Home

Navigation manual GB

image

Contents

1. 3 1 2 2 Searching for a Place of Interest using preset categories The Preset search feature lets you quickly find the most frequently selected types of Places Menu 1 If you are on the Map screen tap to return to the Navigation menu La fl 2 Inthe Navigation menu tap the following buttons Baiiia P Petrol Station Along Route f Quick Search 2 Parking Along Route At My Destination r R Restaurant A Along Route r 2 Accommodation Custom Search At My Destination 4 Back 3 The preset search categories appear Gas Station Along Route e If an active route exists petrol stations are searched along the route e lf there is no active route destination is not selected they are searched around the current position e lf the current position is not available either no GPS signal they are searched around the last known position Q Parking At My Destination f e If an active route exists parking lots are searched around the destination of the route 36 RDN 573BT NAVIGATION MANUAL CALIBER e lf there is no active route destination is not selected they are searched around the current position e lf the current position is not available either no GPS signal they are searched around the last known position D Restaurant Along Route e If an active route exists restaurants are searched along the route e lf there is no active route destination is not sel
2. Roads are used only if access for buses is allowed Private roads resident only roads and walkways are excluded from routes E Taxi Manoeuvre restrictions and directional constraints are taken into account when planning a route Roads are used only if access for taxis is allowed Private roads resident only roads and walkways are excluded from routes P Truck Manoeuvre restrictions and directional constraints are taken into account when planning a route Roads are used only if access for lorries is allowed Private roads resident only roads and walkways are excluded from routes U turns are excluded from routes turning back on a divided road is not considered as a U turn e Road types used or avoided in route calculation Motorways Period Charge Per use Toll Ferries wy Unpaved Roads Whenever data exist route calculation takes into account statistical traffic data for the given day of week and time of day page 78 Real time Traffic events are also taken into account and sometimes greatly modify the route Caliber automatically recalculates the route if you deviate from the proposed itinerary or if a newly received Traffic event concerns a part of the recommended route For further information about Route settings see page 85 74 RDN 573BT NAVIGATION MANUAL CALIBER 6 1 5 Green routing Route calculation is not only about finding the quickest or shortest route For some of th
3. Menu DON 1 If you are on the Map screen tap to return to the Navigation KR n In the Navigation menu tap the following buttons Ajden to search around the current position or if it is not available around the last know position The result list will be ordered by the distance from this position a Tap v r ik to search for a place within a selected city town The result list will be ordered by the distance from the centre of the selected city town 4 to search for a place around the destination of the active route The result list will be ordered by the distance from the destination Nong Rore Tap to search along the active route and not around a given point This is useful when you search for a later stopover that results in a minimal detour only such as searching for upcoming petrol stations or restaurants The result list will be ordered by the length of the necessary detour France Paris 41 CALIBER AUDIO TECHNOLOGY RDN 573BT NAVIGATION MANUAL M A m Vl 6 Select one of the main Place categories e g Accommodation to search in or tap Q Find by Name to search among all Places f List All Places faan B Accommodation fan A Airport c Automotive f de Back 7 Select one of the Place subcategories e g Hotel or Motel to search in or tap Q Find by Name to search in the selected Place category g List All Places in A
4. 79 CALIBER RDN 573BT NAVIGATION MANUAL M A m Vl 6 2 More menu The More menu M nL with various ver and additional applications Tap the following buttons Updates and Settings Extras Trip Monitor Count Information Back Button Description You can configure the program settings and modify the behaviour of Caliber Fine tune route planning options change the look of the Map screen turn on or off warnings or restart the Configuration wizard etc See the next chapter for details Visit www naviextras com to get additional content such as new maps or 3D landmarks and useful applications Updates and Extras If you save your trip logs when you arrive at some of your destinations or let the application automatically save the trip logs for you those logs are all listed here me ap one of the trips to see the trip statistics speed and altitude profile If track log has also been saved you can display it on the map with the selected colour Track logs can be exported to GPX files for later use Select a country from the list and see useful driving information about the selected country Information may include speed limits on different road types the maximum mem blood alcohol level and any compulsory equipment you need to show when stopped by the police Country Run the Demo and watch sample route simulations to see how navigation works The About section provides you wit
5. b Start entering the name of the city town on the keyboard 30 RDN 573BT NAVIGATION MANUAL CALIBER c Find the city town you need e The most likely city town name is always shown in the input field To accept it just tap the field you entered the first letters in e If the desired name does not show up the names that match the string appear in a list after entering a couple of characters to open the list of am Results results before it appears automatically tap the city town from the list Select ris France ntin Seine Saint Denis France u Pyr n es Atlantiques France nazol Haute Vienne France Back Oo Select Settlement 5 Instead of entering the street name tap This way the centre of the displayed city town becomes the destination of the route France Paris 6 A full screen map appears with the selected point in the middle If necessary tap the v map somewhere else to modify the destination The Cursor appears at the new p Next a Back CED to select a different destination 7 After a short summary of the route parameters the map appears showing the entire More location Tap to confirm the destination or tap route The route is automatically calculated Tap to modify route parameters or tap and start your journey poate Troyes C 0000 move rane Route Planning Method EE 7 Road Types Used Motorways Ferries Period Charge Unp
6. choose suitable colour themes from the list for both daytime and night use show or hide 3D buildings turn track logging on or off and manage the visibility of Place markers which Places to show on the map The map is always shown on the screen so that you can see the effect when you change a setting Map Settings View Mode 3D Viewpoint Normal i Automatic Overview ys er Colours Auto Day Map Colour Switch the map view between a 3D perspective view and a 2D top 3D down view Melia Adjust the basic zoom and tilt levels to your needs Three levels are Normal available F ea When selected the map zooms out to show an overview of the l surrounding area if the next route event manoeuvre is far When you get close to the event the normal map view returns Switch between daytime and night colour modes or let the software oe switch between the two modes automatically a few minutes before sunrise and a few minutes after sunset DEANE og Select the colour scheme used in daytime mode ena Eg Select the colour scheme used in night mode Show or suppress 3D landmarks 3D artistic or block representations of on prominent or well known objects ie Buildings on Show or suppress 3D city models 3D artistic or block representation of full city building data containing actual building size and position on the map Show or suppress the 3D elevation of the surrounding terrain di peng sate
7. more optional The Places in the list are ordered by their distance from the current or last known position from the selected city town from the destination or by the length of the Browse the list if necessary and tap one of the list items A full screen map appears with the selected point in the middle The name and address of the Place is displayed at the top of the screen optional Tap to see the details of the selected Place Tap to return to the map necessary detour If you need to reorder the list tap If necessary tap the map somewhere else to modify the destination The Cursor appears at the new location Tap to confirm the Back destination or tap to select a different destination After a short summary of the route parameters the map appears showing the entire More route The route is automatically calculated Tap CEN to modify route gt Go parameters or tap a Fase Troyes 10000 Aube France Skj r LSJ Meaux Route Planning Method y bad LE EOS Fa y and start your journey Road Types Used Motorways Ferries Period Charge Unpaved Roads Per use Toll f Eo Cancel 40 RDN 573BT NAVIGATION MANUAL CALIBER 3 1 2 4 Searching for a Place of Interest by name You can search for Places of Interest by their names You can search around different locations or along your route in the whole Place database or in one Place category or subcategory only
8. r Fa 1 9 Rue Albert Thomas History Reims he fF 2 24 Avenue du G n ral de Gaulle SS Nogent sur Seine f Back O O More 3 Tap the 4 or the 2 destination in the History field 4 A full screen map appears with the selected point in the middle If necessary tap the y map somewhere else to et the destination The Cursor appears at the new location Tap to confirm the destination or tap to select a different destination 5 After a short summary of the route parameters the map appears showing the entire More route The route is automatically calculated Tap gt Go to modify route parameters or tap and start your journey es 1 10000 Aube France Skt Leg Meaux Route Planning Method gris Road Types Used Motorways Ferries Period Charge Unpaved Roads Per use Toll f 4 Cancel 3 1 6 Selecting a recent destination from the History The destinations that you have set earlier appear in the History 1 Access the History e If you are on the Map screen tap and then tap e If you are in the Navigation menu tap and then tap History im 47 CALIBER RDN 573BT NAVIGATION MANUAL M A m Vl 2 The list of recent destinations appears Smart History promotes three destinations to the first page based on your previous routes most likely destinations The rest of the destinations are ordered by time they were last selected If necessary
9. 8eme Arrondissement Paris ue Royale 75008 Paris 8 me Arrondissement Paris ue Saint Florentin 75001 75008 Paris Sime Arrondissement Paris Paris Paris Ler Arrondissement Back 6 A full screen map appears with the selected point in the middle If necessary tap the V map somewhere else to modify the destination The Cursor appears at the new gt Next Back CED to select a different destination 7 After a short summary of the route parameters the map appears showing the entire More location Tap to confirm the destination or tap route The route is automatically calculated Tap to modify route parameters or tap and start your journey es d 10000 Aube France 113s Mux COU Route Planning Method x r PE Road Types Used Motorways Ferries Period Charge Unpaved Roads Per use Toll f 4 Cancel 3 1 1 4 Selecting a city town centre as the destination The city town centre is not the geometric centre of the city town but an arbitrary point the map creators have chosen In towns and villages it is usually the most important intersection in larger cities it is one of the important intersections Menu DSN 1 If you are on the Map screen tap to return to the Navigation menu l In the Navigation menu tap the following buttons im find Address If necessary modify the country as described earlier page 26 Select the destination city town a Tap
10. O More um 5 optional If necessary tap then Ma and enter the coordinate in UTM format UTM zone Easting d Northing E jack When finished tap A full screen map appears with the selected point in the middle If necessary tap the V map somewhere else to modify the destination The Cursor appears at the new location Tap to confirm the destination or tap to select a different destination 8 After a short summary of the route parameters the map appears showing the entire More route The route is automatically calculated Tap to modify route gt Go parameters or tap and start your journey a ones Troyes 1 50 10000 Aube France 7 161 km 13 Cn Men HOPE D ary 5 25 6 kg Route Planning Method Road Types Used a Evry Motorways Ferries cp i RN gt Kl Period Charge Unpaved Roads g Per use Toll apen gt Green amp Cance 49 CALIBER RDN 573BT NAVIGATION MANUAL M A m Vl 3 1 8 Building a route from the list of destinations Create Route You can also build your route destination by destination from the My Route menu Menu DON 1 If you are on the Map screen tap to return to the Navigation menu My Route 2 Inthe Navigation menu tap J Create Route 3 Tap r B Current GPS Position 4 There is only one line in the list of route points the start point of the route normally the current GPS positio
11. 2 Getting fartedLnsasvvarvsvvmvvsivsss ammes 2d Navigation Men seede kaken 8 2 2 Buttons and other controls on the NJ SFs 9 EA WA WA REE EE E em EE 10 RA Beyond single sereen tap EEE EE N EEE ER 11 Did MAPS RE EE EEE 12 2 3 1 Navigating on GE EE NE 12 2 3 2 TT RR EE NE EE ET 14 2 3 2 1 Vehimarker and Lock on Road seede eder 14 2 3 2 2 Selected map location Cursor and selected map object rrrrnnrnnnnnnnnnnnnnnnnvvnennnnnvvnrnnnnrvnerrrnnnrnnere 14 2 3 3 Objects on the Pi 14 2 3 3L Streets and REE EEE EN RE REE 14 23 32 TON NG 15 ESPN TE GO GL RENEE 16 NS de 17 2 33 39 Motorway exit Services nesis tinai E e T A E EE R ei E a 17 2 DNS 18 Zit of Elements of the active route ved 18 DING 19 2 3 4 Manipulating the EE EE 20 PR QUC KME Nee e T E E E E KN enrages cua enn atonies 21 2 3 6 Checking the details of the current position Where Am I rrenrrrnrrrrnrvnvrrrrnrrnnerrrnrrrnereenn 23 3 ONHPOA navigala na a a Job Selecting the destination of a route nosssosssssessseesessseeesssssressseeressseesssssresserreessesresseerre 25 3 1 1 Entering an address or a part of the address rrrrrrrrrrrrnnrrrnrrrerrrrrerrrrrrnrrrrrrrrrserernrnrnssrennnn 25 31 14 Entering an address ecesna nna ORE ER EE E ER EEEE EE EEE i aS 26 3 1 1 2 Entering the midpoint of a street as the destination ssroornnnrrnonrrnvvrnrnnrennnnnvenrnnennnrnnennrnssennrnsenn 28 3 1 1 3 Selecting an intersection as the destination rrrrnnnrvrvrnnnnvrvv
12. Avoidances i Cancel Route Route Alternatives i Itinerary RE Route Settings i i W Gose L gt Route Alternatives Tap You see the basic details of three route alternatives with the selected route planning method Tap any of them to see it on the map TEF a iaa Sa Tee Route Alternatives A1 1 i 57 CALIBER RDN 573BT NAVIGATION MANUAL M A m Vl More Results 6 Or if you cannot find a good alternative tap and scroll down for routes with different routing methods ay fe 7 Select one of the route alternatives then tap and hold for a few seconds to return to the Map screen Caliber recalculates the route The orange line now shows the new recommended route 3 4 8 Changing the vehicle used in route planning To recalculate the active route for a different vehicle do as follows These changes can also be made in Settings page 85 1 On the Map screen tap and then tap Vehicle r Navigation Mode Route Planning Method r He M TY Motorways a amp Back 2 Tap and then tap one of the following o L Emergency 7 2 ee Bus Nye P Truck 3 Caliber recalculates the route optimised for the new vehicle type The orange line now shows the new recommended route 58 RDN 573BT NAVIGATION MANUAL CALIBER 3 4 9 Changing the road types used in route planning To recalculate the active route with different road
13. Map screen tap to return to the Navigation menu 2 Inthe Navigation menu tap and then CALIBER RDN 573BT NAVIGATION MANUAL M A m Vl m Driving Time Management p Ask for Waiting Time r Configure Driving Timers Ask for Waiting Time 4 Tap to enable or disable this option 5 When finished tap and hold to return to the Map screen 5 3 Setting up driving time alerts In order to obey the regulations regarding continuous and daily driving you can set countdown timers to alert you when you need a break or a sleep This feature can be set for one driver or two alternate drivers Menu DaN 1 If you are on the Map screen tap to return to the Navigation menu 2 Inthe Navigation menu tap and then Driving Time Management 3 Tap f Ask for Waiting Time f Configure Driving Timers Configure Driving Timers 4 Tap and set the driving timer defaults for the driver 70 RDN 573BT NAVIGATION MANUAL CALIBER 5 optional Tap the switch to use the vehicle with two drivers The timer defaults are the same but the timers will count down for each driver individually 2 Drivers Max Continuous Driving Time Minimum Break Time Maximum Break Time f Back 6 When finished tap and hold to return to the Map screen Whenever the vehicle stops the current driver receives a message a few minutes later whether this stop means a break Rue des Jar
