Home

General Information

Contents

1. Close Clicking Mark Symbol hides all dialog boxes allowing you to mark a symbol structure with its text if it will be assigned to the symbol block later in the drawing using a selection window 230 Section 13 Symbol Search Replacement V 6 7 E Create V 6 7 E 7 sottelec E VPraster pro VPraster VPraster LT Several symbol structures can be marked in succession These are later used to generate the prototype thus expanding the tolerance range When a symbol is marked the Number of Structures is incremented by 1 When making a selection the window should completely enclose the symbol and a short length of any diverging lines should be included Text selected along with the symbol serve only to identify the location of the attribute text in the drawing in the case of exchange blocks with attributes This location need not be identical to its location in the exchange block The geometry of each marked symbol structure is displayed in the graphical window If no text strings have been selected but the exchange block does have attributes the drawing is searched for text at the relevant attribute locations in the exchange block If text strings have been selected but the exchange block does not have attributes the drawing is searched for text although they are not necessary to recognize the symbol When you click on Create the marked symbol structures are used to generate the prototype which must be sav
2. ccccceccseecceecceeeceeeceneceneceneceeeceseeasecasesaeesaeesaneseesueesees 1 Welcome to the World of Raster and Vector 0 0 cccccccececeeeeeeeeesseeeesaeeesaeeesaeeessaeessaeeesanenes 1 What is VP HybridCAD and Who needs nm REENEN ENEE ENEE ENEE 1 Basics Raster data Vector data eegen deed ee 2 Nector Post EE 6 Erop 6 Concept of THIS MANUS E 10 Beleg NS ON EE 10 SECTION 2 INS FALLA EENEG 11 introduc tO WEE 11 Software License Hardlock ccccccecseceeseueeeeeecuseueeeeueeuscusaueueeusausaueaueueausausaueueeueausaueaeeueausans 11 HOCK O IN Of aciesatonatanenpacanateondsneatnncenna nusie ES EEEE 12 Package COM enis crnan E EEN 12 Attaching the Hardlock DONGIE eege eege 12 Installing VP HybridCAD Software cece ceee eee eee eee eeesaeeesaae essa essaeeesaeessaeaesaaeessaeeesaeeenas 13 attente 13 Performing the Installation iecancnvtendecsauinrenanna sesvemstmniessnnintendeestieienranicdebteantasieascandentaesteeeanenssettieadtesivane 14 Registra ON RE 15 Unos taling EE 15 Updating Upgrading Patching ccccccccseseceeeeeeeeseeeeeeeaueeeseaeeeessaeeessaaeeessaaeeesaaeeessaaeeeseas 16 System Requirements eicicseiewcsa ca cecnpsainncinsavacaetpisenawenaveannwdinsleannsaencebnacnneuniasanvenesseawsyaeacanenniweawenes 16 Installing the VPLicenseManaget ccccccseceeseeeeeeeeeeeeeeeeaeeeaeeeeeeeeaeesaeeseaaeeaeesaeesenesaeesaeenes 17 PVC CUI FINGAL E 17 YS CeO co A E E E EEE E A 17 Mo
3. Hatch on off This option toggles the search for hatch on and off The value to set is Max Line Distance The lines assigned to a hatch pattern are collected and saved in a Block A minimum of five lines are required to create a hatch block Hatch is recognized if the angular deviation of its lines relative to one of the three base angles is less than Angle Range and the angle tolerance of the individual elements is less than or equal to 5 Max Line Distance Default 5 mm or 0 2 inch Angle Range Range 5 thru 35 Default 25 Base Angle A maximum of three angles can be entered Defaults 45 45 45 V 6 7 E Section 10 Raster to Vector Conversion Vectorization 199 7 sottelec E VPraster pro VPraster Symbols on off VPraster LT Use this option to turn on and off searching for symbols during vector post processing Clicking on Prototypes opens the dialog box for the selection of symbol prototypes for the later search process If you wish to search for specific symbols in the original they must be set up as prototypes activated and listed in the Symbols to search selection box For information on creating prototypes see Section 12 Layers Tab The Layers tab allows you to dynamically assign three layers to define three line width classes Parameters Post Processing EN General Basic Advanced Blocks Layers Parameter Set Mech Arch Geo Line Weight be ha Untitled
4. 90 Section4 General Functions V 6 7 E 7 sottelec E VPraster pro E VPraster Strip Control E VPraster LT TIFF data can be written in whole single strip or in strips Select between e Auto calculates the strip size so that it amounts to roughly 8 KB of uncompressed data e Single Strip writes the file in whole e Multi Strips The number of Rows Per Strip can be entered into the edit field Default 512 Default Single Strip A large number of strips result in large file sizes Also do not choose the option Auto with wide images gt 6 000 pixels Compression The compression method substantially affects the resulting file size Colored images can be compressed as follows e Uncompressed the data will not be compressed e LZW typically generates the smallest file sizes e Packbits compresses data using the Packbits method Monochrome B W images allow these options e Uncompressed the data will not be compressed e CCITT Group 4 generates highly compressed data Write Out World File TFW Activating this check box results in the creation of an additional World File where geo referencing information is registered that is used together with the raster data for mapping or GIS applications The World File bears the associated TIFF file s name with the extension TFW In order to generate a valid TFW file it is necessary to choose Meter m as User Units Entering any other unit will bring up a message box indi
