEON2 and two cycles on the NIOS II 10 4 Maximum Performance Conclusions As one could see in the result sections above the execution times has decreased compared with the Mini mum Area results When a hard multiplier is available on chip it improves the execution speed compared to software emulation When small programs like the Stanford benchmark set is executed a bigger cache system in not always a advantage If it is too big it will introduce some overhead by checking empty places while accessing the caches If the cache is to small there will be replacement conflicts which will decrease the execution performance since the data and the instructions have to be fetched from the main memory In loop intensive applications the performance will be improved as seen in the results above since the temporal and spatial locality in the bigger caches will be improved then data and instructions does not have to be fetched from the main memory that often 39 Comparison of Synthesizable Processor Cores 11 PARANOIA 11 Paranoia In this section the results from flo
44. ign Write Back The pipeline is stalled when one of these conditions occurs Multi cycle instructions Avalon instruction master port read access Avalon data master port read write access Data dependencies on long latency instructions When a stall has occurred no new instructions enter any stage Only The Decode and Align stages creates stalls Up to thirteen depends on the multiplier latency instructions can be executed while waiting for the result from a multicycle instruction if there is no data dependency between the result of the multicycle instruction and the other instructions Comparison of Synthesizable Processor Cores 3 NIOS II 3 3 2 Multiply and Divide Options The processor supports a variety of multiplication and divide options mostly depending on the FPGA according to the table 3 below No embedded multiplier or divider is provided on the development board used in this thesis work Table 3 NIOS II Multiply and Divide Options ALU option Details CPI Result Latency cycles No HW MUL DIV EMULATED 40 N A EMBEDDED STRATIX I amp II 32 x 32 1 2 EMBEDDED CYCLONE II 32 x 16 5 2 LE BASED 32x4 11 2 HARDWARE DIVIDE 32 32 4 66 2 The hardware divide has no exception when a division by zero occurs not on overflow either 3 3 3 Branch Prediction The core is provided with a branch predictor to achieve better performance while avoiding stalls during execution The effectiveness of a branch predictor sch
45. ls The core also supports an optional enhanced interface that allows real time trace data to be routed out of the processor and stored in an external debug probe 3 8 2 Exception Controller The architecture provides a simple non vectored exception controller to handle all exception types All exceptions cause the processor to transfer execution to a single exception address The handler at this address determines the cause of the exception and finishes the appropriate exception routine 3 8 3 Interrupt Controller The architecture supports thirty two 32 external hardware interrupts The core has thirty two 32 level sensitive interrupt request IRQ inputs providing a unique input for each interrupt source The priority is determined by software The software can enable and disable any interrupt source individually by masking the IENABLE control register Comparison of Synthesizable Processor Cores 4 BUS COMPARISON 4 Bus Comparison This section contains a more detailed comparison of the internal buses used by each processor core see table 5 below The AMBA AHB and AMBA APB which LEON2 uses and the Avalon switch fabric which the NIOS Il uses Table 5 Bus Comparison Option AMBA AHB AMBA APB AVALON PROVIDER ARM ARM ALTERA Bus VERSION REV 2 0 REV 2 0 1 2 DATA BUS WIDTH 8 1026 BITS 8 32 BITS 8 32 BITS ADDRESS BUS WIDTH 32 BITS 32 BITS 32 BITS ARCHITECTURE PROTOCOL BRIDGING TRANSFER SIZES TRANSFER CYCLES
46. ls if the processor fulfil the IEEE754 standard or if there were any failures in the implementation 8 2 4 Control Application Since Paranoia does not contain any time measuring a floating point program that measures the execution time has been executed on both processors the program is a kind of control application that does a lot of floating point calculations This program reveals the performance of the soft float part on each processor core both hardware and the software 25 Comparison of Synthesizable Processor Cores 9 MINIMUM AREA 9 Minimum Area This section and section 10 contains the third part of the thesis work This section contains the Mini mum Area configurations and the results of the benchmarks mentioned in section 8 2 Each processor configuration can be seen in section 9 1 below 9 1 Processor Configurations Each processor configuration can be seen in the table 8 below Additional info concerning the processors take a look in section 6 Table 8 Minimum Area Processor Configurations PROCESSOR CORE LEON2 NIOS II OPTION UNIT CACHE INSTRUCTION CACHE SIZE 1024 512 BYTES ASSOCIATIVITY 1 1 NR OF SETS CACHE LINES 32 16 LINES BYTES LINE 32 32 BYTES SUB BLOCK SIZE 1 BIT 4 BYTE WORD TOTAL LINE SIZE 291 287 BITS DATA CACHE SIZE 1024 512 BYTES ASSOCIATIVITY 1 1 NR OF SETS CACHE LINES 32 128 LINES BYTES LINE 32 4 BYTES SUB BLOCK SIZE 1 BIT 4 BYTE WORD TOTAL LINE SIZE 291 55 BITS