14. Settings stenene Enter the average consumption of your vehicle when used on highways The unit for consumption can be set in Regional Settings Engine Type Select the engine and fuel type of your vehicle This helps in estimating the CO emission Fuel Price Enter the average fuel price for travel cost calculation The currency can be set in Regional Settings Set the maximum speed you travel with the vehicle heck thi t tti for th ters Use Extended Settings Chec is box to enable more settings for the below parameters Length Set the total length of the vehicle Width Set the width of the vehicle Height Set the height of the vehicle i Set if there is a trailer attached to the vehicle Trailer Meru eee Set the maximum allowed weight of the vehicle Actual Weight Set the actual weight of the vehicle Freiaht Select one or more hazard types if the vehicle carries dangerous di material 87 BER 2 CAC RDN 573BT NAVIGATION MANUAL FF T I Vehicle types When creating a new vehicle profile select one of the below vehicle types Besides the below mentioned conditions dimension weight and freight hazard restrictions can also be taken into account when planning a route Car e Manoeuvre restrictions and directional constraints are taken into account when planning a route e Roads are used only if access for cars is allowed e Private roads and resident only roads are used only they are inevitable to rea
15. a city town e an intersection e the midpoint of a street e any of the above starting the search with the postal code page 32 25 CALIBER RDN 573BT NAVIGATION MANUAL M A m Vl 3 1 1 1 Entering an address To enter an address as the destination do as follows Menu 1 If you are on the Map screen tap to return to the Navigation menu 3 bad bind A In the Navigation menu tap the following buttons iy find Address By default Caliber proposes the country and city town where you are If needed tap Country enter the first few letters of the country name on the keyboard and select one country from the list of results France Paris lt Street Name gt Select Town 4 Select a new city town a Tap b Start entering the name of the city town on the keyboard c Find the city town you need e The most likely city town name is always shown in the input field To accept it just tap the field you entered the first letters in e If the desired name does not show up the names that match the string appear in a list after entering a couple of characters to open the list of RETIE results before it appears automatically tap the city town from the list Select ris France ntin Seine Saint Denis France u Pyr n es Atiantiques France nazol Haute Vienne France 4 Back 5 Enter the street name a Tap b Start entering the street name
16. a panel with the details of the next few exits or service stations Tap any of them to display it on the map and add it as a waypoint to your route if needed eelam Select the service types displayed for the motorway exists Choose from the POI categories Signposts Whenever adequate information is available lane information similar to the real ones on road signs above the road is displayed at the top of the map You can turn this feature on or off j SET CLAGE you are approaching a motorway exit or a complex intersection and l the needed information exists the map is replaced with a 3D view of the junction You can turn this feature on or let the map be displayed for the whole route Tunnel View When entering tunnels the surface roads and buildings can be disturbing This feature shows a generic picture of a tunnel instead of the map A top down overview of the tunnel and remaining distance are also displayed 91 CALIBER RDN 573BT NAVIGATION MANUAL HSNON gt D Turn on the route progress bar to see your route as a straight line on the left side of the map The blue arrow represents your current position and moves up as you travel Waypoints and Traffic events are also displayed on the line ad Offer Congestion a When you slow down while driving on a motorway there is a chance e Detour on Highways that you are in a traffic jam so Caliber offers you a detour using the next exit The message shows you distance
17. all saved data and reset all settings to their factory defaults 6 3 1 Sound and Warnings Adjust the sound volume mute your device or change the voice guidance language In addition you can enable and set up different warnings and alerts Tap this button to adjust the volume of the different sounds in the application A new screen shows the different sound types and their controls See below for details Voice Language This button shows the current voice guidance profile By tapping the button you can select a new profile from the list of available languages and speakers Tap any of these to hear a sample voice prompt Just tap when you have selected the new spoken language Tap this button to adjust the enhanced TTS features The following settings are available You can set the feature to read out traffic messages Whenever a route is calculated the software can read out the quick summary of the route When you cross country borders the application can read out the information about the country you have just entered All system messages can also be announced Tap this button to set the verbosity of the voice instructions how much Verbosity Level they tell and how often they speak 82 RDN 573BT NAVIGATION MANUAL CALIBER TELEn Maps may contain information about the speed limits of the road segments Caliber is able to warn you if you exceed the current limit This information may not be available fo
18. fa e tap if you have modified an existing vehicle profile or Done e tap if you have created a new profile p L Emergency GF Bus r Taxi r Lorry While this profile is selected the parameters of your vehicle are taken into account when planning routes Note that this leads to a safe route for your lorry only if map data contains the weight height etc restrictions of the road network in your area p Speed limits for lorries may not be available for all roads It is advised to enter the Tip maximum allowed speed in your area for your vehicle instead of the maximum speed your lorry is capable of When you often use your vehicle with typical configurations of parameters for Tip example with or without a trailer that also affects the length the height the number IP of axles and the weight it is better to create different vehicle profiles for the typical setups and change between the profiles instead of always modifying parameters 5 2 Setting up waiting time at waypoints In order to receive a better arrival time estimation and to be able to use time restrictions and statistical traffic information for future legs of the route you can enable this feature and specify a waiting time for each stop on your route If you enable the feature as described below the application will ask you to enter the time you will spend at a stopover every time you enter a new destination Menu ee 1 If you are on the
19. on the keyboard c Find the street you need e The most likely street name is always shown in the input field To accept it just tap the field you entered the first letters in 26 CALIBER AUDIO TECHNOLOGY RDN 573BT NAVIGATION MANUAL e If the desired name does not show up the names that match the string appear in a list after entering a couple of characters to open the list of s Results results before it appears automatically tap the street from the list Select f Avenue stant Coquelin 75007 Paris 7 me Arrondissement Paris stant Coquelin Avenue Avenue du Nouveau servatoire 75019 Paris 19 me Arrondissement Paris Carrefour de la servation 75012 Paris 12 me Arrondissement Paris f Cit dorcet 75009 Paris 9 me Arrondissement Paris 4 Back 6 Enter the house number a Tap b Enter the house number on the keyboard To enter letters tap ove c Tap to finish entering the address If the entered house number cannot be found the midpoint of the street is selected as the destination 7 A full screen map appears with the selected point in the middle If necessary tap the Vv map somewhere else to modify the destination The Cursor appears at the new Ce Next location Tap a Back to confirm the destination or tap to select a different destination 8 After a short summary of the route parameters the map appears showing the ent
20. or tap a prute Troyes 10000 Aube France pa A3 i T Mi ux gt and start your journey Route Planning Method Road Types Used Motorways Ferries Period Charge Unpaved Roads Per use Toll 4 Cancel 33 CALIBER RDN 573BT NAVIGATION MANUAL M A m Vl 3 1 1 6 Tips on entering addresses quickly e When you are entering the name of a city town or a street e Only those letters are offered on the keyboard that appear in possible search results All other characters are greyed out e As you are typing the most likely result is always displayed in the input field If the guess is correct just tap to select it s Results e After entering a couple of letters tap to list the items that contain the specified letters e You can speed up finding an intersection e Search first for the street with a less common or less usual name fewer letters are enough to find it e lf one of the streets is shorter search for that one first You can then find the second one faster e You can search for both the type and the name of a road If the same word appears in several names for example in the name of streets roads and avenues you can obtain the result faster if you enter the first letter of the street type For example enter PI A to obtain Pine Avenue and skip all Pine Streets and Pickwick Roads e You can also search in postal codes As postal codes consist of only a few characters this is usu
21. or tap and enter a few letters from the 4 A full screen map appears with the selected point in the middle If necessary tap the v map somewhere else to modify the destination The Cursor appears at the new Next location Tap to confirm the destination or tap to select a different destination 5 After a short summary of the route parameters the map appears showing the entire More route The route is automatically calculated Tap a gt Go to modify route parameters or tap and start your journey g siais Troyes 10000 Aube France as meat Route Planning Method pris Road Types Used Motorways Ferries Period Charge Unpaved Roads Per use Toll ra ES Cancel 3 1 5 Selecting one of the most likely destinations Smart History The destinations that you have set earlier appear in the History list Two of those recent destinations are shown in the Destination menu for easy access Smart History offers these locations based on your navigation habits using parameters like the current time of day the day of week and the current location The more you use the navigation software the better it can guess your desired destination Menu DOES 1 If you are on the Map screen tap to return to the Navigation menu 46 RDN 573BT NAVIGATION MANUAL CALIBER 2 Inthe Navigation menu tap ax ra ax y r ad Lad fl o gt hr Find Address Find Places Find on Map Favourites
22. or tap twice to turn on Caps Lock Tap again and lower case letters return Tap 123 to switch to a keyboard offering numeric and symbol characters Tap 10 RDN 573BT NAVIGATION MANUAL CALIBER Finalising the keyboard entry saving your input Cancelling the keyboard entry returning to the previous screen 2 2 2 Beyond single screen tap You usually need to tap the screen only once However some useful features can be accessed with combined touch screen tapping Those are the following Tapping and re holding the Tap and keep pressing the following buttons to reach extra functions Tap and hold on list and menu screens the Map screen appears Tap and hold any of the Ed t 4 and buttons on the Map screen you can rotate tilt or scale the map continuously Tap and hold on keyboard screens you can delete several characters quickly Tap and hold Al or v in long lists you can scroll pages continuously Gestures You need to drag and drop the screen only in cases like drag amp drop e Moving the handle on a slider e Scrolling the list grab the list anywhere and slide your finger up or down Depending on the speed of the sliding the list will scroll fast or slow only a bit or till the end e Moving the map in map browsing mode grab the map and move it in the desired direction 11 CALIBER RDN 573BT NAVIGATION MANUAL M A m Vl 2 3 Map screen 2 3 1 Navigati
23. the Settings menu page 81 After the initial setup the Navigation menu appears and you can start using Caliber 2 1 Navigation menu You can reach all parts of Caliber from the Navigation menu You have the following options D Find e Tap to select your destination by entering an address or selecting a place of interest a location on the map or one of your Favourite destinations You can also look up your recent destinations from the Smart History or enter a coordinate gt My Route e Tap to display the route parameters and the route in its full length on the map You can also perform route related actions such as editing or cancelling your route setting a start point for the route picking route alternatives avoiding parts of the route simulating navigation or adding the destination to your Favourites More e Tap to customise the way the navigation software works to simulate demo routes or to run some additional applications Show Map e Tap to start navigating on the map The button itself is a miniature live map that shows your current position the recommended route and the surrounding map area Tap the button to enlarge the map to the full screen i e Tap to open the Traffic Summary screen e Tap to stop navigation and exit the software RDN 573BT NAVIGATION MANUAL CALIBER 2 2 Buttons and other controls on the screen When you are using Caliber you usually tap buttons on the touch scre
24. type preferences do as follows These changes can also be made in Settings page 85 1 On the Map screen tap Ej and then tap Vehicle Navigation Mode r Route Planning Method d TT Motorways 4 Back 2 Tap any of the listed road types to modify the route If needed scroll the list for all road types You have the following options their order depends on the selected vehicle type Al T Motorways You might need to avoid motorways when you are driving slow car or you are towing another vehicle jab Period Charge Charge roads are pay roads where you can purchase a pass or vignette to use the road for a longer period of time They can be enabled or disabled separately from toll roads m Per use Toll Caliber includes toll roads pay roads where there is a per use charge in the routes by default If you disable toll roads Caliber plans the best toll free route fam Xx Ferries Caliber includes ferries in a planned route by default However a map does not necessarily contain information about the accessibility of temporary ferries You might also need to pay a fare on ferries wy Unpaved Roads Caliber excludes unpaved roads by default unpaved roads can be in a bad condition and usually you cannot reach the speed limit on them 3 The route has already been recalculated Tap to return to the Map screen The orange line now shows the new recommended route
25. 59 CALIBER RDN 573BT NAVIGATION MANUAL 3 5 Saving a location as a Favourite destination You can add any location to Favourites the list of frequently used destinations Planning a route to one of the Favourite destinations is described on page 45 1 Select a destination as described before It can be an address a Place any location on the map a previously used destination from History etc 2 When the full screen map appears with the selected location in the middle tap X P Places Around Cursor r Add to Favourites DA f Show Cursor Position f W ose 3 Tap 4 optional Using the keyboard you can change the name offered for the Favourite Tap to enter numbers or symbols Gh RD a ER BR ER G ah SR Q WwW CE R IT FY PU I 10 P RD ER NER SD Ga AS D F G H J K L RD ED Eh ER 6 V IB iN IM 1123 f Done Ea 5 Tap to save the location as a new Favourite destination 60 M A m Vl RDN 573BT NAVIGATION MANUAL CALIBER 3 5 1 Editing the details of a Favourite destination You can select a location that you have already saved as a Favourite and edit its details Adding a location to the list of Favourite destinations is described on page 60 1 Access the list of Favourites e f you are on the Map screen tap and then tap Find e If you are in the Navigation menu tap P Find and then tap Favourites 2 The list of Favourite destinations is dis
26. AVIGATION MANUAL CALIBER 2 3 3 4 Junction view If you are approaching a motorway exit or a complex intersection and the needed information exists the map is replaced with a 3D view of the junction The lanes you need to take are displayed with arrows Signposts can also be present if information is available If you want to hide the currently displayed junction tap the picture and the Map screen returns Cr teil Centre ES 455km 2 3 3 5 Motorway exit services You may need a petrol station or a restaurant during your journey This feature displays a new button on the map when you are driving on motorways A4 A5 Metz Nancy NG Ji 2 3 keen Tap any of them to display the exit area on the map You can now easily add this exit as a waypoint to your route if needed If you want to display other types of Places for the exits you can change the icons in Visual Guidance settings page 91 17 CALIBER RDN 573BT NAVIGATION MANUAL M A m Vl 2 3 3 6 3D object types Caliber supports the following 3D object types 3D terrain 3D terrain map data shows changes in terrain elevations or depressions in the land when you view the map in 2D and use it to plot the route map in 3D when you navigate Hills and mountains are shown in the background of the 3D map and illustrated by colour and shading on the 2D map Elevated roads Complex intersections and vertically isolated roads such as o