5. Choose one of the eight slots The preview window displays an object if the chosen slot already contains data Otherwise a black cross indicates an empty slot Click OK to copy into this slot Copying an object to a slot that already contains data will result in overwriting When no objects have been selected the command appears grayed in the Edit menu Paste from Clipboard Ctrl V This command is only available when objects have been previously copied to the clipboard see above Otherwise the command appears grayed in the Edit menu The Paste from Clipboard command Edit Paste from Clipboard or using Ctrl V will bring up the following dialog box allowing for a selection of a slot to paste from Clipboard Choose Clipboard Entry CR Ww C3 C4 R 5 5 BE Ee Cg AAS Cancel 205K Only those slots containing object data will be available Click the desired slot followed by OK The slot s contents will be pasted to the screen If only one slot contains data it is pasted without showing this dialog box Object handles allow for moving scaling and rotating Raster Objects are displayed only as rectangles in this mode When clicking the left mouse button the object will be inserted into the drawing Last Selection Ctri L Re selects the elements last edited or the elements created in the last editing operation 210 Section 11 Hybrid Editor in the VP HybridCAD Window V 6 7 E 7 sottelec E VPraster pro VPras
6. Wrong selection Select two lines or two arcs or one line and one arc or one polyline to close it only The operation could not be carried out Ensure that there are no additional objects accidentally selected Wrong selection Select at least two objects The operation will refuse to run if only one object is selected First select a reference object and then additional objects which should be extended to this You cannot place more than 4 borders The number of split borders is limited to four in each horizontal and vertical direction If you want to split the drawing in more parts you have to use this command repeatedly Your current hardware lock does not allow you to run this program Please enter update password below The hardware lock currently connected to your computer belongs to an older or different version of VP HybridCAD Please enter the update password that you received together with the software Contact your dealer or softelec for assistance V 6 7 7E Appendix Error Messages Scanner Interface 249 7 sottelec This page has been left blank intentionally 250 Appendix Error Messages Scanner Interface V 6 7 7E 7 sottelec E VPraster pro E VPraster Ap pend ix B This section applies to VPraster LT Scanner Interface Supported Scanners The following table contains all currently supported scanners ScanPlus III 300 ScanPlus III 500 C ScanPlus III 500 ScanPlus III 800 C ScanPlus Ill 600 Sca
7. 7 sottelec E VPraster pro VPraster New Attributes VPraster LT New Attributes opens an additional dialog box for defining attributes Add Attdef x Attdef Name Default Value Prompt Angle Textstyle Invisible I Constant IT Verify T Preset Cancel The following settings must be entered for each attribute e Attribute Definition Name e Default Value Default value of the attribute when the block is inserted If the Default value is not defined the attribute name is displayed instead in the block definition preview See the topic New Attribute in Section 4 for more information on Default Value e Prompt Brief text displayed instead of the attribute name when viewing attribute values In addition Angle and Text Style can be set Default Angle 0 Default Textstyle T1 The attribute function can be set using the following checkboxes e Invisible Attribute not displayed in the block e Constant AutoCAD flag Attribute value cannot be edited or positioned in the block e Verify AutoCAD flag has no meaning here e Preset AutoCAD flag has no meaning here Clicking OK completes definition of attributes and closes the dialog box The new attribute definition is displayed with its default name in the geometry of the block definition It automatically becomes the highlighted entry in the selection list and is displayed as such 226 Section12 Blocks V 6 7 E 7 sottelec E VPraster pro VPra
