Home
MS Dynamics NAV Integration - e
Contents
1. amp Product e Con 2012 a Add Environment This wizard adds a new environment to an e Con installation Would you like to Add an environment including a local repository Add an environment without a local repository 9 Add a local repository to an existing environment C Click next to continue Enter a descriptive name for this environment for example nav lt test gt lt cronus gt where lt test gt refers to the purpose of the NAV environment test production development etc and lt cronus gt refers to the name of the company in NAV r t gt Add Environment lola re Environment settings Configure the new environment Hame navtest Datastore navtest MSMO Request navtestreaquest MSMO Response navtestesponse Company name CRONUS International Ltd Select as type Dynamics NAV The following message can pop up General Installation Information Dynamics MAY 28 Click Yes to install this Policy Service Installing the NAV Client Policy Service Click next to start installation ie MAY Policyservices Welcome to the NAY PolicySerices Setup Wizard p The installer will guide you through the steps required to install WAY PolicyServices on your computer WARNING This computer program is protected by copyright law and international treaties Unauthorized duplication or distribution of this program or any portion of it m
2. lt filters gt lt filter field 5 value F lt Tilters gt lt fields gt Hele i i007 Shel id 3 72 lt field id 8 gt lt field id 5 gt lt r fields lt offset start 0 count s gt lt table gt tables lt wmexmlrequest gt It consists of the read action the table and the query in the filters tag The fields tag gives the fields that have to be filled for each result record The XML response file contains the query result Appendix NAS Technical e on SOLUTIONS lt wmxmlresponse gt c lt action gt read lt action gt lt tables gt i lt table id 99000754 gt lt record id 100 gt fields lt field id 1 gt 100 lt field gt lt field id 3 gt Assembly department lt field gt lt field id 8 gt lt field id 5 gt F lt Teld gt lt Tlelds gt lt recard gt record id 300 gt fields lt field id 1 gt 300 lt field gt lt field id 3 gt Painting department field gt lt field id 8 gt lt field id 5 gt F lt feld gt lt Tlalds lt recard gt lt table gt tables status gt ok status gt lt reqtime gt 100 lt regtime gt lt wmxmlresponses The status in this document should always be ok even if an empty set is returned Only erroneous queries can return a failure The reqtime gives the time in milliseconds that was needed to query the database and build the response XML The eCon NAS Handling Form
3. has a function Long Queries This function gives a quick overview of all resoonse query documents with a request time greater or equal than a given value The input XML trace files can be processed interactively by running codeunit 11002524 N043 NAS Metadata Handler or codeunit NO43 NAS Message Handler The process will ask for the XML input file and generate a separate xxx _out xml output file in the same folder The Metadata and Repository request can be checked via the Functions MD Query Overview on the NAS ba ba e State Start Stop Time Stop Queue Name Queue Ti Timer Inte Stopped VM NAV B5IS private navisionrequest4 50 500 Started 27 05 10 14 38 VM NAV 5IS private navisionrequest4 0 0 m ha i Functions v Windows Service Status Test Configuration Restart NAS Long Queries MD Query Overview Appendix NAS Technical 7 5 Troubleshooting the e Con 2012 Navision Integration In general there is one rule that stands above all other rules when initializing the Navision Application Server for e Con 2012 Have Patience Stopping and Starting the NAS as a service and initializing the Queue s might take some time Some error messages that you might get After stopping and starting the NAS Have patience and try it again in one minute e Con Application Servers StartiStop Time Computer Mame Description Microsoft
4. the default settings will work OK General Installation Information e on SOLUTIONS Ka Add Environment Default IIS Use default or custom IIS settings IIS Settings Use default settings 6 Use custom settings Click Next then Finish Now go back to the first tab page in DMI and choose Run tests If any warnings appear where the fix flag is set click the Fix button to have the possible issues resolved Troubleshooting Note if you get a message about the NAV Client Policy Service not running just confirm to start this service Dynamics MAY Note if you get a message about the Navision Web Service not running just confirm to start this service Dynamics MA 3 4 Message Queue On the e Con Server computer the Message Queuing Component should be installed before e Con Server is installed The e Con installation will create two default Messages Queues in the Private Queues navisionresponse4 and navisionrequest4 On computers e g NAS Server or separate MSMQ Server where the e Con Server installation is not performed but the Message Queues are needed they should be created manually See Message Queue Properties Setup chapter for more information Note when DMI is used to create a new NAV environment it also creates two new message queues General Installation Information e Con SOLUTIONS 4 Installation of Navision Integration Start this step after installation of all
5. 2 Adda proper Windows Login and connect a Role to it 3 If needed Synchronize the new login The NAS service must have a Log on account that is known as Windows Login in Navision By default it is set to the Local System account so please change this Startup of NAS from Navision Client eon SOLUTIONS 1 Goto the Services in Configuration of Computer Manage Zh Server Manager File Action View Help e9 2008 6b BA gt 8 n p EN Server Manager VM N soe A gt ge Roles z D Features edie 2 gt a Diagnostics T 5 Application Server for Microsoft Name Description Status Startup Type Log On As E 4 ait Configuration ics NAV Classic VM NAV BIS A gt Task Scheduler i Gh Active Directory Domain Services AD DS Dom Started Automatic Local Syste gt Windows Firewa S Application Experience Processes a Started Automatic Local Syste Gh Services Stop the service G amp Application Host Helper Service Provides ad Started Automatic Local Syste j WMI Control Restart the service S Application Information Facilitates t Manual Local Syste D e Storage G amp Application Layer Gateway Service Provides su Manual Local Service S amp Application Management Processes in Started Manual Local Syste E S6 Application Server for Microsoft Dynamics NAV Classic VM NAV BIS CLASSIC Disabled Network S Applicatio