27. DN 573BT NAVIGATION MANUAL HSNON gt D When a feature can be e Drag the handle to set to different values in move the slider to a range Caliber shows its new position an indicator on a gauge that displays and sets Tap the slider where the value you want the handle to appear the thumb jumps there Alphabetic and Each key is a touch screen alphanumeric keyboards button to enter text and numbers You only need to enter letters or numbers when you cannot avoid it You can type with your fingertips on the full screen keyboards and you can switch between various keyboard layouts for example English Greek or numerical Task Instruction Switching to another keyboard layout for example from an English keyboard to a Greek keyboard Correcting your entry on the keyboard Entering a space for example between a first name and a family name or in multi word street names Tap the button and select the new keyboard layout from the list Tap to remove the unneeded character s Tap and hold the button to delete several characters or the entire input string Tap the button at the bottom centre of the screen Entering upper and lower case letters Entering numbers and symbols Finalising the keyboard entry opening the list of search results When entering a text the first character appears in upper case while the rest of the text is in lower case Tap to enter an upper case letter
28. Distance 15 km Time Left 0 29 RDN 573BT wve uetooth 4X 75W RDN 573BT RDN 573BT 4 x NAVIGATION MANUAL FREE map updat ENGLISH Nl WILT ONE year INTET Ep GWas NAVIGATION MAP UPDATE P f After the first connection with the GPS satellite you have nN av extra S CO m one year to update the maps for free Note you need a cardreader for SD and a Naviextras user profile to update your device You can create a profile on the website simply go to www naviextras com and click HOW DOES IT WORK Go to www naviextras com Click Downloads and download the program Naviextras Toolbox After installing it on your computer just follow the instructions in the program Create a user profile CALIBER AUDIO TECHNOLOGY RDN 573BT NAVIGATION MANUAL User Manual Navigation software for the Caliber RDN573BT UK English CALIBER RDN 573BT NAVIGATION MANUAL M A m Vl Thank you for choosing the Caliber RDN573BT as your navigator Start using Caliber RDN573BT right away This document is the detailed description of the navigation software You can easily discover Caliber while you are using it however we still recommend that you read this manual to fully understand the screens and features RDN 573BT NAVIGATION MANUAL CALIBER Table of contents 1 Warnings and Safety information cccccccccccccccccccscccccccccccccccccccccecccececscecececeeeO
29. age brightness of the screen low Caliber offers different daytime and night colour profiles It can also switch automatically between the daytime and the night schemes based on the current time and GPS position a few minutes before sunrise when the sky has already turned bright and a few minutes after sunset before it becomes dark 6 1 3 Tunnel view When entering a tunnel the map is replaced with a generic tunnel image so that surface roads and buildings cannot distract you Voie Georges Pompidou The top down overview of the tunnel helps you orientate yourself The remaining distance in the tunnel is also displayed 72 RDN 573BT NAVIGATION MANUAL CALIBER After leaving the tunnel the original map view returns This feature can be turned off in Settings page 91 6 1 4 Route calculation and recalculation Caliber calculates the route based on your preferences Route planning methods Fast Gives a quick route if you can travel at or near the speed limit on all roads Usually the best selection for fast and normal cars Short Gives a route that has the smallest total distance of all possible routes It can be practical for slow vehicles Green Gives a quick but fuel efficient route based on the fuel consumption data given in Route settings page 85 Travel cost and CO emission calculations are estimations only They cannot take elevations curves and traffic conditions into account E
30. al traffic data and traffic J patterns This locally stored information can be very useful in normal circumstances but for example on public holidays it may be better to turn off in order not to take into account normal weekday traffic jams A HEUREA Use this switch to enable or disable the TMC receiver that can receive real time traffic information The rest of the buttons below are all related to the TMC function and are available only if the receiver is enabled Detour This setting determines how Caliber uses the received real time traffic information in route calculation When calculating a new route or when recalculation becomes necessary based on the received Traffic events Caliber avoids traffic events if it makes sense You can also set the minimum delay that triggers route recalculation and you can instruct the application if you want to confirm every recalculation AM Event Types Tap this button to open the list of traffic event types and select which events to take into account in route calculation 6 3 5 Route settings These settings determine how routes will be calculated Button Description You can set the type of vehicle you will use to navigate the route Based upon this setting some of the road types can be excluded from the route or some of the restrictions may not be taken into account in route calculation You can edit the parameters of the selected vehicle profile or you can even create new
31. ally faster than entering the name of the city town 3 1 2 Selecting the destination from the Places of Interest You can select your destination from the Places of Interest included with Caliber Using the same screen you can find a Place in different ways e with the Quick search feature you can quickly find a nearby Place by its name e with the Preset search feature you can find frequently searched types of Places with only a few screen taps e you can search for a Place by its category e you can search for a Place by its name In addition you can search for special services from the Where Am screen 34 RDN 573BT NAVIGATION MANUAL CALIBER 3 1 2 1 Quick search for a Place of Interest The Quick search feature lets you quickly find a Place by its name The search is always carried out along the recommended route if it exists or around your current location if there is no destination given 1 2 Start the Quick search function O e If you are on the Map screen tap and then tap e If you are in the Navigation menu tap Meee and then jw Quick Search tap Along route l Using the keyboard start entering the name of the Place f RR ah Gh FR R R Gh a a Q WwW CE R T ae eo I 10 P RAR DD R R ER Ais 1D F G H J K L RR R R BW sb V B N M 123 f 35 Results 96 s Results 3 After entering a few letters tap to open the list of Places with names containing the entered c
32. always faces North This is the orientation for example in Find on Map Road Safety Camera Special alert points for speed red light or bus lane cameras Different data sources are available You can configure Caliber to warn you when you approach one of these cameras Detecting the location of Road Safety Cameras is prohibited in certain countries It is the sole responsibility of the driver to check whether this feature can be used during the trip The software is capable of showing and warning for more than just cameras Various other types of proximity alert points like school zones and railway crossings are also available Route A sequence of route events i e manoeuvres for example turns and roundabouts to reach the destination The route contains one start point and one or more destinations The start point is the current or last known position by default If you need to see a future route the start point can be replaced with any other given point Track up map orientation In Track up mode the map is rotated so its top always points in the current driving direction This is the default orientation in 3D map view mode Vehimarker The current position is shown with a blue arrow on the map by default The direction of the blue arrow shows the current heading This position marker can be replaced with different 3D vehicle symbols You can even specify different Vehimarkers for different route types depending on which vehi
33. ap to return to the Navigation menu My Route 2 Inthe Navigation menu tap 3 The following pieces of information are displayed e The name and or address of the destination e Warning icons if any They provide extra information about your route e g unpaved roads or toll roads to be taken e The total time of the route e The total length of the route e Estimated delay calculated from traffic events on your route e The symbol of the vehicle type used in route calculation e The route planning method e g Fast Troyes 10000 Aube France V Alternative n Green 51 CALIBER RDN 573BT NAVIGATION MANUAL M A m Vl 4 You have the following options on this screen for detailed instructions on how to use them see the next chapter e Tap ii to edit the route to add or remove destinations or change their sequence You can also set a route start point other than your current location This can be useful to plan and save a future trip to display the entire route on the map to bypass a part of the route i s Cancel Route e Tap to delete the active route More e Tap EIEND to open a list with more options like selecting from route alternatives changing route parameters simulating the route saving the active route or loading a previously saved route e Tap to return to the Navigation menu 3 4 Modifying the route When Caliber is already started the
34. arge in the routes by default If you disable toll roads Caliber plans the best toll free route Caliber includes ferries in a planned route by default However a map does not necessarily contain information about the accessibility of temporary ferries You might also need to pay a fare on ferries T PER Caliber excludes unpaved roads by default unpaved roads can be in a A ak bad condition and usually you cannot reach the speed limit on them 2 ee KES 1f the selected routing method is not Green you can have your route NE compared to the best green alternative on the screen when confirming the route If this alternative is much better than the selected method you can quickly switch to Green mode Vehicle profiles Vehicle When you first tap veide e you see the list of default vehicle profiles You have the following options Button Description You can edit the parameters of the vehicle profile 86 M A m Vl RDN 573BT NAVIGATION MANUAL CALIBER When creating a new vehicle profile first you need to select the vehicle type Then you need to set the following parameters some of them may not exist for the selected vehicle type You can modify the same parameters when you edit an existing profile Tap this button to rename the profile for something meaningful tr este Enter the average consumption of your vehicle when used in built up areas The unit for consumption can be set in Regional
35. arrefour de la servation 75012 Paris 12 me Arrondissement Paris Cit dorcet 75009 Paris 9 me Arrondissement Paris 4 Back O Select Street 5 Instead of entering the house number tap The midpoint of the street is selected as the destination p Country France Town Paris Street Place de la Concorde f lt Intersecting Street gt h lt House Number gt se Back Select Street 6 A full screen map appears with the selected point in the middle If necessary tap the y map somewhere else to modify the destination The Cursor appears at the new a gt Next location Tap to confirm the destination or tap Back to select a different destination 28 RDN 573BT NAVIGATION MANUAL CALIBER 7 After a short summary of the route parameters the map appears showing the entire More route The route is automatically calculated Tap gt Go to modify route parameters or tap and start your journey ante Troyes 10000 Aube France Lea Meaux i Sans Bu Route Planning Method NG aaa fl Road Types Used Motorways Ferries Period Charge Unpaved Roads Per use Toll f 4 Cancel 3 1 1 3 Selecting an intersection as the destination To enter an address as the destination do as follows Menu DSN 1 If you are on the Map screen tap to return to the Navigation menu PES A In the Navigation menu tap the following buttons find Address If necessary
36. aved Roads Per use Toll i 4 Cancel 31 CALIBER RDN 573BT NAVIGATION MANUAL M A m Vl 3 1 1 5 Entering an address with a postal code All of the above address searching possibilities can be performed with entering the postal code instead of the city town name Find below an example with a full address Menu np 1 If you are on the Map screen tap to return to the Navigation menu i bii A In the Navigation menu tap the following buttons Fe aos If necessary modify the country as described earlier page 26 Enter a new city town using its postal code a Tap b If necessary tap 123 to open the numeric keypad c Start entering the postal code d Find the city town you need e The most likely postal code is always shown in the input field To accept it just tap the field you entered the first numbers in e lf the desired number does not show up open the list of results by Results tapping Select the postal code from the list Le Monast re Boutonnet Onet le Ch teau Rodez 100 La Roque Sainte Marguerite Alteyrac Millau Cureplats G 110 habia Combes Achin Le Crouzet Cransac Dacazedile La Croix du Sout Firmi Escabrins 120 Arvieu Cassagnes B gonh s Centr s Meljac 4 Back 5 Enter the street name a Tap b Start entering the street name on the keyboard c Find the street you need e The most likely street
37. ccommodation nam a Camping pr 3 Hotel or Motel List All Places in Accommodation Hotel or Motel E all seasons r Best Western fan rf Best Western Premier Back 10 After entering a few letters tap to open the list of Places with names containing the entered character sequence D Fonkhien Place de H tel de Ville 75004 4 me Arrondissement Paris Ty Bel Canto 72 Quai H tel de 75004 Paris amp H tel de Ville 4 Place de l H tel de Ville 75004 Paris L armor 75004 4 me Arrondissement Paris f 4 Back o More 42 RDN 573BT NAVIGATION MANUAL CALIBER 11 optional The Places in the list are ordered by their distance from the current or last known position from the selected city town from the destination or by the length of the necessary detour If you need to reorder the list tap 12 optional Tap to see the details of the selected Place Tap to return to the map 13 If necessary tap the map somewhere else to modify the destination The Cursor appears at the new location Tap to confirm the Back destination or tap to select a different destination 14 After a short summary of the route parameters the map appears showing the entire More route The route is automatically calculated Tap EIEND to modify route gt Go parameters or tap and start your journey a prute Troyes 10000 Aube France Sep ES sMeaux Route Planning Meth
38. ch the destination e Walkways are excluded from routes e All manoeuvres are available in intersections e Directional constraints are taken into account the way that opposite direction is allowed with a low speed e A private road is used only if the destination is there e Walkways are excluded from routes A Bus e i e Manoeuvre restrictions and directional constraints are taken into account when planning a route e Roads are used only if access for buses is allowed e Private roads resident only roads and walkways are excluded from routes ee Taxi e Manoeuvre restrictions and directional constraints are taken into account when planning a route e Roads are used only if access for taxis is allowed e Private roads resident only roads and walkways are excluded from routes e Manoeuvre restrictions and directional constraints are taken into account when planning a route e Roads are used only if access for lorries is allowed e Private roads resident only roads and walkways are excluded from routes e U turns are excluded from routes turning back on a divided road is not considered as a U turn 88 RDN 573BT NAVIGATION MANUAL CALIBER Route Planning Method types Button Description Fast Gives a quick route if you can travel at or near the speed limit on all 23 roads Usually the best selection for fast and normal cars Gives a short route to minimise the distance to travel It can be pract
39. cle type is selected for route calculation 96 RDN 573BT NAVIGATION MANUAL CALIBER 8 Copyright note The product and the information contained herein are subject to change without prior notification This manual may not in whole or in part be reproduced or transmitted in any form either electronically or mechanically including photocopying and recording without the express written consent of Caliber 2014 Caliber 2006 2014 TomTom All rights reserved This material is proprietary and the subject of copyright protection database right protection and other intellectual property rights owned by TomTom or its suppliers The use of this material is subject to the terms of a license agreement Any unauthorized copying or disclosure of this material will lead to criminal and civil liabilities All rights reserved 97 CALIBER AUDIO TECHNOLOGY RDN 573BT NAVIGATION MANUAL M q m v IT WWwW CALIBER NL CALIBER HEAD OFFICE The Netherlands Fax 31 0 416 69 90 OI E mail info calibernl
40. conomical For vehicle types where Green routing is not available this method combines the benefits of Fast and Short Caliber calculates as if it were calculating the Fast route but it takes other roads as well to save fuel Easy Results in a route with fewer turns and no difficult manoeuvres With this option you can make Caliber to take for example the motorway instead of a series of smaller roads or streets Vehicle types When creating a new vehicle profile select one of the below vehicle types Besides the below mentioned conditions dimension weight and freight hazard restrictions can also be taken into account when planning a route Car e Manoeuvre restrictions and directional constraints are taken into account when planning a route e Roads are used only if access for cars is allowed e Private roads and resident only roads are used only if they are inevitable to reach the destination e Walkways are excluded from routes L Emergency e All manoeuvres are available in intersections e Directional constraints are taken into account the way that opposite direction is allowed with a low speed e A private road is used only if the destination is there 73 CALIBER AUDIO TECHNOLOGY A Bus sW RDN 573BT NAVIGATION MANUAL M A m Vl Walkways are excluded from routes Manoeuvre restrictions and directional constraints are taken into account when planning a route