47. ne Its data handling capabilities is better than on the NIOS II 41 Comparison of Synthesizable Processor Cores 12 SUMMARY By respect to their sizes it is noticeable that the NIOS II core is vendor optimized and the so urce is encrypted which is a limit to portability when it only could be used in Altera FPGA s The LEON2 which has no vendor restriction fits well in a low end FPGA like the one used in this work even if it is not optimized with respect to a certain technology To achieve best performance when dealing with embedded systems the hardware and software have to be designed together When having a FPGA based platform the whole system can be re configured by respect to the FPGA capability to change characteristics if its performance is not good enough With respect to their configurablity the LEON2 is the best by providing multi set cache system with con figurable sizes and bytes line and a variety of cache replacement policies and multipliers On the NIOS II only the cache sizes are configurable the multiplier option depends on the target FPGA used One NIOS II advantage is that it supports custom instructions which could speed up applications where a certain task is dominating 42 Comparison of Synthesizable Processor Cores 13 APPENDIX 13 Appendix Appendix A Program Versions This section contains the different development tool versions used in this work Provider Program Version SYNPL
48. on byte address has the following fields and sizes for a 8Kbyte cache TAG 30 15 LINE 14 5 OFFSET 4 2 00 1 0 The offset field is 3 bits wide an 8 word line the tag and line sizes depends on the cache size The maximum instruction address size is 31 bits The instruction cache is permanently enabled and can not be bypassed 3 4 2 Data Cache The data cache has the following features Direct mapped implementation Write back Write allocate 4 Bytes One word per cache line Configurable size 512 bytes to 64 Kbytes The data byte address has the following fields and sizes for a 1 Kbyte cache TAG 22 10 LINE 9 2 OFFSET 1 0 The offset field is 2 bits wide the tag and line sizes depends on the cache size In all current NIOS II cores there is no hardware cache coherency mechanism Therefore if there are multiple masters accessing shared memory software must explicitly maintain coherency across all masters Comparison of Synthesizable Processor Cores 3 NIOS II 3 5 Internal Busses 3 5 1 Avalon On chip Bus The Avalon 13 bus is a simple bus architecture designed to connect on chip processor and peripherals together into a working NIOS II based system The Avalon is an interface that specifies the port con nections between master and slave components it also specifies the timing by which these components communicate The Avalon bus supports advanced features e g latency
49. ose was to create a short benchmark program representative of integer programming Its code is dominated by simple integer arithmetic string operations logic decisions and memory accesses intended to behave like a typical computing application Most of the execution time is spent in library functions The Dhrystone result is determined by measuring the average time a processor takes to perform many iterations of a single loop containing a fixed sequence of instructions The output from the benchmark is the number of Dhrystones per second and the number of iterations of the main loop per second 8 2 2 Stanford The Stanford suite is gathered by John Hennessy and modified by Peter Nye The version of the suite used is 4 2 The suite consists of three major program categories Recursion Loop intensive Sorting algorithms All four loop intensive programs include multiplication two of these includes floating point arithmetics All programs perform a check to make sure each program will get the right output the time spent do ing the check is included in the execution time The following ten programs are included Perm Calculates permutations recursively Towers Solve the Towers of Hanoi problem Queens Solve the Eight Queens Problem fifty times IntMm Multiply two random integer matrices Mm Multiply two random real matrices Puzzle A Compute bound program Quick Sort a random array using the Quicksort