6. Business Solutions Mavision T This message is For CAL programmers Uninitialized object A Log Directory The call to member ServiceStart Failed MSMOQueue returned the Following message HH gt Start Server Stop Server Starting the NAS could give these 2 warnings in your Event Viewer No service could be started with the Start Up Parameter ECON C073_NAS370 For more information see Help and Support Center at http go microsoft com fwlink events asp And The Navision Application Server C073_NAS370 could not initialize properly The server will attempt to initialize every 30 seconds until this is successful For more information see Help and Support Center at http go microsoft com fwlink events asp Have patience most of the time it will run after 30 seconds if it doesn t then the same warnings will be created a number of times Forgotten to add a Windows login with proper roles to your database Microsoft Business Solutions Navision has not been set up to allow you to use Windows login Contact your system manager For more information see Help and Support Center at http go microsoft com fwlink events asp The Navision Application Server only runs with Windows login Appendix NAS Technical e on SOLUTIONS e Con SOLUTIONS e You might run into trouble running the NAS as a service Normally that has nothing to do with the NAS but could be a res
7. Con environment ssssessessssssrsrrsresrrsrrsrrsrrsrroreorresroseeseoseoseoseeseeserseeseeseesersreseesreseene 32 8 2 New QUCUGS uee E E E 33 8 3 NONWE DIOICA 34 8 4 New Navision Application Server NAS cccccccccsssseccccseessecccseeeseceeseeeeeeceeseeeneceesseegeeeeees 35 Table of Contents 2 e on SOLUTIONS 1 Introduction This document provides a description of the installation procedure for the e Con 2012 integration with the Microsoft Dynamics NAV5 and NAV2009 software The e Con 2012 installation is described in a separate installation manual for e Con 2012 1 1 General Information Read the system requirements before starting installation The e Con 2012 version must be properly installed before the Microsoft Dynamics NAV installation is started When installing on Microsoft Windows Terminal Server the server must be in the Install mode Change the mode manually at the command prompt change user install or run the setup from the control panel Add Remove Programs This installation manual assumes that the DMI tool is installed as well Please refer to the Installation Manual DMI and Service Packs User manual Introduction 3 e on SOLUTIONS 2 Installation Scenarios This chapter describes the most common installation scenarios 2 1 Schematic view of complex scenario Terminal server Citrix e Con Studio Navision client Navision client NET runtime E 6 0 or
8. document describes some technical issues concerning the e Con 2012 and Navision Application Server NAS integration As a prerequisite the NAS should be installed properly on your system as described in the e Con 2012 installation manual or the NAS installation document that can be found on your Navision Attain installation CD Furthermore the reader should have some basic knowledge of the Navision Attain programming environment and the MS Windows operating system 7 2 Description of the NAS 7 2 1 General The Navision Application Server acts as a faceless client It connects to a predefined database server ina predefined company and runs a predefined function id 99 in a predefined codeunit codeunit 1 Any functionality can be triggered as long as it is programmed by a developer and no user interaction is needed The NAS Startup Parameter allows you to run different parts of code e g by means of a CASE statement Normally the NAS is used to run one or more single instance codeunits These codeunits remain in memory and can be triggered by events e g an incoming messages or via a timer interval This way the NAS can perform different tasks Running as a service the NAS can be stopped as long as no other tasks are being performed 7 2 2 For e Con 2012 The architecture overview of the e Con 2012 NAS integration looks like this eCon Engine CodeUnit 1 C N O i eConAttain V f NAO CodeUnit library e Con Th
9. e on SOLUTIONS MS Dynamics NAV Integration INSTALLATION MANUAL e Con 2012 1 12 2011 Deliver excellence with ease To Increase BV TO INCREASE COM ECONSOLUTIONS e on SOLUTIONS Document Information Title MS Dynamics NAV Integration Subject e Con 2012 Version 1 0 Status Final Solution Product e Con Category Installation Manual Author Marijn van Poelje Copyright To Increase e Con Solutions All rights reserved The information in this document is subject to change without notice No part of this document may be reproduced stored or transmitted in any form or by any means electronic or mechanical for any purpose without the express written permission of To Increase e Con Solutions B V To Increase e Con Solutions B V assumes no liability for any damages incurred directly or indirectly from any errors omissions or discrepancies between the software and the information contained in this document Document Information il e on SOLUTIONS Table of Contents ES UST OV CIO UM ear E R entaet 1 TOEO INE een eee ene oe ee E ee ee re ee 2 E MIAH CUM I Vs orye oxtereip ce veiw EEE NE eee eran eeonrer TE 3 1 1 General iniormatiOn cccdesaPaceacidnncososntndesssatocedonatydvaeddemssnpetedencedsevacwaalaewune EEE 3 A WAS TAN ALIOM S CERIOS renn E 4 2 1 Schematic view of complex scenario cccceseccccessccccaseccceesececceecccesesecessusececsuneceeseneceetegeeeees 4 2 2 Navision Server amp e Con Server