41. d closures or a traffic jam caused by an accident Both functions are subject to data availability You can display the historical traffic information on the map if you browse the map and select this option from the More menu A 2D map is displayed with road segments coloured by the density of the traffic in the given period The current information is shown when you open the screen Modify the day of week and the time of day to see the desired period You can display the live traffic information on the map if you browse the map and select this option from the More menu A 2D map is displayed with road segments coloured b the severity of traffic events Tap the event type icon at the road segment and then tap the button to get information about the traffic event eg gt c HO 19 me Arrondi ADA rey eS z AN SA gg p gt bp TT CALIBER RDN 573BT NAVIGATION MANUAL M A m v IT 6 1 9 1 Historical traffic If statistical traffic information is stored with the map data Caliber can take them into account when planning a route In normal cases these statistics help you avoid usual traffic jams on the given day of week in the given hour but in some cases like on public holidays that fall on normal weekdays they can be misleading You can disable this feature in Traffic settings page 85 You can display statistical traffic information on the map if you browse the map and select
42. d limit e Only when speeding The audio alert is only played when you exceed the given speed limit e When approaching The audio alert is always played when approaching one of these alert points In order to draw your attention the alert can is different when you exceed the speed limit The warning for road safety cameras is disabled when you are in a country where EY Note road safety camera warning is prohibited However you must ensure on your own liability that using this feature is legal in the country where you intend to use it 6 1 7 Speed limit warning Maps may contain information about the speed limits of the road segments Caliber is able to warn you if you exceed the current limit This information may not be available for your region ask your local dealer or may not be fully correct for all roads in the map The maximum speed set in the vehicle profile is also used for this warning Caliber alerts you if you exceed the preset value even if the legal speed limit is higher Speed warning can be fine tuned in Sound and Warnings settings page 82 You can set the relative speed above which the application initiates the warning The following alert types are available e Audio warning you receive a verbal warning when you exceed the speed limit with the given percentage e Visual warning the current speed limit is shown on the map when you exceed it for You can also choose to see the speed limit sign on the
43. diniers i You have been waiting for 15 minutes Is this a break When a break is initiated the continuous driving timer stops and it is reset to its default value the daily driving timer also stops and the break timer starts counting down the break starts from the moment when the vehicle stopped When the vehicle is in motion again the break timer is reset and both driving timers start counting down again 71 CALIBER RDN 573BT NAVIGATION MANUAL M A m Vl 6 Reference Guide On the following pages you will find the description of the different concepts and menu screens of Caliber 6 1 Concepts 6 1 1 Smart Zoom Smart Zoom provides much more than just a usual automatic zoom feature e While following a route when approaching a turn it will zoom in and raise the view angle to let you easily recognise your manoeuvre at the next junction If the next turn is at a distance it will Zoom out and lower the view angle to be flat so you can see the road in front of you e While driving without an active route Smart Zoom will zoom in if you drive slowly and zoom out when you drive at high speed 6 1 2 Daytime and night colour themes Caliber uses different colour themes during the day and during the night for both the map and the menu screens e Daytime colours are similar to paper road maps and the menus are bright e The night colour themes use dark colours for large objects to keep the aver
44. e destinations You can also select some of the objects on the map If you tap the map at the icon of a Place of Interest or an alert point the object will be selected you see a red circling border around the object and you can get information about this object or use it as a route point 2 3 3 Objects on the map 2 3 3 1 Streets and roads Caliber shows the streets in a way that is similar to how the paper road maps show them Their width and colours correspond to their importance you can easily tell a motorway from a small street 14 RDN 573BT NAVIGATION MANUAL CALIBER 2 3 3 2 Turn preview and Next street When navigating a route the top section of the Map screen shows information about the next route event manoeuvre and the next street or the next city town Voie Georges Pompidou There is a field in the top left corner that displays the next manoeuvre Both the type of the event turn roundabout exiting motorway etc and its distance from the current position are displayed A smaller icon shows the type of the second next manoeuvre if it is near the first one Otherwise only the next manoeuvre is displayed s A F Quai d Anjou 4 Rare Rue Poulle Most of these icons are very intuitive The following table lists some of the frequently shown route events The same symbols are used in both fields Turn left Turn right Turn back Bear right Turn sharp left Ly Kee
45. e vehicle types you can also check the fuel consumption and CO emission when planning a route and you can create cost effective routes with less effect on the environment In Route settings you can edit the parameters of the selected vehicle Enter the fuel consumption values and the price of the fuel You can also select whether you want to see the difference between your route and the green route even if the selected routing method is not Green Green After the above parameters are set select Green as route planning method to get a fast but also fuel efficient route Note that travel cost and CO emission calculations are estimations only They cannot take elevations turns curves and traffic conditions into account Also this routing is not meant to give you the greenest route of all It is still important to travel quickly so the result is a fast route with low fuel consumption and CO emission With a vehicle type where green routing is selectable whichever route planning method is selected the Green details are also shown when you confirm the route a fre Troyes 10000 Aube France La Seine ma F A jae A If the selected route planning method is not Green and you have allowed the application to show the green alternative the price fuel consumption and CO emission differences between your selected route and the Green route are also shown on this screen 1 46 10000 Aube France om 175 k
46. e application Time Zone By default time zone is taken from the map information and adjusted by your current location Here you can set time zone and daylight saving manually 6 3 11 Trip monitor settings Trip logs contain useful information about your trips Trip logs can be saved manually when you reach your destination or you can turn on the automatic saving here You can access these logs in the Trip monitor Trip monitor is available from the More menu osae Trip monitor can record statistical data of your trips If you need these logs later you can let the application save them automatically for you UDE ear This is not a button This line shows the current size of the trip database the sum of all trip and track logs saved Ste Wom ed moyen Track logs the sequence of the positions given by the GPS receiver can be saved together with trip logs They can later be displayed on the map You can let the application save the track log whenever it saves a trip 93 CALIBER RDN 573BT NAVIGATION MANUAL M A m Vl 6 3 12 Log collection settings If you accept this when first using the application it collects usage information and GPS logs that may be used for improving the application and the quality and coverage of maps The data is processed anonymously no one will be able to track any personal information Here you can enable or disable collecting these logs ae EE Anonymous statistica
47. eal difference between the on road and off road modes is the navigation itself When you are on the Map screen with an off road route e your position and heading is not aligned with the nearest road and e there is no turn by turn navigation just a recommended direction You see a orange line drawn between your current position and the next destination to reach The Turn Preview field in the top left corner shows a compass with your bearing and the distance of the next destination When you reach a waypoint the orange line will show the direction to the next destination When you reach the final destination navigation ends 66 RDN 573BT NAVIGATION MANUAL CALIBER 5 Lorry navigation The navigation software gives more options for lorry drivers e You can enter the parameters of your vehicle and Caliber calculates your routes with taking available weight height etc restrictions into account this feature is accurate only if restrictions are available for all roads between your position and the destination e Based on the dimensions and other entered parameters of your vehicle Caliber warns you when you are approaching a restricted road segment or such roads must be used in your route e You can set a waiting loading time for each destination of the route This way the arrival time calculation can take into account the idle times at intermediate destinations In addition time dependent restrictions and statistical traffic inf
48. ected they are searched around the current position e lf the current position is not available either no GPS signal they are searched around the last known position Accommodation At My Destination e If an active route exists accommodation is searched around the destination of the route e lf there is no active route destination is not selected they are searched around the current position e lf the current position is not available either no GPS signal they are searched around the last known position 4 Tap any of the quick search buttons to get an instant list of Places 6 Andrea Rivoli 3 Rue Saint Bon 75004 Les Halles f EN Sansonnet O 48 Rue de la Verrerie 75004 Le Marais 200m A TT Ap 11 Rue du Temple 75004 Paris 200 m Duo a 11 Rue du Temple 75004 Le Marais 200m 4 Back More Q Filter 5 optional The Places in the list are ordered by their distance from the current or last known position from the destination or by the length of the necessary detour If you 6 Browse the list if necessary and tap one of the list items A full screen map appears with the selected point in the middle The name and address of the Place is displayed at the top of the screen 7 optional Tap to see the details of the selected Place Tap to return to the map need to reorder the list tap 8 If necessary tap the map somewhere else to modify the destination The Cursor V a
49. elect the alert point to edit The red circle appears around the alert point More Places Around Cursor r Add to Favourites DI oe Show Cursor Position f W ose 3 Scroll down the list and tap 4 On the newly opened screen modify the type of the alert point the direction from which you expect the alert or if applicable the speed limit for this alert point g 8 Type of Alert Speed Camera r Direction of Alert Speed Limit 90 km h f se Back f Save 5 Tap to save the changes to the alert point 63 CALIBER RDN 573BT NAVIGATION MANUAL M A m Vl 3 8 Watching the simulation of the route You can run a simulated navigation that demonstrates the active route Do as follows Menu 7 1 If you are on the Map screen tap to return to the Navigation menu My Route 2 Inthe Navigation menu tap Edit Route overview a gt h Avoidances w Cancel Route Route Alternatives F Itinerary VA sener Route Settings f W ose gt Simulate navigation yY 9 4 Scroll down the list and tap The simulation starts from the starting point of the route and using a realistic speed it leads you through the whole recommended route a optional You have the following controls during the simulation the control buttons disappear after a few seconds but you can open them again if you tap the map p Jump
50. en You only need to confirm selections or changes if the application needs to restart it needs to perform a major reconfiguration or you are about to lose some of your data or settings Otherwise Caliber saves your selections and applies the new settings without confirmation as soon as you use the controls Button Tap it to initiate a Tap it once function to open a new screen or to seta parameter Button Some buttons display the Tap it once with Normal current value of a field or value setting Tap the button to change the value After the change the new value is shown on the button Distance Shows status ls de cis oe 16 9 km information a utton I ap them gt When you need to select Grab the list anywhere and gt a from several options slide your finger up or gt engnsn ux they appear in a list down Depending on the 2 speed of the sliding the list r will scroll fast or slow only at a bit or till the end Alternatively move between pages with the and buttons and tap the value that you want When there are only a Tap one of the buttons to few choices radio select a new value buttons may be used instead of lists Only one value can be selected When there are only two Tap it to turn the switch on choices a checkmark or off shows whether the feature is enabled CALIBER AUDIO TECHNOLOGY Virtual keyboard 2 2 1 Using keyboards R
51. ent position or if it is not available around the last know position The result list will be ordered by the distance from this position 38 RDN 573BT NAVIGATION MANUAL CALIBER France Paris 6 Select one of the main Place categories e g Accommodation or tap List All Places to list all Places around the selected location or along the route List All Places B Accommodation fa A Airport c Automotive f i 4 Back List All Places 7 Select one of the Place subcategories e g Hotel or Motel or tap to list all Places in the selected main category around the selected location or along the route List All Places in Accommodation x Camping an ped Hotel or Motel 39 CA LIBER EL vas Merny RDN 573BT NAVIGATION MANUAL fi am v ml 8 Sometimes the list of brands in the selected Place subcategory appears Select one 10 11 12 13 14 List All Places brand or tap to list all Places in the selected subcategory around the selected location or along the route List All Places in Accommodation Hotel or Mote FE all seasons p Best Western c lt Best Western Premier Finally the results appear in a list Andrea Rivoli 3 Rue Saint Bon 75004 Les Halles r Z Sansonnet 48 Rue de la Verrerie 75004 Le Marais af H tel Duo 11 Rue du Temple 75004 Paris Duo 11 Rue du Temple 75004 Le Marais 4 Back Oe
52. es Foss s Saint Bersard 75005 Serve Arrondissement Paris 4 Back f f O More 5 optional The Places in the list are ordered by their distance from the current or last known position from the selected city town from the destination or by the length of the 6 Browse the list if necessary and tap one of the list items A full screen map appears with the selected point in the middle The name and address of the Place is displayed at the top of the screen 7 optional Tap to see the details of the selected Place Tap to return to the map necessary detour If you need to reorder the list tap 8 If necessary tap the map somewhere else to modify the destination The Cursor appears at the new location Tap to confirm the Back destination or tap to select a different destination 9 After a short summary of the route parameters the map appears showing the entire More route The route is automatically calculated Tap CD to modify route gt Go parameters or tap r frr Troyes 10000 Aube France By Route Planning Method and start your journey Road Types Used Motorways Ferries Period Charge Unpaved Roads Per use Toll f 4 Cancel 44 RDN 573BT NAVIGATION MANUAL CALIBER 3 1 3 Selecting a map location as the destination Menu 1 If you are on the Map screen tap to return to the Navigation menu Vo In the Navigation menu tap the followin
53. ff the GPS receiver Then you can set the starting point of the route to a different location than the current GPS position Menu Er 1 If you are on the Map screen tap to return to the Navigation menu Dp My Route 2 Inthe Navigation menu tap en Edit Route 3 If you already have a route tap If you are starting a new route Create Route tap B Current GPS Position 24 Avenue du G n ral de Gaulle Nogent sur Seine Vu 1 5 Troyes 10000 Aube France 4 The first line is the start of the route normally the current GPS position Tap ad and confirm your action at the warning message J Set Start Point 53 CALIBER RDN 573BT NAVIGATION MANUAL M A m Vl 5 The Destination menu appears and you can select the start point of the route the same way you select a destination Find Address Find Places Find on Map Favourites E f 1 9 Rue Albert Thomas History Reims he fF 2 24 Avenue du G n ral de Gaulle Nogent sur Seine f 4 Back O More a When the new start point is set tap The map returns with a transparent Vehimarker showing that there is no GPS reception If an active route already existed it is now recalculated starting from the selected location Your GPS receiver has been turned off Turn on GPS a Turn on GPS 8 To return to normal navigation tap 3 4 3 Editing the list of destinations Edit Route You can edit the route by modifyi