50. ping part of the LEON2 synthesis was done in Synplify Pro 8 0 and the place and route part was done in Quartus II Concerning the NIOS II it was straight forward all you had to do was to configure the system and then do the synthesis and place and route in Quartus II The resulting netlist was downloaded to the target hardware through Quartus This was also done for the LEON2 On LEON2 the benchmark programs were downloaded to the target hardware through GRMON 20 which connects to the DSU and allows debugging of the system On the NIOS II the software downloading was done through the provided IDE 21 Comparison of Synthesizable Processor Cores 8 BENCHMARKING 8 Benchmarking Benchmarking should be an objective reproducible measure of performance for example execution speed comparisons It must be meaningful and test something relevant to the user Benchmarks could also be used to monitor performance changes during development The benchmarks in this thesis work only consists of integer and emulated floating point performance Two important questions should be asked of any benchmarking activity How accurately does the benchmark predict real world performance How reliably can a comparison between competing processors be made 8 1 Benchmarking considerations When a set of benchmarks are to be executed on several microprocessor architectures one must keep a few things in mind regarding Which Programming Lan
51. res 3 NIOS II 3 2 Instruction Set Architecture The Instruction Set Architecture ISA is compatible across all NIOS II processor systems The supported addressing modes are register register or register immediate There is also a possibility to add custom instructions Multibyte numbers are stored as little endian When the processor issues a valid instruction that is not implemented in hardware an unimplemented instruction exception is generated The exception handler determines which instruction generated the ex ception If the instruction is not implemented in hardware control is passed to an exception routine that emulates the operation in software concerning multiply and divide instructions 3 3 Integer Unit The integer unit IU architecture supports a flat register file consisting of thirty two 32 bit general pur pose registers Three control registers are also provided The architecture is prepared for the future addition of floating point registers All instructions take one or more cycles to execute Some instructions have other penalties associated with their execution Late result instructions have a two cycle bubble placed between them and the instruction that uses the result Instructions that uses Avalon transfers are stalled until it is completed 3 3 1 Pipeline Architecture The NIOS II f core employs a 6 stage pipeline with following stages Instruction Fetch Instruction Decode Execute Memory Al
52. ses 2 5 Internal Busses 2 5 1 AMBA The processor has a full implementation of AMBA 2 0 10 AHB and APB on chip buses The APB bus is used to access on chip registers on the peripheral functions while the AHB bus is used for high speed data transmission A flexible configuration scheme makes it simple to add new IP cores A more detailed description of the internal buses can be seen in section 4 2 5 2 AHB Bus LEON2 uses the AMBA 2 0 AHB bus to connect the processor cache controllers to the memory controller and other high speed units Default configuration the processor is the only master on the bus while there are two slaves the memory controller and the APB bridge 2 5 3 APB Bus The APB bridge is connected to the AHB bus as a slave and acts as the only master on the APB bus The most on chip peripherals are accessed through the APB bus eg UART I O Timer IrqCtrl A detailed bus overview of how the peripherals are connected can be seen in figure on page 2 Comparison of Synthesizable Processor Cores 2 LEON2 2 6 Memory Interfaces The memory interface provides a direct interface to PROM memory mapped I O devices static RAM SRAM and synchronous dynamic RAM SDRAM The different controllers can be programmed to ei ther 8 16 32 64 bits data width Chip select decoding is done for two PROM banks one I O bank five SRAM banks and two SDRAM banks The external memory bus is controlled by a programmable memory