8. In a raster drawing some solid lines are going to be exchanged by dashed lines The following steps are necessary e vectorizing lines interactively e rasterizing vectorized lines Preparation Start with a new drawing and load the raster file GEO TIF from the SAMPLES directory V 6 7 E Section3 Tutorial 57 7 sottelec E VPraster pro E VPraster Tracing Contours VPraster LT Sa lel Click the Erase Raster Background mode icon command line vprerasebg to delete the raster data during tracing Change the current line type to Dashed2 as described above Disable the option Append Mode in the dialog Trace Settings Start the Contour Trace function command line vprtrace set the work area to the entire drawing and trace all contour lines assigned to 1000 or 1200 End the trace mode For better display of the dashed polylines change the properties of each polyline by marking the LT Gen option Rasterizing Vectors 58 Section 3 Click the function Rasterize command line vprplot to open the dialog Select Rasterize only Vector Objects All and Delete Objects after Rasterizing Close the dialog In the following dialog box change the Width of color 7 black to 0 05 Click OK to start the rasterize process All polylines generated during tracing will be converted into raster data The result of this operation should look like this Save the raster as Geo_1 TIF to the TUTORIAL directory Tutorial V 6 7 E
9. VPraster LT Zoom in to the following area Select Raster a SS Click the Create Raster Object Erase Background icon command line vpreobject Select with the appropriate selection commands the circle the arc and both the vertical dimension help lines Select Circle Select Arc Select Line For the dimensioning section line arrows and text use Select Window for selection Drag a window around these entities and everything inside the window will be selected Therefore make the window as small as possible End the selection Enter Move Raster Object 42 Section 3 For an optimal positioning we will set the object insertion point to the center of the drilling circle We will use the raster snap to locate the center point Click on the icon Change Settings activate the Raster Snap function and select the snap modes Center and Crossing Close the dialog with OK Select the raster object and click on the AutoCAD function Move Activate the Raster Snap and move the cursor towards the raster circle line until the raster snap displays the circle center snap with a little color circle If you now click with the mouse then the base point for moving the object will be the center of the circle If no little circle appears then your snap mode is set to Crossing Press Tab to change to Center Tutorial V 6 7 E 7 sottelec E VPraster pro E VPraster VPraster LT Since the raster snap operates only
10. Exchange 205K Review Delete A block definition will be automatically deleted if it is not used by a block in the loaded file When the block definition is used by a block in the loaded file the following selection is available Yes deletes the block definition and all its blocks No deletes the block definition all blocks however will be exploded to their basic elements origin Cancel cancels the delete command V 6 7 E Section4 General Functions 111 7 sottelec E VPraster pro VPraster Exchange VPraster LT The selected block definition can be exchanged by any other existing block definition Exchange Block Reference x Exchange Block Refrence RES After OK and Close all blocks of the former block definition in the current file will be exchanged by the new block definition For attributes bearing the same name the former values will be assigned For all others the attribute definition s default values are valid Modify Block definition layer insertion point and when existing attribute definitions can be displayed and modified l Layer of Block Reference BLOCKS D Style moo H Default ik i d Prompt War Angle mmm Attributes Insertion Point I Invisible I Constant New Attribute T Verify T Preset Delete Attribute Cancel The insertion point can be moved with the mouse It automatically snaps to cross points intersect
11. Text recognition OCR Symbol search and extraction replacement with automatic attribute assignment Parameter files load edit save Draw line polyline spline arc circle ellipse Insert arrowhead connection dot donut Hatch create explode erase Entities adjust move copy Text create move rotate scale Block insert create rotate scale Object snap general to end of entity to center of line Length of pointing and dimension arrowhead Hatch single cross angle line distance Transparency on off fix variable Edit chain adjust line polyline spline arc circle ellipse Edit line types text Modify layer assignments Review texts Create explode edit blocks Create and edit block attributes Explode entity V 6 7 E 7 sottelec E VPraster pro VPraster VPraster LT Functions of Vector Editor Create edit dimension Build corners between elements Smooth transitions between elements Trim elements Assign elevation OCR Choose character set from 28 languages Special characters handwritten text recognition V 6 7 E Specifications 239 7 sottelec This page has been left blank intentionally 240 Specifications V 6 7 E 7 sottelec E VPraster pro E VPraster Appendix A This section applies to E VPraster LT Error and System Messages All data belonging to this parameter set will be deleted Do you wish to continue The selected parameter set will be overwritten with the system