54. fields when cruising without a destination tap and hold any of the fields to change its value Speed Shows your current speed given by the GPS receiver 61 km n Speed Limit Shows the speed limit of the current road if the map contains it 70 km h Shows the current time corrected with time zone offset The accurate time comes from the GPS satellites and the time zone information comes from the map or it can be set manually in Regional settings The current time is always displayed in the top left corner of menu screens Default data fields when navigating a route tap and hold any of the fields to change its value me been Distance Shows the distance you need to travel on the route before reaching 16 9 x your final destination m 0 16 Shows the time needed to reach the final destination of the route based on information available for the remaining segments of the route If Caliber RDN573BT is capable of receiving live traffic information the calculation takes into account traffic delays affecting your route if they are received However this calculation is rarely accurate Historical traffic data can also be taken into account if data is available pute ue Shows the estimated arrival time at the final destination of the route based on information available for the remaining segments of the route If Caliber RDN573BT is capable of receiving live traffic information the calculation takes into account traffic de
55. g buttons tl Locate your destination on the map move and scale the map as needed 24 Avenue du G n ral de Gaulle Nogent sur Seine R AS Port Saint N A CO Ca A V 4 Tap the location that you want to select as your destination The Cursor appears there ap Select Tap to select the Cursor as the destination After a short summary of the route parameters the map appears showing the entire More route The route is automatically calculated Tap to modify route a gt Go parameters or tap and start your journey prute Troyes 10000 Aube France Meaux Route Planning Method Road Types Used Motorways Ferries Period Charge Unpaved Roads Per use Toll r dj Cancel 3 1 4 Selecting the destination from your Favourites You can select a location that you have already saved as a Favourite to be your destination Adding a location to the list of Favourite destinations is described on page 60 1 Access the list of Favourites O e If you are on the Map screen tap to open the Quick menu e If you are in the Navigation menu tap 45 CALIBER RDN 573BT NAVIGATION MANUAL M A m Vl 2 Tap The list of Favourite destinations is displayed amp Amuse Bouches DE 9 Langevin pr Le Saint Nicolas 3 Tap the Favourite that you want to set as your destination If necessary browse down name of the Favourite destination to see more of the list
56. h product information Read the Software and Database End User License Agreement or check the map and other contents of the application You can also access program usage statistics 80 RDN 573BT NAVIGATION MANUAL CALIBER 6 3 Settings menu You can configure the program settings and modify the behaviour of Caliber Tap the following buttons The Settings menu has several options Tap v or scroll with your finger to see the full list Sound and Warnings am Customise Quick Menu r P Driving Time Management F4 etl Traffic C amp Back TEENAA Adjust the sound volume mute your device or change the voice guidance language In addition you can enable and set up different warnings and alerts eee The content of the Quick menu page 21 is fully customisable Tap the n button you want to change and select its new function from the list Driving 5 To calculate a better arrival time it is necessary to include the waiting or 0 8 Time Management loading times spent at each waypoint Driving timers allow you to be warned when you need a rest or you have driven enough for the day The recommended route is not always the same between two points Whenever suitable data exists traffic information can be taken into account in the route calculation Kea These settings determine how routes will be calculated Select the type of vehicle you are driving the road types used in route planning and
57. haracter sequence Fonkhien Place de l H tel de Ville 75004 4 me Arrondissement Paris rr Qi Bel Canto 72 Quai H tel de 75004 Paris H tel de Ville 4 Place de l H tel de Ville 75004 Paris L armor 75004 4 me Arrondissement Paris Back More optional The Places in the list are ordered by the length of the necessary detour when navigating a route or by their distance from the current position when no Browse the list if necessary and tap one of the list items A full screen map appears with the selected point in the middle The name and address of the Place is displayed at the top of the screen optional Tap to see the details of the selected Place Tap to return to the map destination is given If you need to reorder the list tap 35 CALIBER RDN 573BT NAVIGATION MANUAL M A m Vl 7 If necessary tap the map somewhere else to modify the destination The Cursor appears at the new location Tap a Back to confirm the destination or tap to select a different destination 8 After a short summary of the route parameters the map appears showing the entire More calculated Tap to modify route route The route is automaticall parameters or tap and start your journey Va par Troyes 10000 Aube France Route Planning Method Road Types Used Motorways Ferries Period Charge Unpaved Roads Per use Toll f E Cancel
58. he map and menu screens Themes are custom graphic settings and they can have different colours for streets blocks or surface waters in 2D and 3D modes and they display shades or shadows in different ways in 3D mode One daytime scheme and one night scheme is always selected for the map and for the menus Caliber uses them when it switches from day to night and back GPS accuracy Several factors have impact on the deviation between your real position and the one given by the GPS device For example signal delay in the ionosphere or reflecting objects near the GPS device have a different and varying impact on how accurately the GPS device can calculate your position Map Caliber works with digital maps which are not simply the computerised versions of traditional paper maps Similarly to the paper road maps the 2D mode of digital maps show you streets roads and elevation is also shown by colours In 3D mode you can see the altitude differences for example valleys and mountains elevated roads and in selected cities 3D landmarks and 3D buildings are also displayed You can use digital maps interactively you can zoom in and out increase or decrease the scale you can tilt them up and down and rotate them left and right In GPS supported navigation digital maps facilitate route planning 95 CALIBER RDN 573BT NAVIGATION MANUAL M A m Vl North up map orientation In North up mode the map is rotated so its top
59. ical for slow vehicles Searching for a short route regardless of the speed this route type is rarely practical for normal vehicles Gives a quick but fuel efficient route based on the fuel consumption data given in Route settings page 85 Travel cost and CO emission calculations are estimations only They cannot take elevations curves and traffic conditions into account For vehicle types where Green routing is not available this method combines the benefits of Fast and Short Caliber calculates as if it were calculating the Fast route but it takes other roads as well to save fuel Results in a route with fewer turns and no difficult manoeuvres With this option you can make Caliber to take for example the motorway instead of a series of smaller roads or streets 6 3 6 User profiles If more drivers use Caliberfor navigating their settings can be remembered by using one of the user profiles Rename the profiles after tapping the edit button on the right so that all users know which profile to use and switch between profiles by tapping its name If you select a new profile the application restarts so that the new settings can take effect F Driver profile 01 7 Driver profile 02 Driver profile 03 Fs Driver profile 04 f 4 Back 89 CALIBER RDN 573BT NAVIGATION MANUAL M A m Vl 6 3 7 Map settings You can fine tune the appearance of the Map screen Adjust the map view to your needs
60. ire More route The route is automatically calculated Tap to modify route parameters or tap and start your journey pode Troyes 10000 Aube France gjA3 Meaux Ver r Route Planning Method pris Road Types Used TA ma Motorways Ferries Period Charge Unpaved Roads Per use Toll f 4 Cancel 27 CALIBER RDN 573BT NAVIGATION MANUAL M A m Vl 3 1 1 2 Entering the midpoint of a street as the destination You can navigate to the midpoint of a street if the house number is not available Menu 1 If you are on the Map screen tap to return to the Navigation menu 3 bad bind A In the Navigation menu tap the following buttons py find Address If necessary modify the country and city town as described earlier page 26 Enter the street name a Tap b Start entering the street name on the keyboard c Find the street you need e The most likely street name is always shown in the input field To accept it just tap the field you entered the first letters in e If the desired name does not show up the names that match the string appear in a list after entering a couple of characters to open the list of s Results results before it appears automatically tap the street from the list Select r Avenue stant Coquelin 75007 Paris 7 me Arrondissement Paris tant Coquelin Avenue Avenue du Nouveau servatoire 75019 Paris 19 me Arrondissement Paris C
61. l Turn on or off track log saving that is saving the sequence of the locations your journeys go through 90 RDN 573BT NAVIGATION MANUAL CALIBER m Nene Crem Select which Places to show on the map while navigating Too many Places make the map crowded so it is a good idea too keep as few of them on the map as possible For this you have the possibility to save different Place visibility sets You have the following possibilities e Tap the checkbox to show or hide the Place category e Tap the name of the Place category to open the list of its subcategories Tap to save the current Place visibility set or to load a previously saved one Here you can also revert to the default visibility settings 6 3 8 Visual guidance settings Adjust how the software helps you navigate with different kinds of route related information on the Map screen Data Fields The data fields in the corner of the Map screen can be customised Tap this button and select the values you want to see The values can be different when you navigate a route from when you are just cruising without a given destination You can select general trip data like your current speed or the altitude or route data related to your final destination or the next waypoint on your route Mi Ceann YOU may need a petrol station or a restaurant during your journey This 5 feature displays a new button on the map when you are driving on motorways Tap this button to open
62. l information on using the navigation software is Pe inrormaton collected for later development purposes Understanding how different people use the application can help us improve the user interface and the program workflow Anonymous track logs are collected for later development purposes Your trips can help us improve the quality and coverage of maps 94 RDN 573BT NAVIGATION MANUAL CALIBER 7 Glossary 2D 3D GPS reception The GPS receiver uses satellite signals to calculate its your position and needs at least four signals to give a three dimensional position including elevation Because the satellites are moving and because objects can block the signals your GPS device might not receive four signals If three satellites are available the receiver can calculate the horizontal GPS position but the accuracy is lower and the GPS device does not give you elevation data only 2D reception is possible Active route The currently navigated route Whenever the destination is set the route is active until you delete it reach your destination or you quit Caliber See also Route City Centre The city town centre is not the geometric centre of the city town but an arbitrary point the map creators have chosen In towns and villages it is usually the most important intersection in larger cities it is one of the important intersections Colour theme Caliber comes with different colour themes for daytime or night use of t
63. language of the application interface Later you can change it in Regional settings page 93 Eesti keel gt English UK f Espa ol 2 You are now asked whether you allow the software to collect usage information and GPS logs that may be used for improving the application and the quality and coverage f Yes of maps Tap to allow the anonymous statistics or disable this function Later you can turn them on or off individually in Log collection settings page 94 The Configuration wizard starts Tap to continue Select the language and speaker used for voice guidance messages Later you can change it in Sound and Warnings settings page 93 not ennounced a Eesti keel Natural Voice X mah v wlz foe Engl PT moie ks ames 229228 E uw English UK Natural Voice AS Soa Arnt nar Espanol Natural Voice f Back Next 5 If needed modify the time format and unit settings Later you can change them in Regional settings page 93 Distance Kilometres metres Fuel Economy 1 100 km Weight Metric Ton p Currency 6 If needed modify the default route planning options Later you can change them in Route settings page 85 Vehicle Car r Navigation Mode On road Route Planning Method En i Motorways f dj Back CALIBER RDN 573BT NAVIGATION MANUAL M A m Vl 7 The initial setup is now complete The Configuration wizard can be restarted later from
64. lays affecting your route if they are received However this calculation is rarely accurate Historical traffic data can also be taken into account if data is available 13 CALIBER RDN 573BT NAVIGATION MANUAL M A m Vl 2 3 2 Position markers 2 3 2 1 Vehimarker and Lock on Road When your GPS position is available Caliber marks your current position with the Vehimarker This marker is a blue arrow When on road navigation is selected the Vehimarker may not show your exact GPS position and heading If roads are near it is aligned to the nearest road to suppress GPS position errors and the direction of the icon is aligned to the direction of the road If you select off road navigation The Vehimarker is at your exact GPS position The direction of the icon shows your current heading 2 3 2 2 Selected map location Cursor and selected map object You can mark a map location in the following ways e Tap the map when navigating e Tap the map when you are asked to confirm the destination at the end of a search or e Tap the map in Find on Map page 45 When a map location is selected the Cursor appears at the selected point on the map The y Cursor is displayed with a radiating red dot to make it visible at all zoom levels The location of the Cursor can be used as the destination of the route a new alert point you can search for Places around it or you can save this location as one of your Favourit
65. m SEPM REK VG 5 Eu amp 22 88 gt eee co 26 8k9 Tap the field with these details to switch the route to Green immediately 6 1 6 Road safety cameras and other proximity alert points There is a special proximity warning for road safety cameras like speed or red light cameras and other proximity alert points like schools or railroad crossings These alert points are not part of Caliber You can download them from www naviextras com or you can upload points in a specific text file if needed You can also add your own alert points or edit the previously uploaded points See page 62 for details The application can warn you when you approach road safety cameras like speed cameras or dangerous areas like railroad crossings or school zones You can set up the different alert types individually in Sound and Warnings settings page 82 The following alert types are available e Audio warning beeps can be played while you are approaching one of these points or extra alert sounds if you exceed the given speed limit while approaching 15 CALIBER RDN 573BT NAVIGATION MANUAL M q m v e Visual warning the type of the alert point its distance and the related speed limit appear on the Map screen while you are approaching one of these cameras For some of the alert points the enforced or expected speed limit is available For these points the audio alert can be different if you are below or above the given spee