53. sses 6 5 die 4 we RG Be a Se Sed ee 252 AMBA sch ti e Sse Gia debe is edt fag eas 2 2 AHB BUS 26 ele Ee See EN Bw oe Re el BRAS al BE ee 23 3 APB Bus fost toh AA ee Leite Bia eb ae Be ab a ted amp 2 6 Memory Interfaces eeose be posed Rede a rea E a 201 SRAM ques easels Gide e ee a A pe BR SE arte aed 26 2 PROM vee poms ard ee ok ab fee Ree Re Road Sab Oe Bo Bee 2 6 3 VO DEVICES 4 5 E ae bee has bea ee ate eg we bee ee 166 26 4 SDRAM arty 008 bat dS ole a the Ee BP Gee ae tle BS ae eet te S R hk 2 7 System Interfaces soo ac eee ee a he he Bae be a a 2 71 VART D d taht e Sass be hd ts fog bed 2 02 Ethernet MAC soc olsen Be pde Ae ee Da lee Bk Bee ere ee 8 ES CUA ce E BE ROR ARE UN N RA R Sk EN Ar 2 8 Additional Units and Features ere ee ee 2 8 1 Debug Support Unit e e IAS E BUEL A ON DEI gt TIMES 2 A ate wae bee it be ate eg e a USA Watchdog a2 6 0 oe Ae ER Ge eb eS A A Bie as 2 8 3 Interrupt Controller gt gt gt ses eda es Se a eee eS 29 07 Paralel VWOSBOTE 00d ye thes liga Ach feo aes od LAL By Be ede oe veoh Ay bok ig 28h POWELL Wi Slee BAIR Sia A See A BO Bee Boh a 2 9 CO POCESSOLS cr ak san er GIG BRE A Be RS BRP AG BBA Aw lee eh ZIL EPU amp pret oti O det hed 3M elie Ew 2 92 QGREPW 250008 A Ba AS ee ta 2 9 3 Generic Co processor 2 be SIR Be RR RR ER 2 10 Memory Management Unit e 2 10 1 Translation Look
54. terface to the GRFPU available from Gaisler Research and Meiko FPU core from Sun Microsystems 2 9 2 GRFPU The GRFPU operates on single and double precision operands and implements all SPARC V8 FPU instructions It is interfaced to the LEON2 pipeline using a LEON2 specific FPU controller GRFPC The control unit allows FPU instructions to be executed simultaneously with integer instructions Only in case of a data or resource dependency the integer pipeline is stalled 2 9 3 Generic Co processor LEON2 can be configured to provide a generic co processor The interface allows execution in parallel with the integer unit IU One co processor instruction can be started each clock cycle if there is no data or resource dependency 2 10 Memory Management Unit With the optional Memory Management Unit MMU it implements a SPARC V8 reference MMU and allows usage of robust operating systems such as Linux The MMU can have a separate Instruction and Data or a common Translation Look aside Buffer TLB The TLB is configurable for 2 32 fully associative entries When the MMU is disabled the caches operate as normal When enabled the cache tags store the virtual address and also include an 8 bit context field 2 10 1 Translation Look aside Buffer The MMU can be configured to use a shared TLB the number of TLB entries can be set to 2 32 The orga nization of the TLB and number of entries is not visible to the software and operating s
55. ts processor architecture and system analysis implementation on a FPGA and benchmarking Two different processor configurations have been compared and evaluated minimum area and maximum performance Both configurations have been executed in two different fre quencies 25 MHz and 50 MHz respectively The benchmarks used in this work are Dhrystone Stanford Paranoia and a typical control application the execution results have been discussed for each configuration Comparison of Synthesizable Processor Cores 2 LEON2 Licensing and Availability This section contains a evaluation of their license forms respectively The LEON2 full VHDL source code 1s available under the GNU LGPL 5 license which allows free and unlimited use of the processor core and peripherals Since it is open source it is not restricted to a certain technology LEON2 based systems could be implemented in both FPGA and ASIC The full LEON2 source code is available through the Gaisler Research homepage 6 All NIOS II development kits includes a perpetual non cost license 7 to develop and ship systems using the processor core and peripherals in a Altera FPGA A implementation as a ASIC is also possible The NIOS II is distributed as a encrypted VHDL file 1 Initial Architecture Analysis This section contains the first part of the work In section 2 the LEON2 is described and analyzed in section 3 the same kind of description and analysis is done for the NIOS2