10. on different computers The e Con data amp NAS amp MSMQ Server on e Con Server No Citrix sssesssssssssrssrsrrsrrssrsrrsresrrssessessesseesesseoseoseeseeseeseeseeserseeseeseeereee 6 2 3 Navision Server amp e Con Server amp e Con data amp NAS amp MSMQ Server on the same computer No CIU K eenskesnir iT E E 7 2 4 Navision Server amp e Con Server amp Citrix on different computers The e Con data amp NAS amp MSMO Server on e Con Servel i creaccesesinwecnenacsenioctniiniareasnitesanwtarareaienssbaruvareuddends AEAEE aE 8 3 General Installation Information eessesssesessesesrenserrereserrsssrerssrrerssreresererssreresererssreressrerssrereserereseeree 9 3 1 INAV ONC OWN GN aE E E E TEEN T EEN 9 3 2 Typical installation order of components essssssssesesresesrresssreresrrererreresereessreresererssrereserereseeree 9 3 3 Use DMI to create an initial e Con environment for NAV cccccssseccccessececeesececeeeceeeeeeeees 9 3 4 Messag QU CUS cect cece sete ceceeees eoesedac cavemen pounesursiedunbaenressies cessed E EEE 13 Installation of Navision Integration cecccccssseccccssececcenscccceesececseececcueceeseusecesseecesseeceeteneeeens 14 5 Setup Message Queue Properties ccccsccsecceccsecceccsececcsecucesececeseceuceseeeuceseeeeceseeeeceseseeeeseeeees 18 5 1 1 Permissions Windows 2003 or XP sssssssseesessreersessrrrressrrereessrrrressrrrresserrrresssrereeseeees 18 5 1 2 Permissions Windows 2
11. original web folder Sp Server Manager File Action View Help AAEH EA Server Manager VM NAV BIS x Roles i Active Directory Domain i Bi DNS Server gt FEI File Services gt Ty Terminal Services a GS Web Server I5 Wh Internet Information 4 a VM N ge administrator J Featu A Aomen roon ASI 4 aj Features ogy Applica gt EF Message Queuing a a Sites b l amp i Group Policy Manageme 4 Default Web Sne gt Diagnostics p E aspnet_client 1 o ee Corr a ait Configuration EF econs gt m Task Scheduler p B econadmin4 b P Windows Firewall with A gt EP MSMQ ca Services gt MTB elon4 Test Macl aT WMI Control p Storage IE Auth Note It is also best practice to add a new Application pool for the new default web site How to create a new e Con environment e Con SOLUTIONS Next steps e Open the e Con settings by clicking the Edit environment button in the e Con Setup e Change the following settings in there Output settings Output folder C Program Files e Con Solutions e Con 2012 WebTest Output UI settings Label URL C Program Files e Con Solutions e Con 2012 WebTest Labels xml Data settings e Con folder C Program Files e Con Solutions e Con 2012 WebTest Data settings e Con bin folder C Program Files e Con Solutions e Con 2012 WebTest bin Data settings e Con URL http localhost econ4Test e Save t
12. server is flagged as Run On Client then codeunit e Con NAS Message Receiver will be running in the Navision client process If the Queue timeout is set to a relatively small amount of time e g 50 ms then the client can also be used for other processing Be aware that it will not be possible to save and process a configuration on a client acting as an application server But it is possible to do any other action via the e Con Studio 7 4 Additional Features 7 4 1 Test NAS Configuration The eCon NAS Handling Form has a function Test Configuration This function checks whether a NAS with status is Started can be reached or not The replies can be Reading ok Not responding or Missing request Other NAS is reading the same queue a E3 NO43 Application Servers gt le sz e Con NAS R Description State Start Stop Time Stop Queue Name Queue Ti Timer Inte CLIENT NAS running on dient Stopped VM NAV 5IS private navisionrequest4 50 500 gt VM NAV BIS SOL The NAS for ECon 4 1 Started 27 05 10 14 24 VM NAV BIS private navisionrequest4 0 0 gt VM NAV BIS SQL 7 4 2 Request Response Logging The e Con 2012 requests and responses for the NAS are represented as XML documents placed in the body of the messages in the Message Queue Via the eCon NAS Handling form these XML documents can be saved in a folder for debug purposes Before the NAS or client is star
13. the Navision components Navision Server Client and NAS The Navision database should be started with the Navision Server Service Before you can use e Con integrated with Navision you need to import the Navision e Con objects into your database e g a customer test database The W1 US and NL objects for the 2012 releases and the Windows help files are available on the e Con Product CD in the Navision Integration subfolder Before we describe the import process of the FOBs we would like to explain the different type of FOBs we distinguish Solution Center FOB N108 e g N108 NAVW16 00 10 R 1101 OBJECTS fob this FOB contains the basis application for a certain major release Most of these objects are ina reserved add on range and can be imported or replaced Codeunit 1 contains the integration for the Platform NAS handler This object can only be replaced if the version is equal The e Con FOB NO43 e g 1101W16 00 01N043 this FOB contains the e Con application You can always import these objects in any database without affecting any other existing objects All objects are in a reserved add on range The FOB also contains the Connector objects objects with Name starting with Conn Codeunits 11002550 and 11002565 might contain customer specific code These objects must only be replaced if the NAV version is NAV2009 So please skip them when the NAV environment is a technical upgrade only to NAV2009 and the database is still NAV
14. 008 or WINGOWS7 eesssssessseesessssereessrrreessrrrreeserrrreesrrereeseeeee 19 5 1 3 BOST ETIC UCE Ser N 20 Startup of NAS from Navision Client sseesseessesresersnssrreerrrsrrrsrersrtesrrrertrsstrrsrresrtesstenserrsreesereeeeees 21 lt Appendix NAS TechNiCa cssssessiiessaniosinssucossissdmestunnecsies e 25 l PVE TIC CIO g AREE EET EA PE EEA A EE AE E E OAA E O E O 25 7 2 DSS CID iono r Ne N A a E anteannaeenrseuteas 25 7 2 1 EE A E EE E E A A T A AE E E A 25 7 2 2 FOr Ee CONO e e E E A E E E te nomnceaiowteeeomuaisioete 25 7 3 Get the e Con 2012 Navision Integration tO WOfK seessssssssrssersrserresrressrrerresrressrreereesrereeeens 25 7 3 1 Sarete NAS SENICE orena ene ee ee ee 25 7 3 2 SOP MENAS SEINIO erran ratentoapanseua net seuctoneersc pad esdeeoandensise tent asaecesosarwclGarataesren 27 7 3 3 Navision Integration Via a normal client c cc ceeccceeeccceeseceeseceeesseeeeceeeueseteneeseeeeeegess 27 7 4 POEM elt FEE e seticonsagatanssacaacsnanatdeuiok autusener ontautei ees snerendents ae ueane casanteeeatncuseds 27 7 4 1 Test NAS COMI UA IO Neeser E Ta 27 7 4 2 Request Response Logging ssesssssessseesssrrerrrssssssrttrrreessssrttrreessssrttrreesssrsttrreessseseerne 27 7 5 Troubleshooting the e Con 2012 Navision Integration sssssssssssrseserrssrresrrresrrerrrssereerereeee 30 8 How to create a new e Con environment ssssssessessessessessessesseesesseeseeseesreseesersersrrsrrsrrserssreeees 32 8 1 New e