66. map all the time example 6 1 8 GPS position quality indicator and current time You can find useful information in the top corners of menu screens The current time is displayed in the top left corner In the top right corner the GPS reception quality icon shows the current accuracy of the position information Caliber has no connection to the GPS receiver GPS navigation is not possible Devices with a built in GPS receiver are permanently connected On such devices the icon does not appear in normal circumstances 76 RDN 573BT NAVIGATION MANUAL CALIBER Caliber is connected to the GPS receiver but the signal is too weak and the receiver cannot determine the GPS position GPS navigation is not possible Only a few satellites are received Position information is available but elevation altitude cannot be calculated GPS navigation is possible but the position error may be significant Kee Altitude information is available the position is a 3D position GPS navigation is possible 6 1 9 Traffic information in route planning The recommended route is not always the same between two points Offline statistical traffic information historical speed information or traffic patterns can be taken into account in the route calculation based on the time of day and the day of week whenever suitable data exists In addition real time traffic information can help you avoid current traffic events like temporary roa
67. modify the country and city town as described earlier page 26 Enter the street name a Tap b Start entering the street name on the keyboard c Find the street you need e The most likely street name is always shown in the input field To accept it just tap the field you entered the first letters in e If the desired name does not show up the names that match the string appear in a list after entering a couple of characters to open the list of s Results results before it appears automatically tap the street from the list Select Avenue stant Coquelin 75007 Paris 7 me Arrondissement Paris g stant Coquelin Avenue Avenue du Nouveau servatoire 75019 Paris 19 me Arrondissement Paris Carrefour de la servation 75012 Paris 12 me Arrondissement Paris f cit dorcet 75009 Paris 9 me Arrondissement Paris Back 5 Enter the intersecting street name lt Intersecting Street gt a Tap e If only a few intersecting streets exist their list appears immediately 29 CALIBER RDN 573BT NAVIGATION MANUAL M q m v e In case of a longer street the keyboard screen appears Start entering the name of the intersecting street on the keyboard As soon as the street names that match the entered string can be shown on one screen their list appears automatically Select from the list Cours La eine 75008 Paris 8 me Arrondissement Paris ue Boissy d Anglas 75008 Paris
68. n Tap to select the destination The Destination menu appears and you can select the destination of the route the same way as described in the previous sections Find Address Find Places Find on Map Favourites Pa 1 9 Rue Albert Thomas History Reims G 2 24 Avenue du G n ral de Gaulle Nogent sur Seine f f Back More 7 When the new destination is selected the list returns GR B Current GPS Position 24 Avenue du G n ral de Gaulle Nogent sur Seine Vu ae Troyes 10000 Aube France i vr Back 8 To add more destinations tap where you want to insert the new route point in the list and repeat the above procedure 9 After you have added all the route points tap to have the route calculated 50 RDN 573BT NAVIGATION MANUAL CALIBER 3 2 Viewing the entire route on the map It is easy to get a map overview of the active route Do as follows Menu _ 1 If you are on the Map screen tap to return to the Navigation menu My Route 2 Inthe Navigation menu tap l N Overview 3 Tap iim The active route is displayed in its full length on the map together with additional information and controls Edit Route overview a 77 Avoidances Cancel Route 3 3 Checking route parameters and accessing route related functions You can check different parameters of the route recommended by Caliber Menu a 1 If you are on the Map screen t
69. name is always shown in the input field To accept it just tap the field you entered the first letters in 32 CALIBER AUDIO TECHNOLOGY RDN 573BT NAVIGATION MANUAL e If the desired name does not show up the names that match the string appear in a list after entering a couple of characters to open the list of s Results results before it appears automatically tap Select the street from the list f Avenue stant Coquelin 75007 Paris 7 me Arrondissement Paris stant Coquelin Avenue Avenue du Nouveau servatoire 75019 Paris 19 me Arrondissement Paris Carrefour de la servation 75012 Paris 12 me Arrondissement Paris cit dorcet 75009 Paris 9 me Arrondissement Paris Back 6 Enter the house number a Tap b Enter the house number on the keyboard To enter letters tap weg c Tap to finish entering the address If the entered house number cannot be found the midpoint of the street is selected as the destination 7 A full screen map appears with the selected point in the middle If necessary tap the V map somewhere else to modify the destination The Cursor appears at the new Next location Tap to confirm the destination or tap to select a different destination 8 After a short summary of the route parameters the map appears showing the entire More route The route is automatically calculated Tap to modify route gt Go parameters
70. nd Safety information The navigation system helps you find your way to your destination with the built in GPS receiver Caliber does not transmit your GPS position others cannot track you If you accept it when first using the application Caliber collects usage information and GPS logs that may be used for improving the application and the quality and coverage of maps The data is processed anonymously no one will be able to track any personal information If you change your mind later you can enable or disable the log collection in Settings page 94 It is important that you look at the display only when it is safe to do so If you are the driver of the vehicle we recommend that you operate Caliber before you start your journey Plan the route before your departure and stop if you need to change the route You must obey the traffic signs and follow the road geometry If you deviate from the recommended route Caliber changes the instructions accordingly Never place Caliber RDN573BT where it obstructs the driver s view where it is in the deployment zone of an airbag or where it might cause injuries in an accident RDN 573BT NAVIGATION MANUAL CALIBER 2 Getting started Caliber is optimised for in car use You can use it easily by tapping the screen buttons and the map with your fingertips When using the navigation software for the first time an initial setup process starts automatically Do as follows 1 Select the written
71. nd small symbols displayed along the route show the type of the traffic event 18 CALIBER AUDIO TECHNOLOGY RDN 573BT NAVIGATION MANUAL 2 3 3 8 Traffic events Road segments affected by traffic events are displayed with an alternate colour on the map and small symbols above the road show the nature of the event Voie Georges Pompidou A EJ FEN ioie Georges Pompidou hy 147km 2 A Next event in 16 8 km Right lane closed Significant Events 1 V Trafic 95 0 MHz 3 Tap the traffic category you are interested in or tap to see the list of all events A4 A86 Roissy Noisy le Grand ouest Right lane closed 17 km Place Charles de Gaulle Place de la Concorde Slow traffic 46 ion Paris Porte d Auteuil Paris Porte Maillot 4 Slow traffic 2km Porte de Champerret Place de la Porte Maillot Queuing traffic 9 4 km 4 Back O More Q Iter 4 Now tap any of the list items to see its details and to display the affected road segment in its full length on the map Porte de Clichy Boulevard P riph rique Place de Clic La Fourche Avenue de Saint Ouen Place de EY Note bypassed the fi quickly check them 19 CALIBER RDN 573BT NAVIGATION MANUAL M A m Vl 2 3 4 Manipulating the map Tap the map anywhere to browse it during navigation The map stops following the current position the Vehimarker a blue arrow by default is not l
72. ng on the map The Map screen is the most frequently used screen of Caliber Show Map A small live map is displayed on the Navigation menu as a part of the button My Route Show Map More Show Map To enlarge this small map and open the Map screen tap This map shows the current position the Vehimarker a blue arrow by default the recommended route an orange line and the surrounding map area When there is no GPS position the Vehimarker is transparent It shows your last known position You see coloured dots circling around a satellite symbol in the top left corner The more green dots you see the closer you are to get the valid GPS position When GPS position is available the Vehimarker is displayed in full colour now showing your current position There are screen buttons and data fields on the screen to help you navigate During navigation the screen shows route information CJ The o button gives quick access to frequently used functions You can change the available functions in Settings By default only one data field is displayed in the bottom right corner Tap this field to see all route data fields Tap any of the data fields to suppress others and display only the selected one 12 RDN 573BT NAVIGATION MANUAL CALIBER The data fields are different when you are navigating an active route and when you have no specified destination the orange line is not displayed Default data
73. ng the list of destinations You can add or remove destinations modify the start position or reorder the list Menu ae 1 If you are on the Map screen tap to return to the Navigation menu My Route 2 Inthe Navigation menu tap 3 Tap B Current GPS Position 24 Avenue du G n ral de Gaulle Nogent sur Seine G A p s Troyes 10000 Aube France 4 Back 4 You have the following options e Tap to add a new destination 54 RDN 573BT NAVIGATION MANUAL CALIBER e Tap to delete a destination e Tap to modify the start point of the route More e Tap FO More to reorder the list You can do it manually or you can let the application optimise the route for you 3 4 4 Pausing the active route You do not need to pause the active route when you start driving again Caliber restarts the voice instructions from your position 3 4 5 Cancelling the active route To cancel the navigated route do one of the following e If you are on the Map screen tap o and then tap Eisis If you have a route Remove with waypoints you need to tap kaka until all waypoints are deleted My Route a5 i Cancel Route e Inthe Navigation menu tap and then tap The active route is deleted with all its waypoints 3 4 6 Checking route alternatives when planning the route You can select from different route alternatives or change the route planning method afte
74. nnnnsrrennnn 59 3 5 Saving a location as a Favourite destination rrrrrnnonnnnnnnrrnnnvvvvvvnvvnvnrrrnnrrnnnnnnnnnnnnnnn 60 3 5 1 Editing the details of Favourite desndidnurosassvsqqmadssssvsamsknken 61 3 6 Saving a map location as an alert point sammensatt 62 3 7 Editing an alert point sininitvinnssevceeteaqanncesseaoenndaannnsi 4a tinea veasltiinsanaetsnmntssnaeinananiaailadeoonienees 63 3 8 Watching the simulation of the route rrrrrrrrnrrrrnnnnnnnnnnnnnnnnnnnnvrvvnnvrnnrerrrnrsrrnssnnernnnnnnnnnn 64 4 OfFro d navnsa ion u um wwveeseimnsseertinemnnreveiipsiiivdasnakseasnndansner 66 4 1 Selecting the destination Of the route as pesensrssrsssnninssnnssn nr aaeanasskmeedaekeneisendddddededneee 66 4 2 Navigating in off road mode susnucccesscessiuaescasisinsnvannusestvicsvadestiaveesdiasaantaemasadesdesnnanacannstenin 66 5 Lorry NAVIES aises 67 5 1 Setting up vehicle parameters vasisasssnnosnnnnaranacssaassaciecernevnsiecdenmnesennnniacaneabassssoreusnnannnntabios 67 5 2 Setting up waiting time at Waypoints rrrrrrrrrvvrrrrrrrrrnnnnnnnnnnnnnnvrrnnvvvvnnrrnnrrrrsrserssssnnnnnnnnns 69 5 3 Setting up driving time alerts drssnearazsveseeesentsssnannnninscnninagadaineisadsinmennnnseiaananiiheraaaaeRteRs 70 6 Referat Gude sisissaisccatiesiiseasevcivesisvedtauatedesbaionsaieubuscunbesetscusdsieastbeneaaenbancisesisastes 72 TENT 72 FT Smart ZooM agenda 72 6 1 2 Daytime and night colour themes sesscdscier decsrvnncnndaciaccseencediensentansssantareena
75. ocked in a fix position on the screen any more and control buttons appear to help you modify the map view mar No buttons Moving the map with drag amp drop Zooming in and out Tilting up and down Rotating left 2D or 3D view You can move the map in any direction tap and hold the map and move your finger towards the direction you want to move the map Changes how much of the map is displayed on the screen Caliber uses high quality vector maps that let you examine the map at various zoom levels always with optimised content It always displays street names and other text with the same font size never upside down and you only see the streets and objects that you need Map scaling has a limit in 3D map view mode If you zoom out further the map switches to 2D view mode Tap the button once to modify the view in large steps or tap and hold the button to modify it continuously and smoothly Changes the vertical view angle of the map in 3D mode Tap the button once to modify the view in large steps or tap and hold the button to modify it continuously and smoothly Changes the horizontal view angle of the map Tap the button once to modify the view in large steps or tap and hold the button to modify it continuously and smoothly Tap this button to switch between the 3D perspective and 2D top down map view modes Compass in 2D map view mode Compass in 3D map view mode The direction of the c
76. od Ge gt Road Types Used Motorways Ferries Period Charge Unpaved Roads Per use Toll f 4 Cancel 3 1 2 5 Selecting nearby assistance from Where Am I You can quickly search for nearby assistance from the Where Am I screen CJ 1 On the Map screen tap o to open the Quick menu r NN A f a f R Quic Pesce Favourites History Edit Route g 5 2 f pr ks aaj TA amp j Remove Route i 2 Map Settings Where Am I next Waypoint Settings 2 gt gt Tap Where Am I Car Repair Health Around Here Around Here Police Petrol Station Around Here Around Here 43 CALIBER RDN 573BT NAVIGATION MANUAL M A m Vl 3 Preset search categories appear all for searching around the current position or around the last known position if the current position is not available Car Repair Around Here Car repair and roadside assistance services amp Health Around Here Medical and emergency services Police Around Here Gas Station Around Here 4 Tap any of the quick search buttons to get an instant list of that type of Places Police stations e Petrol stations Garage de l Ile Saint Louis 5 Boulevard Henri IV 75004 4 me Arrondissement Paris Parking Garage Sully Rue Agrippa d Aubign 75004 4 me Arrondissement Paris St Parisienne de Parking Rue Saint Antoine 75004 4 me Arrondissement Paris Mercedes Benz Jussieu Automobiles 35 Rue d
77. of the exit and the difference in distance and estimated time compared to the original route You can choose from one of the following options e Tap if you want to keep the original route e Tap one of the suggested detour options and you will see the overview of the original route and the detour to make the decision You can accept the detour as offered or increase the bypassed motorway segment before accepting Turn to the suggested new direction and the route will be automatically recalculated nek esis Similar to the above possibility alternative routes can be suggested when driving on normal roads Caliber will select a different turn in the Route Alternatives upcoming intersection and offers you a different route for the next section of the route Your options are the similar as above but you cannot modify the offered detour P em Parking at the destination may not be easy in city areas As you sine approach the destination Caliber can offer parking category Places near your destination Tap the P button to open a top down map with the destination and the offered parking Places Select one and modify the route accordingly Sil if you leave the recommended route and suddenly exit the motorway E Detour ae 4 hoe Ses the application offers different alternatives near the exit like petrol stations or restaurants Also if there are avoidable parts of the original route ahead like a tunnel a toll road or a fer
78. ompass shows North Tap the button to switch to North up view and then tap again to rotate the map in the previous direction The direction of the compass shows North Tap the button to switch to North up view and then tap again to rotate the map in the previous direction 20 RDN 573BT NAVIGATION MANUAL CALIBER Location Tap this button to open a new screen with information information about the selected map point the Cursor Return to normal navigation Tap this button to move the map back to follow the current GPS position Automatic map rotation is also re enabled The map manipulation buttons disappear and navigation continues Additional Tap this button to open a list of additional features like options saving the Cursor as a Favourite destination or searching for Places around the Cursor Selecting kg Tap this button to select the Cursor as a new destination destination The route is automatically calculated 2 3 5 Quick menu The Quick menu is a selection of controls and functions that are oll needed during navigation It can be opened directly from the Map screen by tapping f f Q kX amp Favourites History Edit Route mee f l y AGA 1 Remove Next Waypoint Quick Place Search settings _ Map Settings Where Am I The menu will close after a few seconds of inactivity or if you tap gt Most of these functions are shortcuts They are accessible from the menu sys