56. uded in hardware in this configuration Regarding the next seven programs Intmm Mm Puzzle Quick Bubble Tree and FFT the difference is obvious since they all contain a lot of data to be processed where the bigger cache system is a advantage Concerning the matrix multiplication programs Intmm and Mm and Puzzle which are loop intensive the speed up is caused by the hardware multiplier and the bigger caches where the temporal and spatial locality are improved then it is a bigger possibility that the desired data or instruction already is in the caches respectively and no fetching from the main memory is needed Their multiplier performance decreases the execution times almost three times Especially the NIOS II multiplier performs really good even if it has such a big latency compared to the LEON2 multiplier Thirteen cycles compared with five on the LEON2 37 Comparison of Synthesizable Processor Cores 10 MAXIMUM PERFORMANCE Regarding the sorting algorithms Quick Bubble and Tree which also takes advantage of the big cache system the performance has increased The equal execution times on the Quick and Bubble sort algo rithms on LEON2 at 50 MHz probably depends on the data which the random function generates other wise the Quicksort algorithm would be the fastest one as it is on the NIOS II and on the LEON2 in the Minimum Area section The Tree sort algorithm is deeply recursive which causes register window overflo
57. ults of the benchmarking their integer performance are quite equal despite the cache size differences When dealing with emulated floating point applications LEON2 is faster by taking advantage of its write buffers and the bigger cache system In the NIOS II case where the load delay which is two cycles affects the per formance negatively by stalling the pipeline If a stall occurs many times especially when dealing with floating point emulation combined with a relatively small cache system its performance will drop by a certain amount In the Maximum Performance section where the aim was to configure both processor cores to achieve as high performance as possible Multiplication and divide is performed in a hardware based multiplier and divider respectively Their sizes and latencies have been configured to gain as high overall performance as possible The NIOS II has the best integer performance especially on Dhrystone which contains a fixed sequence of instructions where the hole sequence more or less fits in the instruction and data caches re spectively The bigger cache system improves the performance by improving the cache hit rate which on such small applications like Dhrystone and Stanford is almost 100 on both processors Then the benchmark results will be representative of integer performance rather than the overall system performance In the emulated floating point application part LEON2 once again is the fastest o
58. ve 26 9 Minimum Area Synthesis Results o o ss rss ss ss 27 10 Dhrystone Results Minimum Area rer res ss ss 000 28 11 Stanford Results Minimum rea 29 12 Control Application Results Minimum Area 32 13 Maximum Performance Processor Configurations o 33 14 Maximum Performance Synthesis Results o o 34 15 Dhrystone Results Maximum Performance 35 16 Stanford Results Maximum Performance 000 000 4 36 17 Control Application Results Maximum Performance o o 39 Objectives Today synthesizable processor cores are becoming common for embedded microprocessor based applica tions where high performance is required Because of the Field Programmable Gate Arrays FPGA are becoming bigger and faster they can contain a complete microprocessor based system The first syntesiz able processor cores were 8 bit and showed up in the late 1990 s now there are 32 bit processor cores available In this context it is of interest to make a comparative analysis with synthesizable processor cores from different providers In this thesis work two syntesizable processor cores have been compared the LEON2 1 which is a SPARC V8 compatible processor core developed by Gaisler Research 2 and the NIOS II which is 3 developed by Altera 4 The work consists of three major par
59. w on the LEON2 most of the execution time is spent in the trap routines but the NIOS II handles the recursive part very good indeed The difference in the FFT program is only about 4 one reason could be the difference in the multiplier latency since it is not as multiplication intensive as the Mm program where the difference is about 10 Overall when comparing the composite sum the NIOS II is roughly 30 better The cache system is big enough to contain all necessary instructions and data since a majority of the programs are loop intensive integer programs The LEON2 on the other hand has the best floating point performance but not as big as in the minimum area section 38 Comparison of Synthesizable Processor Cores 10 MAXIMUM PERFORMANCE 10 3 3 Control Application As a complement to the floating point programs in the Stanford benchmark set the Control Application was executed to reveal emulated floating point performance differences In table 17 below the result of the execution of the Control Application can be seen Table 17 Control Application Results Maximum Performance PROCESSOR CORE LEON2 NIOSH LEON2 NIOSI FREQUENCY 25 MHz 25 MHz 50 MHz 50 MHz PROGRAM UNIT CONTROL APPLICATION 200 293 107 141 SEC Control Application Result Comments This time the floating point emulation performance has increased by beneficiation of the bigger cache system and the hardware based multiplier and divider used W