15. 4 or NAV5 Execute the following steps to get import the objects and to test the installation Installation of Navision Integration 1 Copy the chm and hh help file in your Navision Client language subfolder 2 Open the database 3 Make a backup copy of the Navision Database 4 Start the Object Designer Shift F12 5 Import the Navision Object Files for e Con Menu File Import 6 Import the Solution Center FOB Replace all objects in the 11000000 range merge or replace codeunit 1 Note When installing N108 1101 or N108 1102 to replace the N108 1002 or previous versions the following objects should be deleted All N108 objects with filter N108 Test in the Name and Forms 11068698 and 11068699 This is according to the Solution Center installation documentation 7 Import the NO43 FOB All objects are in the 11000000 range Note Skip the Connector codeunits Conn In the Name and Codeunits 11002550 and 1102565 when database version is not NAV2009 8 Re open the Navision Main Menu 9 Registration and initialization of the installed components N108 and N043 e on SOLUTIONS 9 1 Open the Business Integration Solutions Menu and go to Product Registration Product Registration 9 2 Run Register All via the Functions button 9 3 Select the line for the Solution Center available in the Solution Center group and run Activate 9 4 Selec
16. IONS Go to e Con Setup to e Con NAS Handling al CROWNUS International Ltd Microsoft Dynamics NAV Classic File Edit View Tools Window Help 2A AOG Bx gt E f Generic Models E Configure E Offline Configurations E Decision Matrices Pro cei Reports d Setup m E e Con Setup E3 e Con NAS Handling E External Users H E Modelling H 0 Repository if Fill in the proper e Con NAS name select the Queue name and push the Start Server button The state should be changed from Starting to Started E5 NO43 Application Servers L A VM NAV BIS SQL e NAS for ECon 4 Stopped 27 05 10 14 23 VM NAV BIS private navisionrequest4 e Con NAS R Description State Start Stop Time NO43 Application Servers oS el es Start Stop Time Stop Queue Name 27 05 10 14 23 VM NAV BIS private navisionrequest4 Startup of NAS from Navision Client SOLUTIONS NO43 Application Servers ore t be fea Ra Description State Start Stop Time Started 27 05 10 14 24 __ Con NAS Stop Queue Name gt VM NAW BIS SQL VM NAV 815 private navisionrequest4 ul Start Server Server Functions w Startup of NAS from Navision Client e on SOLUTIONS 7 Appendix NAS Technical 7 1 Introduction This
17. NS15 O902WL61N515 O02 L61N515 M515_031 Os02Wl61NS15 O02 L61NS15 O02 L61NS15 O02 161N515 os02W161N515 1002 161N106 1002 161N106 m Register All Activate Ctrl F11 Deactivate shit Ctrl F11 Export Generate Con Ga CRONUS International Ltd Microsoft Dynamics NAV Classic re ene File Edit View Tools Window Help su XODI BX BEBSBY 0000 0882 M e Do you want to generate metadata a Generate Metadata NAVDEMO admini 28 01 10 Note if you get a question to enter a file name when you execute step 10 1 please go to the option to alter the database go to tab Options and select Enable for Microsoft Dynamics NAV Server 11 Change the default environment settings for NAV 11 1 Open the e Con Menu and go to Set up e Con Setup 11 2 Open the General Tab Description of the fields in the General tab of the e Con Server Setup window Fields on General tab e Con Server The name of the e Con Server Normally this is the computer name of the e Con Server The name of the environment used by e Con during configuration Installation of Navision Integration e on SOLUTIONS Environment with all the e Con specific setup information It can be accessed by Functions Edit Environment See the Setup document about this 11 3 Change the value for e Con server into the e Con server name 11 4 Change the value fo
18. Navision Client available Preferred X X NAS available X IIS available X e Con data folder X MSMQ component installed and X setup NET runtime 4 available X X IE 6 0 or higher available X X X Import e Con objects Register and 2 2 2 Initialize 1 Optional installation of Navision client and e Con modeler for testing purposes 2 Import can be done from every Navision client if available and if access to e Con Server directory is allowed 3 Installed together with e Con Server Installation Scenarios 7 e Con SOLUTIONS 2 4 Navision Server amp e Con Server amp Citrix on different computers The e Con data amp NAS amp MSMQ Server on e Con Server Navision Server e Con Server amp e Con Terminal data amp NAS amp MSMQ Server Citrix Server e Con Server installation X e Con XML license stored in e Con X server Web folder e Con Studio installation Optional 1 3 X Navision Server available X Navision License stored in X Navision Server folder Navision Client available Optional 1 Preferred X NAS available X IIS available X e Con data folder X MSMQ component installed and X setup NET runtime 4 available X X IE 6 0 or higher available X X Import e Con objects Register and 2 2 2 Initialize 1 Optional installation of Navision client and e Con modeler for testing purposes 2 Import can be done from every Navision client if available and if access to e Con Server directory i