79. ormation can also be considered for the whole route e When selecting lorry as the vehicle type U turns are disabled from routes as much as possible Disable U Turns e By using the button in the vehicle profile you can even forbid turning back on divided roads e You can use countdown timers to alert you when compulsory breaks must be taken timers can be set for one driver or two alternate drivers Warnings are both visual and audible There are different kinds of warnings e When approaching a restricted road segment without a route you are warned that there is a restricted area ahead e Restricted road segments are excluded from your routes but in some cases some restricted roads need to be used to reach the given destination In this case you receive a warning and you must accept that you have restricted roads in your route or you can stop the navigation and continue without an active route Please note that lorry navigation is only as accurate and comprehensive as the restrictions received with the map Restrictions may not cover lower priority roads and in most cases the coverage changes as you move around your map region You are obliged to always obey the restrictions displayed on the road EY Note 5 1 Setting up vehicle parameters When you use Caliber with a lorry you need to select a lorry type vehicle profile in Route settings and enter the parameters of your vehicle These parameters are used in route calculation
80. p Next appears at the new location Tap to confirm the Back destination or tap to select a different destination 37 CALIBER RDN 573BT NAVIGATION MANUAL M A m Vl 9 After a short summary of the route parameters the map appears showing the entire More to modify route route The route is automatically calculated Tap gt Go parameters or tap and start your journey p s Troyes 10000 Aube France Route Planning Method Road Types Used Motorways Ferries Period Charge Unpaved Roads Per use Toll r 4 Cancel 3 1 2 3 Searching for a Place of Interest by category You can search for Places of Interest by their categories and subcategories Menu 1 If you are on the Map screen tap to return to the Navigation menu 2 Inthe Navigation menu tap the following buttons Tap Custom Searc Select the area around which the Place should be searched for R e Tap v r ir to search for a place within a selected city town The result list will be ordered by the distance from the centre of the selected city town Ang Rore e Tap to search along the active route and not around a given point This is useful when you search for a later stopover that results in a minimal detour only such as searching for upcoming petrol stations or restaurants The result list will be ordered by the length of the necessary detour 4 to search around the curr
81. p left Continue straight in the intersection Go left on the roundabout 3rd exit next manoeuvre Enter roundabout second next manoeuvre Co 15 CALIBER RDN 573BT NAVIGATION MANUAL HSNON gt D Enter motorway Exit motorway i ferry fag oa a waypoint Approaching the destination 2 3 3 3 Lane information and Signposts When navigating on multilane roads it is important to take the appropriate lane in order to follow the recommended route If lane information is available in the map data Caliber displays the lanes and their directions using small arrows at the bottom of the map Highlighted arrows represent the lanes you need to take Where additional information is available signposts substitute arrows Signposts are displayed at the top of the map The colour and style of the signposts are similar to the real ones you can see above road or by the roadside They show the available destinations and the number of the road the lane leads to All signposts look similar when cruising when there is no recommended route When navigating a route only the signpost that points to the lane s to be taken is displayed in vivid colours all others are darker If you want to hide the currently displayed signposts tap any of them and the normal Map screen returns until new signpost information is received A4 E50 L Autoroute de I Est i ede AS E50 141km i 16 RDN 573BT N
82. pear on the Map screen while you are approaching one of these cameras For some of the alert points the enforced or expected speed limit is available For these points the audio alert can be different if you are below or above the given speed limit e Only when speeding The audio alert is only played when you exceed the given speed limit e When approaching The audio alert is always played when approaching one of these alert points In order to draw your attention the alert is different when you exceed the speed limit Meuk Eie Maps may contain driver alert information that is displayed as traffic signs on the map screen Tap this button to enable or disable the warning for these road segments for example dangers sharp curves For each category of warning signs set the warning type audio or visual and the distance from the hazard to receive the warning at 83 CALIBER RDN 573BT NAVIGATION MANUAL M A m Vl You can control the volume of the following sound types This is the main volume control These controls affect all below sounds These controls affect the volume of the guidance sounds verbal instructions Ding Turn off the attention tone preceding verbal instructions or adjust its volume Alert Beeps These controls affect the volume of the non verbal alert sounds beeps Key sounds provide audible confirmation of tapping the touch screen These controls affect key sounds Cont
83. played C Amuse Bouches C Langevin Le Saint Nicolas 3 Tap the Favourite that you want to edit If necessary browse down to see more of the destination list or tap and enter a few letters from the name of the Favourite 4 A full screen map appears with the selected point in the middle Tap ES to see the details of the selected Place Tap any of the data fields and modify its content 6 Back 7 Tap and hold ETEN to return to the map 61 CALIBER RDN 573BT NAVIGATION MANUAL M A m Vl 3 6 Saving a map location as an alert point You can save any map location as an alert point for example a speed camera or a railway crossing 1 Browse the map and select a location The red Cursor appears there More Places Around Cursor r Add to Favourites rN E Show Cursor Position f W gose En Add Alert Point 3 Scroll down the list and tap e 4 On the newly opened screen select the type of the alert point the direction from which you expect the alert and if applicable the speed limit for this alert point Type of Alert Speed Camera Direction of Alert p Speed Limit 90 km h f Save 5 Tap to save the location as a new alert point 62 RDN 573BT NAVIGATION MANUAL CALIBER 3 7 Editing an alert point You can edit a previously saved or uploaded alert point for example a speed camera or a railway crossing 1 Browse the map and s
84. r you have selected a new destination Do as follows 1 Select a destination as explained earlier and get to the route confirmation screen prute Troyes 10000 Aube France 55 CALIBER AUDIO TECHNOLOGY RDN 573BT NAVIGATION MANUAL M A m Vl P Route Alternatives r AY Itinerary 414 Route Settings 7 W ose L gt Route Alternatives Tap You see the basic details of three route alternatives with the selected route planning method Tap any of them to see it on the map E Ma m i ed Route Alternatives ES Rg 5 160 More Results 5 Or if you cannot find a good alternative tap and scroll down for routes with different routing methods Route Alternatives Pa 5 e Lra 6 Select one of the route alternatives and tap to return to the previous screen Caliber recalculates the route The orange line now shows the new recommended route 56 RDN 573BT NAVIGATION MANUAL CALIBER 3 4 7 Checking route alternatives for an existing route To recalculate the active route with a different route planning method you can modify the Route settings page 85 There is another way to do this and to compare different route alternatives with the same route planning method Do as follows Menu or 1 If you are on the Map screen tap to return to the Navigation menu My Route 2 Inthe Navigation menu tap Edit Route overview
85. r your region ask your local dealer or may not be fully correct for all roads in the map The maximum speed set in the vehicle profile is also used for this warning Caliber alerts you if you exceed the preset value even if the legal speed limit is higher This setting lets you decide whether you wish to receive visible and or audible warnings Adjust the slider to set the relative speed above which the application initiates the warning The following alert types are available e Audio warning you receive a verbal warning when you exceed the speed limit with the given percentage Visual warning the current speed limit is shown on the map when you exceed it If you prefer to see the speed limit sign on the map all the time normally it is shown only if your speed exceeds it you can set it here This feature allows you to receive a warning when approaching a Road Safety Camera or other alert points like school zones or railroad crossings You must ensure on your own liability that using this feature is legal in the country where you intend to use it You can set the warning type for the different alert point categories individually The following warning types are available e Audio warning beeps can be played while you are approaching one of these points or extra alert sounds if you exceed the given speed limit while approaching e Visual warning the type of the alert point its distance and the related speed limit ap
86. re are several ways to modify the active route The following sections show some of those options 3 4 1 Selecting a new destination when already having a route New Route Waypoint or Final Destination If you already have a recommended route and you select a new destination as described in the above sections the application will ask you whether to start a new route add a new waypoint intermediate destination to the route or append the newly selected destination at the end of the current route Waypoint pa I p i Bsc Final ris Destination New Route gt C amp Back e Tap ELGI to plan anew route to the newly selected location The previous destination and waypoint s are deleted 52 RDN 573BT NAVIGATION MANUAL CALIBER e Tap EECA to add the newly selected location as an intermediate destination to your route The other destinations of the route remain intact Note the new waypoint is placed among destinations to keep the route optimal To decide where a waypoint to appear use the Edit Route feature AES to append the newly selected destination at the end of the route The other destinations of the route remain intact The previous final destination is now the last waypoint 3 4 2 Setting a new starting position for the route For normal navigation all routes are planned from the current position In order to check future routes simulate them or see their length in time and distance you can turn o
87. rols for each sound type Volumesiger Adjusts the volume of the related sound Use the switch to mute the related sound The slider becomes inactive Tap again to re enable 6 3 2 Customise Quick menu The content of the Quick menu page 21 is fully customisable Tap the button you want to change and select its new function from the list The list of available functions and their descriptions are on page 21 6 3 3 Driving time management To calculate a better arrival time it is necessary to include the waiting or loading times spent at each waypoint Driving timers allow you to be warned when you need a rest or you have driven enough for the day You have the following options Ask for Waiting Time Turn this switch on to be able to set the waiting time for all waypoints of the route This way the arrival time calculation can take into account the idle times at intermediate destinations In addition time dependent restrictions and statistical traffic information can also be considered for the whole route Configure Driving Timers Set up and use countdown timers to monitor the continuous and daily driving times as described on page 70 84 RDN 573BT NAVIGATION MANUAL CALIBER 6 3 4 Traffic settings The recommended route is not always the same between two points Whenever suitable data exists traffic information can be taken into account in the route calculation am een Use this switch to enable or disable historic
88. rrent position This will also turn off the GPS receiver so that the route is not recalculated when a new position is received You can plan routes with multiple destinations Select the first destination Then select a second destination and add it to your route to create a multi point route You can add as many destinations to your route as you like You can also use Caliber for off road navigation For details see page 66 3 1 Selecting the destination of a route Caliber offers you several ways of choosing your destination e Enter a full address or a part of an address for example a street name without a house number or the names of two intersecting streets page 25 e Enter an address with postal code page 32 This way you do not need to select the name of the city town and the search for street names might be faster as well e Use a built in Place of Interest as your destination page 34 e Select a location on the map with the Find on Map feature page 45 e Use a previously saved Favourite destination page 45 e Select a location from the History of previously used destinations page 47 e Enter the coordinate of the destination page 48 3 1 1 Entering an address or a part of the address If you know at least a part of the address it is the quickest way to select the destination of the route Using the same screen you can find an address by entering e the exact address including house number e the centre of
89. rrrsrnrnnrrrernnnnsreenn 47 3 1 7 Entering the coordinate of the destmatonLuausnsemsmnanansrnsersmeravnsarsasvm iv 48 3 1 8 Building a route from the list of destinations Create Route rrrrrrnnrrnrrrrnnnrrnrrrrrrrnerrenn 50 3 2 Viewing the entire route on the map rovvvrrnnnrrrrnnnornnnnnnnnnnnnnnrrvvnnnnnnnnrrnnrssssnnnsnnnnnnnnennn 51 3 3 Checking route parameters and accessing route related functions rnnrrrvnvrrnnnnnnnrnre 51 3 4 Modifying EON den 52 3 4 1 Selecting a new destination when already having a route New Route Waypoint or Final BLE GE RE EEE EA EAEE AGEE TSE 52 3 4 2 Setting a new starting position for the route si sesicccssnsstessnscnd oaccawedanseoaasantactnonedaesvadandeacatnaees 53 3 4 3 Editing the list of destinations Edit ROUUE ssisseiiadccssanstessnscedoncedwedensensassautacsnanedaesvedenbeaceceases 54 Je NENNE ae 55 3 4 5 Cancelling the active TOU a isa spss onseva vn cues Aeyattatsurmanloainbininneabignisia uid ese ale Ovatanonacanbebssnpenbayensesanen 59 3 4 6 Checking route alternatives when planning the route srrrnnrrrnnnrvrrrrnnrrnrrrrnnnrnnrrrrrrnnereenn 55 3 4 7 Checking route alternatives for an existing route rrrnrrrornrrnrrrrrrrrrrrrrrrrrnrrrrrrnrnnerrrrnrnnerrenn 57 3 4 8 Changing the vehicle used in route planning rrrnvrrnvrrrrrnrvnvrrrrrrnverrererrnrrrrsrnrnsserernnrnssrenn 58 3 4 9 Changing the road types used in route planning rrrrrrnnrrvnrrrrnrnrvnrrrrrrnrnrrrnnrnnerrrn
90. ry you will find them in the list in case you want to bypass them with the help of Caliber 6 3 9 Display settings Display related settings include menu animations separate skins for daytime and night use and the brightness of the display IW alem Nalisatciscelame Vhen animation is turned on buttons on menus and keyboard screens appear in an animated way Screen transitions are also animated sen mene Select the style and colours of the application used in daytime mode Mie auu Select the style and colours of the application used in night mode 92 RDN 573BT NAVIGATION MANUAL CALIBER evner eee Adjust the display backlight 6 3 10 Regional settings These settings allow you to customise the application for your local language measurement units time and date settings and formats as well as to choose the time zone This button displays the current written language of the user interface By tapping the button you can select a new language from the list of available languages The application will restart if you change this setting you are asked to confirm this Mine isome YOU Can Set the distance units to be used by the program Caliber may not support all the listed units in some voice guidance languages Select between 12 and 24 hours time display and the various international date display formats Program language You can also set other country specific units used to display different values in th
91. s page 85 A special icon Al is displayed on the Map screen to show you whether traffic events are received The icon shows the status of the traffic receiver when there are no traffic events on your route otherwise it shows the type of the next traffic event on your route Road segments affected by traffic events are displayed with an alternate colour on the map and small symbols above the road show the nature of the event Voie Georges Pompidou a 78 CALIBER AUDIO TECHNOLOGY RDN 573BT NAVIGATION MANUAL A 1 Tap Bm to open the Traffic Summary screen Next event in 16 8 km Right lane closed Significant Events 1 V Trafic 95 0 MHz ANN Event List 2 Tap 3 Tap the traffic category you are interested in or tap to see the list of all events A4 A86 Roissy Noisy le Grand ouest Right lane closed 17 km Place Charles de Gaulle Place de la Concorde Y Slow traffic LG im Paris Porte d Auteuil Paris Porte Maillot Slow traffic Dy Porte de Champerret Place de la Porte Maillot Queuing traffic 2 4 km 4 Back O More Q Filter 4 Now tap any of the list items to see its details and to display the affected road segment in its full length on the map A Porte de Clichy Boulevard P riph rique Place de Clic La Fourche Avenue de Saint Ouen Place de Clichy Boulevard des Batignoles EY Note bypassed the quickly check them