60. wide instruction set and few addressing modes Register Register and Register Immediate Multibyte numbers are stored as big endian 2 3 Integer Unit The LEON2 integer unit implements the full SPARC V8 standard including all multiply and divide in structions The implementation is focused on portability and low complexity The number of register windows is configurable within the limit of the SPARC standard 2 32 8 is default Total number of registers by default is 136 Separate instruction and data cache interfaces are provided Harvard Architecture The LEON2 is provided with a branch delay slot more info concerning the delay slot feature can be seen in section 5 1 2 3 1 Pipeline Architecture The LEON2 integer unit uses a single instruction issue pipeline with 5 stages The stages can be seen below Instruction Fetch Instruction Decode Execute Memory Write Back The LEON pipeline is stalled until the operation is completed if one of these conditions occurs Multi Cycle Instruction Load or Store from the memory SRAM or SDRAM Comparison of Synthesizable Processor Cores 2 LEON2 2 3 2 Multiply and Divide Options The LEON2 has a variety of multipliers available In table 1 below the LEON2 multiplier options can be seen Table 1 LEON2 Multiply Options Configuration Result latency cycles 32 x 32 1 32x 16 2 32 x 8 4 16x 16 4 16 x 16 PIPELINE REG 5 ITERATIVE 35 EMULATED IN SOFTWARE 40
61. xecuting a program like the Control Application will reveal the total system performance then the processor has to work with a high load during a longer time 32 Comparison of Synthesizable Processor Cores 10 MAXIMUM PERFORMANCE 10 Maximum Performance This section contains the last part of the thesis work This part contains the Maximum Performance configurations and the results of the benchmarks mentioned in section 8 2 10 1 Processor Configurations Each processor configuration can be seen in the table 13 below Additional info concerning the processors take a look in section 6 Table 13 Maximum Performance Processor Configurations PROCESSOR CORE LEON2 NIOS II OPTION UNIT Cache INSTRUCTION CACHE ASSOCIATIVITY SET SIZE 2 4096 1 8192 NR OF SETS KBYTES CACHE SIZE 8192 8192 BYTES REPLACEMENT POLICY LRU N A CACHE LINES 256 256 Lines BYTES LINE 32 32 Bytes SUB BLOCK SIZE 1 Bit 4 Byte Word TOTAL LINE SIZE 294 278 BITS DATA CACHE ASSOCIATIVITY SET SIZE 2 4096 1 8192 NR OF SETS KBYTES CACHE SIZE 8192 8192 BYTES REPLACEMENT POLICY LRU N A CACHE LINES 256 2048 LINES BYTES LINE 16 4 BYTES SUB BLOCK SIZE 1 BIT 4 BYTE WORD TOTAL LINE SIZE 155 55 BITS Memory Controller SRAM 1 1 MBYTE ALU MULTIPLIER SIZE LATENCY 16x16 5 32x4 11 2 DIVIDER SIZE LATENCY 64 32 35 32 32 N A Configuration Comments Both processor cores have be configured to achieve as high performance as possible The
62. ystem modification are therefore not required Comparison of Synthesizable Processor Cores 3 NIOS II 3 NIOS II There are three versions of the NIOS II 12 processor core available one with a single pipeline stage and no cache NIOS Il e one with five pipeline stages and instruction cache NIOS II s and the last one with six pipeline stages and both instruction and data caches NIOS II f In this thesis the focus is on the NIOS II f core since it is the most extensive one of the available NIOS II cores The processor architecture cache structure Instruction Set Architecture peripherals and configuration options are described below 3 1 System Overview The NIOS II processor is a general purpose single issue RISC processor core providing Full 32 bit instruction set data path and address space 32 General Purpose Registers Flat register file 32 External Interrupt Sources Barrel Shifter Avalon System Bus Instruction and Data Cache Memories Harvard Architecture Access to On chip Peripherals and Interfaces to Off chip Peripherals and Memories The core is provided as a encrypted VHDL file A typical NIOS II system can be seen in figure 2 below ES JTAG Debug Module NIOS II Processor Core General Purpose I O Ethernet MAC PHY Interface SDRAM Controller Avalon Switch Fabric Tristate Bridge Figure 2 NIOS II System Overview Comparison of Synthesizable Processor Co
Download Pdf Manuals
Related Search
Related Contents
folpan UBG PCP15654.qxd MSI Mainboard K9N Neo-F REGULADOR - Leroy Somer Alpha 21164 Microprocessor Hardware Reference Manual Stokke Tripp Trap 07 High Chair Set-up and installation Copyright © All rights reserved.
Failed to retrieve file