19. ay result in severe civil or criminal penalties and vill be prosecuted to the maximum estent possible under the law Es NAY PolicyServices Lo a E Select Installation Folder m Ng The installer will install MAY PolicyServices to the following folder To install in this folder click West To install to a different folder enter it below or click Browse Folder C Program Files Con Solutions Way PolicySernvices Install MAY PolicyServices for yourself or for anyone who uses this computer Everyone i Just me Click next to confirm General Installation Information e on SOLUTIONS eon SOLUTIONS ie NAV Policyservices Contirm Installation The installer i ready to install NAWY PolicyServices on your computer Click Next to start the installation During installation the installer is asking for a username a local account and password This user will be assigned to the service and will run the service set Service Login Username Password Confirm password Finally click close to exit the installer and to return to DMI ae NAY Policyservices Installation Complete NAY PolicyServices has been successfully installed Click Close to exit Please use Windows Update to check for any critical updates to the MET Framework Cancel Back Also enter the exact name of the NAV company and click Next Enter IIS settings In general
20. e privateS navision uniqueid response4 General connection new driver Navision server localhost requestqueue VPC ECON4 AX4 privateS navisionrequest4test responsequeue privateS navision uniqueid response4t est How to create a new e Con environment e Con SOLUTIONS e Save the settings 8 3 New web folder Windows Server 2003 To avoid that building of a model in one environment will interrupt the other environment a separate NetASP application domain must be created as well This can be done by duplicating the e Con web folder and share e Copy the e Con web folder and give it a new name e g eConTest The e Con web folder is by default C Program Files e Con Solutions e Con 2012 Web e Create a web share for this folder and give it a new name e g eCon4Test Make sure that the security and permissions are according the original web folder Windows Server 2008 To avoid that building of a model in one environment will interrupt the other environment a separate NetASP application domain must be created as well This can be done by duplicating the e Con web folder and share e Copy the e Con web folder and give it a new name e g eConTest The e Con web folder is by default C Program Files e Con Solutions e Con 2012 Web e Adda default website via Add application on Default Web Site for this folder and give ita new name e g eCon4Test Make sure that the security and permissions are according the
21. e Con SOLUTIONS 5 Setup Message Queue Properties 5 1 1 Permissions Windows 2003 or XP During the e Con installation two Message Queues are created to be used by the NAS The permissions for these two Message Queues must be set Note when an environment is created using DMI the security settings are created in a correct way The description below is then only for reference purposes 1 Goto Computer Management O Computer Management m Fie Action View Window Help m wi e ne System Tools Event viewer S Storage fb Shared Folders i Local Users and Groups rE Performance Logs and Alerts HES Services and Applications Device Manager Si Storage fF Removable Storage Disk Defragmenter Disk Management Ne Services and Applications 2 Select Services and Applications Message Queuing Private Queues and go to the properties of navisionrequest4 navisionreguest Properties General Multicast Security Group or User Hames iG ANONYMOUS LOGON f Anan Kremer akrementtoqus com fi E vervone EEI Pre Windowes 2000 Compatible Access CUS5 Pre Windowes 2000 Pemissions for Everjone Allow Deny Full Control Delete Recernve Message Peek Message Receive Journal Message lt E s E Es s Get Properties For special permissions or for advanced settings click Advanced Setup Message Queue Properties e on SOLUTIONS y
22. e Con Server on different computers The e Con data amp NAS amp MSMQ Server on e Con Server No Citrix Navision e Con Server amp e Client PC Client PC Server Con data amp NAS amp modeler configure MSMQ Server e Con Server installation X e Con XML license stored in X e Con server Web folder e Con Studio installation Optional 1 3 X Navision Server available X Navision License stored in X Navision Server folder Navision Client available Optional 1 Preferred X X NAS available X IIS available X e Con data folder X MSMQ component installed X and setup NET runtime 4 available X X IE 6 0 or higher available X X X Import e Con objects 2 2 2 2 Register and Initialize 1 Optional installation of Navision client and e Con modeler for testing purposes 2 Import can be done from every Navision client if available and if access to e Con Server directory is allowed 3 Installed together with e Con Server Installation Scenarios 6 e on SOLUTIONS 2 3 Navision Server amp e Con Server amp e Con data amp NAS amp MSMQ Server on the Same computer No Citrix Navision Server amp e Con Server Client PC Client PC amp e Con data amp NAS amp MSMQ_ modeler configure Server e Con Server installation X e Con XML license stored in e Con X server Web folder e Con Studio installation 3 X Navision Server available X Navision License stored in Navision X Server folder
23. e NAS runs codeunit 1 and via an ECON parameter the codeunit e Con NAS Message Receiver is called This is also a single instance codeunit the program runs in a cycle waits for the next MSMQ message to arrive The Queue timeout can be changed manually After the queue timeout the codeunit is activated again by a running timer The NAS runs dedicated for e Con and no other external components are needed to react on the MSMQ events this makes installation and maintenance easier Since we don t use external components we can also use any normal Navision client to run the e Con NAS Message Receiver codeunit 7 3 Get the e Con 2012 Navision Integration to work 7 3 1 Start the NAS service The NAS installation also installs a small component on your client the nascontrol 1 0 Type Library This control is used to start stop a NAS service from within Navision Run form eCon NAS Handling from the e Con Menu Setup in Navision to initialize the NAS service Appendix NAS Technical e on N043 Application Servers o E e Con NAS R Description State Start Stop Time Stop Queue Name Queue Ti Timer Inte gt CLIENT NAS running on dient Stopped 50 500 VM NAV BIS SOQL The NAS for ECon 4 1 Started 27 05 10 14 24 VM NAV 5IS private navisionrequest4 0 0 Po 4 mW p Fill in a record with the NAS name as defined in the installation Button lt Start Se