92. scroll the list to see earlier destinations Smart History Items 9 Rue Albert Thomas Reims Place de la Concorde Paris 24 Avenue du G n ral de Gaulle Nogent sur Seine History Items Select a destination from the list A full screen map appears with the selected point in the middle If necessary tap the Vi map somewhere else to modify the destination The Cursor appears at the new to confirm the destination or tap location Ta CTD to select a different destination 5 After a short summary of the route parameters the map appears showing the entire More route The route is automatically calculated Tap to modify route a gt Go parameters or tap and start your journey 2 prute Troyes 4 50 10000 Aube France 161 km gt Kr en 21 89 lt Route Planning Method 11 01 12 7 Gir Road Types Used 7 E 25 6kg Motorways Ferries Period Charge Unpaved Roads Per use Toll f 4 Car el 3 1 7 Entering the coordinate of the destination You can also select a destination by entering its coordinate Do as follows Menu a 1 If you are on the Map screen tap to return to the Navigation menu 2 Inthe Navigation menu tap 3 Open the menu and tap RDN 573BT NAVIGATION MANUAL CALIBER 4 Youcan enter the latitude and longitude values in any of the following formats decimal degrees degrees and decimal minutes or degrees minutes and decimal seconds
93. svneiarendeaadsentdanecien 72 TN 72 6 1 4 Route calculation and recalculation ssssoeeesseeeseeesseeesssssseresssessseesssesssetsstressseesseresssessse 73 6 1 5 GEA eee Gear 75 6 1 6 Road safety cameras and other proximity alert points srrrerrrrrrrrrrrrrnnrrnvrrrrrnrnnrrrrrnnnnerrenn 75 6 1 7 JET 76 6 1 8 GPS position quality indicator and current time ssrrnnnrronnrvnvrrrrnrrnnrrerrrrnrrrrnrnrnsrrrernrnneerenn 76 6 1 9 Traffic information in route planning vaser ammng deukegieesie TI RDN 573BT NAVIGATION MANUAL CALIBER FEIE 78 6 1 9 2 Real time traffic information TMO uansesnsissnsuninetemmdneiddsi dv birken 78 6 2 More Ne 80 GREN ES MENU EEE SE S1 6 3 1 Sound and Warnings eee 82 6 3 2 Customise Quick menn iin icosiiessicssesiciinsdavourssuicediasenancuienneedsosvesunsbenvbaceusiavdssietenuieucsesseensoaneseoss 84 6 3 3 Driving time management Aa ssccu seri cecisvincbacb peecve cd Sevannacavecencviiw wus av baunedeeveaiatar eared buceheons 84 6 34 TEGN E 85 6 3 5 Route Je E Ree 85 6 3 0 User vvs E eee E 89 6 3 7 Map Eee 90 6 3 9 VISUAL guidance PS soreer asserir niire E A EA RE REE E EREE E RERE AE 91 HD SCN E S ore E I A E E E IEEE E E 92 0O REA Ekern 93 6 EP D ST asken 93 6 3 12 Log collection settings lt 5 scaran oii otctessacuntanagtesiesepsgu ste word dala tbdcantpssae deans eveieencamaineade 94 T GLOSSED Y EN ENE AA 95 EP NN 97 CALIBER RDN 573BT NAVIGATION MANUAL M A m Vl 1 Warnings a
94. te position and signal strength information More Settings Route This button opens the parameters of the selected Vehicle page 85 profile More Settings Lorry This button opens the Lorry settings screen page 67 More Settings Lorry ae Configure Driving Timers Configure page 70 Driving Timers This button opens the Driving timer configuration screen 2 3 6 Checking the details of the current position Where Am I This screen contains information about the current position or about the last known position if GPS reception is not available and a button to search for useful Places nearby AD Latitude G Longitude Altitude NY N48 85343 P 2 35693 Om nce Paris Voie Georges Pompidou f f Back More 9 Help Nearby You can access this screen from the map in one of the following ways e f the current street is displayed below the Vehimarker the current position on the map tap it to open the Where Am I screen 23 CALIBER RDN 573BT NAVIGATION MANUAL M A m v IT e Open the Quick menu and tap the MAS button Information on this screen Slo e sy Latitude and Longitude coordinate of the current position according to the widely used WGS84 format E Altitude elevation information coming from the GPS receiver often inaccurate a House number on the left fal House number on the right e Inthe middle of the screen you can see whe
95. tem There are more functions available than the number of buttons in the menu In Settings you can choose the function of each button page 84 The following options are available Button Description Shortcut for Find Find Places Quick Search page 35 This function lets you search for a Place by its name The search is carried out either along your route or around your current location if there is no route calculated Find Favourite page 45 This button opens the list of your Favourite destinations Favourites This button opens the History list You can select one of Find History page 47 A ha your previous destinations History 21 CALIBER AUDIO TECHNOLOGY e Edit Route Map Settings Where Am I Cancel Route Remove Next Waypoint Visual Guidance Itinerary This button opens the route editing function This button opens the route related settings This button opens the map related settings This button opens a special screen with information about the current position and a button to search for nearby emergency or roadside assistance For details see the next chapter This button cancels the route and stops navigation The button is replaced with the next one if waypoints are given This button skips the next waypoint from the route This button opens a 2D map scaled and positioned to show the entire route This button opens the Visual Guidance se
96. the route planning method If more drivers use Caliberfor navigating their settings can be User Profiles N remembered by using one of the user profiles MEP anea YOU can fine tune the appearance of the Map screen Adjust the map view to your needs choose suitable colour themes from the list for both daytime and night use show or hide 3D buildings turn track logging on or off and manage the visibility of Place markers which Places to show on the map i veren i Adjust how the software helps you navigate with different kinds of route s related information on the Map screen 81 CALIBER RDN 573BT NAVIGATION MANUAL JBL E Display Display related settings include menu animations and separate skins for daytime and night use These settings allow you to customise the application for your local language measurement units time and date settings and formats as well as to choose the time zone a Trib Moni Trip logs and track logs contain useful information about your trips Trip op Montor logs can be saved manually when you reach your destination or you can turn on the automatic saving here The application collects usage information and GPS logs that may be l used for improving the application and the quality and coverage of maps Here you can enable or disable collecting these logs K vaa Modify the basic software parameters set during the initial setup gt o process For details see page 7 Delete
97. ther the position is current or the time left since it was last updated e Address details when available of the current position are displayed at the bottom You can also perform some actions on this screen More Tap LO More to save the current position as a Favourite destination Help Nearby You can also search for assistance near your current position Tap to open a new screen for the Quick search Car Repair Health Around Here Around Here p Police Petrol Station Around Here Around Here Back The following services can be searched around the current position or the last known position ii Car repair and roadside assistance services A dH i i Ann Police stations A H i i ve Medical and emergency services iin Petrol stations Tap any of the buttons select a Place from the list and navigate to it 24 RDN 573BT NAVIGATION MANUAL CALIBER 3 On road navigation When first started Caliber calculates routes using the road network of the high quality vector maps provided with the product You can set up your route in different ways e f you need a route for immediate navigation you can select the destination and start navigating to it right away normal navigation e You can also plan a route independently of your current GPS position or even without GPS reception To achieve this you need to set a new starting point in My Route Edit Route by tapping the flag icon at the cu
98. this option from the More menu 6 1 9 2 Real time traffic information TMC TMC Traffic Message Channel can provide you with the real time status of the traffic Route calculation can avoid road blocks or unexpected traffic jams caused by an accident TMC is a specific application of the FM Radio Data System RDS used for broadcasting real time traffic and weather information Using traffic information is enabled by default in Caliber E Note TMC is not a global service It may not be available in your country or region Ask OS your local dealer for coverage details Caliber RDN573BTcontains the TMC receiver that is needed to receive Traffic events If public Traffic data is broadcast at your location Caliber automatically takes into account the traffic events received You do not need to set anything in the program The receiver will automatically search the FM radio stations for TMC data and the decoded information will immediately be used in route planning When Caliber receives traffic information that may affect your route the program will warn you that it is recalculating the route and navigation will continue with a new route that is optimal considering the most up to date traffic conditions To fine tune this recalculation you can set the minimum delay that can trigger a route recalculation or you can instruct Caliber to have you confirm the new recommended route before it takes effect You can do these in Traffic setting
99. to bypass roads that are restricted for your lorry Do as follows Menu S 1 If you are on the Map screen tap to return to the Navigation menu 2 Inthe Navigation menu tap and then CALIBER RDN 573BT NAVIGATION MANUAL M A m Vl sas Route Settings 3 Tap Bia Vehicle Car Navigation Mode On road Route Planning Method Green un secs f i TE Motorways 40 kn 3 Back Vehicle Tap There is one Default Lorry profile at the end of the list You can either gt e tap the button at the Default Lorry profile or Ya e create a new profile by tapping then and selecting Lorry as the vehicle type 6 The list of vehicle profile parameters appear Scroll the list and tap any of the lines to change the parameters The parameters are intuitive In addition you have the following options Confirm Parameters for Me When enabled the list of vehicle parameters always appears before route calculation This helps you quickly adjust the parameters when some of them the actual weight for instance often change Disable U Turns When selecting lorry as the vehicle type U turns are disabled from routes as much as possible With this button you can even forbid turning back on divided roads Max Speed 80 km h f Confirm Parameters for Each Route Planning f f Done 68 RDN 573BT NAVIGATION MANUAL CALIBER 7 When finished with the vehicle parameters
100. to the next route event manoeuvre n Pause the simulation 64 RDN 573BT NAVIGATION MANUAL CALIBER pi Jump to the previous route event manoeuvre Tap to increase the speed of the simulation to 4 8 or 16 times faster Now tap again to return to the normal speed b Tap Back to stop the simulation 65 CALIBER RDN 573BT NAVIGATION MANUAL M A m Vl 4 Off road navigation When first started Caliber calculates routes using the road network of the high quality vector maps provided with the product You can switch the application to off road mode in Navigation settings in one of the following ways You can switch the application to off road mode in the following way a e From the Main menu tap ae r and then Navigation Mode e From the Map screen tap and then Most of the procedures described for on road navigation also apply to off road navigation However there are some that are not available in this navigation mode for example you cannot open the itinerary as you have no manoeuvres just route points and straight lines between them 4 1 Selecting the destination of the route Selecting the start point or a destination waypoint or final destination is the same as described at on road navigation The only difference is that route points are linked to form a route with straight lines regardless of the road network and traffic regulations 4 2 Navigating in off road mode The r
101. ttings screen This button opens the Traffic Summary screen This button lets you bypass parts of the recommended route This button opens the Trip Monitor screen where you can manage your previously saved trip logs and track logs This button opens the list of manoeuvres the itinerary 22 RDN 573BT NAVIGATION MANUAL My Route Edit Route More Settings Route Settings page 85 More Settings Map Settings page 90 Tap the Current Street field on the Map screen My Route Cancel Route page 55 My Route Overview page 51 More Settings Visual Guidance page 91 Tap the Traffic icon in the Navigation menu or on the Map screen My Route Avoidances More Trip Monitor page 80 Tap the top of the Map screen during navigation HSNON gt D RDN 573BT NAVIGATION MANUAL CALIBER My Route More Save With this function you can save the active route for later Route USE My Route More Load With this function you can replace the active route with a Route previously saved route Find Find Places page With this function you can search for Places of Interest in 34 various different ways My Route More This button opens the Map screen and starts simulating Simulate Navigation the active route Simulate page 64 Navigation Tap the top of the Map screen when there is no GPS reception This button opens the GPS Information screen with satelli
102. vehicle profiles if you tap More Navigation Mode On road navigation creates a turn by turn itinerary using the road network on the map Switch to off road navigation to navigate between destinations in a straight line Broren euee The route calculation can be optimised for different situations and vehicle types by changing the planning method See below for details To let the route fit your needs you can also set which road types are to be considered for or to be excluded from the route if possible Excluding a road type is a preference It does not necessarily mean total prohibition If your destination can only be accessed using some of the excluded road types they will be used but only as much as necessary In this case a warning icon will be shown on the My Route 85 CALIBER RDN 573BT NAVIGATION MANUAL screen and the part of the route not matching your preference will be displayed in a different colour on the map In the list of road types you can see in how many segments and what total length of the road type is used in the current route ke M teruane You might need to avoid motorways when you are driving a slow car or ai i you are towing another vehicle ie Akee Charge roads are pay roads where you can purchase a pass or vignette to use the road for a longer period of time They can be enabled or disabled separately from toll roads m S Perse Tol Caliber includes toll roads pay roads where there is a per use ch
103. verpasses or bridges are displayed in 3D 3D landmarks Landmarks are 3D artistic or block representations of prominent or well known objects 3D buildings 3D block representation of full city building data containing actual building size and position on the map 2 3 3 7 Elements of the active route Caliber shows the route in the following way mm Current GPS position Your current position displayed on the map If roads are and Start point near it is aligned to the nearest road Normally if GPS position is available the route starts from the current position If there is no valid GPS position Caliber uses the last known position as the start point Waypoint intermediate destination An intermediate destination of the route before reaching the final destination Destination end The final destination of the route point Route colour The route always stands out with its colour on the map both in daytime and in night colour mode Streets and roads that You can choose whether you want to use or avoid certain are excluded from the road types page 85 However when Caliber cannot avoid navigation such roads the route will include them and it will show them in a colour that is different from the route colour Streets and roads that Road segments may be affected by traffic events received are affected by traffic These streets and roads are displayed in an alternate events colour a
104. vrennnrnnrrrennnrvnerrennnrvnerrrnnrrnrerennnnssssee 29 3 1 14 Selecting a city town centre as the destination ssnrvorrnnvvvrnnnvvnnnnnnvnrnnnnennnrnnrnnrnnennnenssnnnevesnrsseen 30 3 1 1 5 Entering an address with a postal code sansraunsGaneiendanade base deaaiderdnte 32 3 1 1 6 Tips on entering addresses quickly nseonsnessenneseeesseessssrsesressrrrsseerssrtsserreseersserersrrrseereesereseee 34 3 1 2 Selecting the destination from the Places of Interest u nnannnneermermeunvseidnmdje 34 MAT Quicksearch fora Place of eee 35 3 1 2 2 Searching for a Place of Interest using preset categories rrrrnnnrvvvnnrnnrrvvvrennnvrvvrrenenrrnerrennnrvsere 36 3 1 2 3 Searching for a Place of Interest by category ORRE 38 3 1 2 4 Searching for a Place of Interest by name ooo oonooooeneeennnesennsssseeesssererssssreessssrerssssrrressserresessree 41 3 1 2 5 Selecting nearby assistance from Where APL vasesersmendsasnnusvnndedaknnsnmene 43 3 1 3 Selecting a map location as the destination rrrnnrrvvrrrornrvnvrrrrrrrvrrrerrrrnerrrnrnrnnserernnnnsseenn 45 3 1 4 Selecting the destination from your Favourites rrrrnnnrronnrvnvrrrrnrrvnrrrrnrrnrrrrsrnrnnerrernnnnsseenn 45 CALIBER RDN 573BT NAVIGATION MANUAL M A m Vl 3 1 5 Selecting one of the most likely destinations Smart History eerrernrrnrrrrnrrrrnrrrrrnrnnerrenn 46 3 1 6 Selecting a recent destination from the History srrrnnnrrrnnnvnvrrrrrrrvrrrernrrnr

Download Pdf Manuals

image

Related Search

Related Contents

to - Horner APG  V7 HA201  TurboVUi™ Solo Guía de Instalación y Configuración  03 –Tourisme - FAE-CFM  Februar - catwebonline.de  Samsung SGH-I320 User Manual  ficha técnica - Hiperlimpieza® Venta de productos de limpieza  Notice constructeur  レチナ 100プロセッサー  

Copyright © All rights reserved.
Failed to retrieve file