24. he creation of a new environment exists of steps 1 Make a new e Con environment with his own datastore 2 Add new queues 3 Make a new e Con web folder 4 Install a new Navision Application Server In the next part these steps will be described more in detail 8 1 New e Con environment To create a new e Con environment the next steps must be performed e Open the e Con Setup window in the MS Dynamics NAV Main Menu click e Con Setup e Con setup e Enter the new name for the environment in the environment field e g test e Con Setup e Open the new environment by choosing the Edit environment function from the Functions button e Select the Data store setting and enter a new data store in here e g test as well How to create a new e Con environment e on SOLUTIONS E Option screen Windows Internet Explorer wIk A http localhost econadmin4 default aspx environment test w dk Option screen Environment test Lal Path datastore 4 test Name Data Settings Data folder C Program Files To Increase e Con 4 2 Data Label Data store test Description e Con bin folder C Program Files To Increase e Con 4 2 Web bin Type e Con folder C Program Files To Increase e Con 4 2 Web Value test e Con page eConEngineHtml aspx e Con Studio C Program Files To Increase e Con 4 2 Web e Con URL http localhost econ4 E mail Settings Engine Settings L
25. he settings and exit them e Generate the models 8 4 New Navision Application Server NAS Since the Navision Application Server is running dedicated for one environment a new Navision Application Server must be installed as well e Install a new Navision Application Server Read chapter 7 for more details about this topic e Goto the e Con NAS Handling form in NAV can be found in e Con setup e Con NAS Handling e Select the right queue for the Queue name setting Use the dropdown to select this queue How to create a new e Con environment
26. higher E 6 0 or higher e Con Studio for modeler clients e Con data folders IS e Con server e Con XML license MSMO ien a Navision client n preferred MSMQ server Navision client NET 3 5 sp1 MSMQ server IE 6 0 or higher Navision license e Con Studio optional NAS MSMQ client Installation Scenarios 4 e on EM Ciel a Terminal Client PC Server Server modeler Citrix and or configure e Con Server X installation e Con XML license X stored in e Con server Web folder e Con Studio Optional 3 X 4 installation 1 Navision Server X available Navision License X stored in Navision Server folder Navision Client Optional Preferred X X available 1 NAS available X IIS available X e Con data folder X MSMQ component X X X installed and setup NET runtime 4 X 4 available IE 6 0 or higher X X available Import e Con objects 2 2 2 2 Register and Initialize 1 Optional installation of Navision client and e Con modeler for testing purposes 2 Import can be done from every Navision client if available and if access to e Con Server directory is allowed 3 Installed together with e Con Server 4 Just for modeler client PC s Based on this scenario a couple of other scenarios with combined servers can be extracted The most common scenarios are explained Installation Scenarios 5 e on SOLUTIONS 2 2 Navision Server amp
27. icense Settings Output Settings Processing e Con processing page eConBackendProcessing aspx Role customer SmartClient Settings Studio Settings UI Settings e Save the changes by clicking the Save button on top and close the e Con settings form e Return to the e Con Set up in NAV and perform the Create folder Structure option from the Functions button to create the required folders in a new data store folder test 8 2 New Queues To make sure that messages data requests from one environment doesn t mix up with messages from another it s required to set up individual queues for every environment During the e Con installation the following queues are already created e Navisionpost4 e Navisionrequest4 e Navisionresponse4 For the new environment other queues has to be added e Add minimal 2 new queues the response and request queue Use names like Navisionrequest4test Navisionresponse4test Read chapter 5 for more information about settings up queues e Open the e Con settings by clicking the Edit environment button in the e Con Setup e Change the following settings according to the new queue names o In Data settings the General connection o In Data settings MS Dynamics the MS Dynamics connection Examples General connection old driver Navision server localhost requestqueue VPC ECON4 AX4 privateS navisionrequest4 responsequeu
28. n Server for Microsoft Dynamics NAV Classic VM NAV BIS SQL Started Automatic navdemo S Application Server for Microsoft Dynamics NAV NASSQL ECON Disabled Local Syste Sh ASP NET State Service Provides su Manual Network S Background Intelligent Transfer Service Transfers fil Started Automatic D Local Syste SA Base Filtering Engine The Base Fil Started Automatic Local Service G6 Certificate Propagation Propagates Started Manual Local Syste ve CNG Key Isolation The CNG ke Manual Local Syste S COM Event System Supports Sy Started Automatic Local Service Si COM System Application Manages th Manual Local Syste 2 Go to the Properties of the service and change on the Log on tab the Log on as to an account that is available as Windows Login with proper roles in Navision Application Server for Microsoft Dynamics NAV Classic VM NAV BI meen Log on as 6 Local System account Allow service to interact with desktop This account navdemo administrator Password PEPPE Contin password TTTITITT TTT Help me configure user account log on options You can enable or disable this service for the hardware profiles listed below Troubleshooting using hardware profiles Enable 3 Apply this setting and leave the services To start the NAS start the Navision client Startup of NAS from Navision Client 1 2 r e on SOLUT
29. ntrol Delete Receive Message Peek Message Receive Joumal Message SIE SSS For special pemissions or advanced settings click Advanced Leam about access control and pennissions yy Mt 3 Give inthe tab Security to everyone Full Contro and Apply 4 Do the same for navisionresponse4 5 1 3 Best Practice If the e Con Server and the NAS are running on different systems then the read queue should always be on the local system while the send queue should be on the remote system that is the navisionrequest4 queue on the system where the NAS is running the navisionresponse4 queue on the system where the e Con server is running This way you will gain a better performance and it will be possible to use a send queue over HTTP e g through a firewall Setup Message Queue Properties e on SOLUTIONS 6 Startup of NAS from Navision Client The NAS will use Windows Logon from Navision First a Windows Logon must be created if not available yy lt 1 Goto Tools Security Windows Logins Crosc Sy File Edit View Tools Window 2 oe 2B Ww 0800 Object Designer Shift Fl2 Designer Ctrl F2 Navigation Pane Designer Alt F12 Manage Style Sheets Debugger Clent Monitor oom Ctrl Fa amp Backup Restore Security Roles License Information Database Logins Windows Logins Synchronize Single Login Synchronize All Logins Password
30. r e Con environment into the name used in 3 3 11 5 You can now check that the input is correct Open the default e Con environment via Functions Edit Environment 11 6 When done the first time on the server or a client PC Microsoft Silverlight will be installed This is a client application that will be used to show the environment settings E Option screen Windows Internet Explorer jf J http localhost econadmin4 default aspx environment default wr Ps P woe e Option screen l gt Install w W Microsoft Silverlight 11 7 After installation re open the default e Con environment via Functions Edit Environment just to check the settings 12 Import and generation of the metadata groups 12 1 Open the e Con Menu and go to Periodic Activities Import Export Metadata 12 2 Table Group 12 3 Open the Options tab 12 4 Browse and select the file eConMetadataGroups This file can be found on the e Con product CD in the Integration folder 12 5 Select Import and click OK to start the import 12 6 The result can be tested by opening the e Con studio The Product Configuration Sales and CRM configuration and Service configuration groups should be shown up in the tool box Sales and CRM configuration Service configuration a Installation of Navision Integration
31. rver gt changes the state to Starting initializes the NAS parameters and tries to start the NAS service After the NAS has been properly started the NAS will change the state to Started and will update the Start Stop Time Starting a NAS service is a rather time consuming process therefore a progress bar is displayed for 1 minute while the startup proceeds Every 5 seconds it will check whether the NAS was able to change the state to Started or not After one minute the programs will advise to check the Windows Event Viewer a shortcut is located under the Functions button The Windows Service Status also located under the Functions button can be used to retrieve the current status of your NAS service in the Windows OS environment Be aware the Windows status can be Started while the form still states Starting This means that although the NAS service is running properly it is not able to initialize the Navision Attain environment in a proper way Please check the event viewer for additional information The Application Server Manager for Microsoft Dynamics NAV that can be located via de Administrative Tools can also be used to view the status of your NAS service Your NAS has to be added to the Console Root in the tree control on the left hand side All variables Server Company Name Start Up Parameter Value Net Type and Object Cache Size are initialized from within Navision Attain After the NAS ser
32. s allowed 3 Installed together with e Con Server Installation Scenarios g on SOLUTIONS 3 General Installation Information 3 1 Navision components See Navision installation CD for detailed information about installation of Navision Server Navision Client and NAS installation The e Con installation both Server and Modeler will not check on the availability of Navision components 3 2 Typical installation order of components 1 Navision components Server Client s and NAS installation check on Navision license 2 Copy the chm and hh help file in your Navision Client language subfolder 3 Import of Navision integration objects in Navision database 4 Register and Initialize the components 5 Startup of NAS from a Navision client 6 Test with demo models 3 3 Use DMI to create an initial e Con environment for NAV After installing e Con 2012 two initial environments are created called Studio and Default Best practice is to leave these two environments alone Therefore a new environment must be created that can be integrated with NAV To do this start DMI Make sure you select e Con 2012 version and go to the Tab called Maintenance Here press the Ad button at the bottom of the screen Please select Add an environment without a local repository and click Next General Installation Information 9 e on SOLUTIONS i e Con 2012 Diagnostics and Maintenance of Installations 1 1 007 co
33. t the line for the NO43 e Con component available in the General group and run Activate Note the data in your form may differ from the picture below depending on installed components Product Registration E Description General H NO43 e Lon Component Unit Test Studio Ni11 Connectivity Component M111 SQ L Direck Component Nile Webservice Component M113 Data Collection Component M114 MS Project Int Component Notification Management Electronic Invoicing Component Ni26 Doc Exchange Component Replication Management M133 MAY lt gt CRM Component Solution Center Solution Center 4H Workflow Studio Type Code Solution Product Midge US Product Mili Product M111 SOLD Product Hiliz Product H113 Product Mii Product Mii Product N116 E Product Mize Product M130 Product Miss Solution M108 Product M108 Product MIDS wS 10 Creation of the Metadata 10 1 Open the Business Integration Solutions Menu and go to Metadata Status Active Active Metadata After Yes the metadata will be created 10 2 Via the Metadata Installation of Navision Integration Date 27 04 10 11 05 10 12 11 09 12 11 09 12 11 09 12 11 09 05 12 08 12 11 09 12 11 09 12 11 09 12 11 09 12 11 09 26 11 10 15 11 10 Table Relations the results can be checked Version LO01Wle1N043 LO01 Wie iNio8 Os02W161N515 O02 L61
34. ted field XML Input Output Logging should be flagged on and existing folder must be entered in field Log Directory After running a certain model the folder might look like this Appendix NAS Technical e Con SOLUTIONS Mame Size Type 1 WMEMLREQUESTOM_ In xml 1KB sML Document 1_WMEMLREQUESTOM Cut xml 1KB XML Document z2 WMEMLREQUEST_In xml 1 EE ML Document 2 WMEMLREQUEST_Ouk xml ZKE XML Document 3 WMEMLREQUEST_In xml 1 EE ML Document Fey 3 WMEMLREQUEST Ou xml I KE ML Document 4 WMEMLFEUNCTION In ml 1KB XML Document 4 WMEMLFEUNCTION Out xml 1KB XML Document 5 WMEMLREGQUEST_In xml 1 EE ML Document 5 WMEMLREQUEST Out xml SKB XML Document 6 WMEMLREQUEST_In xml LEB ML Document 6 WMEMLREQUEST Out xml SKB ML Document 7 WMSMLREQUEST In ml LEB ML Document 7 WMEMLREQUEST_Ouk xml 1KB XML Document There are five types of XML requests responses XML requests responses WMXMLREQUEST Normal database access GetValue FillOptions etc WMXMLREQUESTDM Decision Matrix Requests WMXMLFUNCTION Special User Defined Functions GetFirstFreeNo TIMDREQUEST Metadata request for e Con studio TIREPREQUEST Repository request for models and configurations The XML request file as a result of an e Con GetOptions rule could look like lt eml version LOS gt lt cwmrxmlrequest gt lt action gt read lt action gt lt filoptions thue lt Tlloptions gt lt tables gt lt table id 99000754 gt
35. ult of your system configuration e g insufficient authorizations In such a case you could first try to run the NAS from a DOS command box The command line arguments are described in document Installation amp System Management Microsoft Business Solutions Navision Application Server that can be found on the Navision Attain installation CD os C WINDOWS system32 cmd exe n of x G Program Files5Havisions ttains NASIYA C Program Files NavisionAttain NASd7ASnas appservername GH73_MAS3S7H servernam e ECONS 76 company e Gon 3 1 Development nettype tcp startupparameter ECON CH73_HNAS3 7H Date 28 09 64 9 26 32 9 28 32 Mavision Application Server version 3 780 Build 13164 97 28 34 Copyright tc 1987 2683 Microsoft Business Solutions Aps 9 28 92 Appendix NAS Technical on SOLUTIONS 8 How to create a new e Con environment IMPORTANT NOTE Using the DMI tool might be useful to create the different environments DMI will create the different environments with e Con webfolders settings and message queues Not created by DMI are the NAV companies and NASses Below is a description of the manual creation of a new environment Normally there are three different e Con environments production test and develop After installing e Con there is one environment available the so called default environment This section describes how to create other environments Basically t
36. vice has been initialized and is started the Application Service Manager might look like this 5 NASMSnapln Console Root Application Server for Microsoft Dynamics NAV Manager VM NAV BIS SQL im File Action View Favorites Window Help amp x e AG EG amp Console Root 4 ji Application Server for Microsoft Dynamics NAV Manac 4g VM NAV BIS SQL A Microsoft Dynamics Nav 2009 Database Server Name VM NAV BIS Database Demo Database nav 6 0 Company Name CRONUS International Ltd Start Up Parameter ECONVMNAVSISS Net Type TCP IP Sockets Object Cache Size KB 5000 Service Status Started Start Service Stop Service Apply these settings Refresh Status Appendix NAS Technical e on SOLUTIONS 7 3 2 Stop the NAS service The Stop indicator in the eCon NAS Handling form will stop the Application Server after all processing has been done and a timeout of Queue Timeout milliseconds The Stop Server button in the eCon NAS Handling form will also sent a special high priority STOPNAS message to the NAS via the Message Queue to force a NAS shutdown as soon as possible The NAS will stop processing and the normal Stop Service command will be executed to stop the NAS service On stopping the NAS will change the state to Stopped and will update the Start Stop Time 13 2 Navision Integration via a normal client If an Application
37. y Mt 3 Give inthe tab Security to everyone Full Contro and Apply 4 Do the same for navisionresponse4 5 1 2 Permissions Windows 2008 or Windows7 During the e Con installation two Message Queues are created to be used by the NAS The permissions for these two Message Queues must be set 1 Goto Computer Manage EA Server Manager File Action View Help E B Ea Server Manager VM NAV BIS EEEE E boy gt a Roles a Features t E Message Queuing gt l Group Policy Manageme b z Diagnostics gt it Configuration Server Summary E Storage Get an overview of the status of this Computer Information Full Computer Name VV Domain NA Local Area Connection No Local Area Connection 2 IP Remote Desktop Enz Product ID 55C Setup Message Queue Properties e Con SOLUTIONS 2 Select Features Message Queuing Private Queues and go to the properties of navisionrequest4 EA Server Manager File Action View Help e Alri Xo abl Bie Sy Server Manager VM NAV BIS gt 2 Roles a Features 4 E Message Queuing t A Outgoing Queues a Private Queues gt 8y navisionrequestd gt 87 navisionresponsed t System Queues t l Group Policy Management b om Diagnostics VM NAV BISS NAVDEMO WM NAV BISS gt i Configuration 82 ANONYMOUS LOGON gt a Storage Pennissions for Everyone Full Co
Download Pdf Manuals
Related Search
Related Contents
handleiding Editorial 58.pmd - Industrial Robotics LAB Targus Slim Wave Case christmas lights - CPC Maytag DFC1500 User's Manual "取扱説明書" Symantec Endpoint Protection 11.0 Media Pack 0527 Avaya 5698TFD-PWR Copyright © All rights reserved.
Failed to retrieve file