12. The available options are e Whole Drawing e Rectangular Area e Polygon Area V 6 7 E Section 10 MRaster to Vector Conversion Vectorization 189 7 sottelec E VPraster pro VPraster VPraster LT The rectangular area option makes it possible especially in the case of large Originals to test on one or several sections the correct parameter settings for achieving optimal results before converting the entire drawing A These options are not accessible if raster objects have been selected Post Processing Vector post processing is initiated All vector data or only the selected vector data are post processed according to the active parameter values Vector post processing can occur with raw vector data or also using different parameter values with previously post processed vectors Selections are made using Window Cross Pick Parameters Post Processing Clicking on this icon or choosing Options Parameters Post Processing brings up the following dialog box Parameters Post Processing Fa General Basic Advanced Blocks Layers Parameter Set m Straightening eae C None k Angle Correction RW C Weak Deviation 3 0 degrees at C Ground c i Medium 0 90 45 0 30 0 S 60 0 degrees eo Strong C Untitled C Untitled MV Gap Jump 0 10 aaa T Create Splines C Untitled Only Along Outlines E Grid Snap ou Even Across Intersections Untitled Cancel Load S
13. VP HybridCAD Always Ahead 7 sottelec E VPraster pro E VPraster Software License Agreement B Vear Grant of Limited License softelec grants the right to install the full version software on one 1 computer workstation or network server at any one time softelec also grants the right for one 1 user or in the case of a network license for the number of users stated in the network license agreement to use and activate the software at any one time For demonstration software versions unlimited multiple installations are permissible This limited license supercedes any other previous agreement unless granted in writing and signed by softelec Copyright The contents of this manual and the associated software recorded in diskettes and or CD s are the sole property of softelec and are protected by applicable copyright law This software may not be altered decrypted decompiled changed or disassembled in any manner without written authorization from softelec A single backup copy is authorized The user agrees not to transfer title of this software at any one time without first notifying softelec All rights are reserved No part of this manual may be reproduced transmitted transcribed stored on a retrieval system or translated into any language or computer language in any form or means electronic mechanical magnetic optical chemical manual or otherwise without the express written consent of softelec as p
14. x G Nearest Snap first on Vector X Intersection Snap first on Raster O T End Point TI Center Marker Size e a Quadrant Marker Color Yellow e Coord Snap on off After activation click on check box enter the values for x and y spacing The values refer to the user coordinate system Default x y 0 1 mm Grid on off After activation click on check box enter the values for x and y spacing The values refer to the user coordinate system Default x y 5 mm Snap Mode There are two Snap choices e Raster Snap e Vector Snap If both are activated the priority snap function has to be defined Default Snap first on Vector V 6 7 E Section4 General Functions 115 7 sottelec E VPraster pro VPraster VPraster LT There are five different snap modi available e Nearest snaps to the nearest middle point of the element e Intersection snaps to the nearest intersection of the element e End Point snaps to the nearest end point of a element e Center snaps to the center of the nearest circle or arc e Quadrant snaps to a quadrant 0 90 180 270 of the nearest circle or arc The sensitive area of the Raster Snap about 200 by 200 pixels at the present mouse position is fixed preset to guarantee the optimal usability with a maximum of speed While using the snap the active mode can be change clockwise to a different snap mode with TAB The differe
15. 7 sottelec E VPraster pro Lesson Six Color Reduction Separation SE VPraster LT During this lesson you will learn how to e combine colors e change colors e export raster data separated by colors Preparation Start with a new drawing and load the raster file KAT TIF from the TUTORIAL directory Color Reduction While scanning the drawing the colors red blue and black have been paled through the white background Le there are intermediate colors added to the basic colors In the following process the number of colors will be reduced down to four From the VP HybridCAD menu click on the sub menu Color Tools Choose the function Color Reduction to display the Histogram dialog box V 6 7 E Section3 Tutorial 59 7 sottelec E VPraster pro E VPraster VPraster LT Histogram Press lt SHIFT gt to deselect colors in preview window EN m Automatic from 256 to 256 Colors 15 Colors used Color A G B C M Y CS S io 245 245 245 E waat eel et ISA e e eieiei e KSSSSSSggsggsgsggsgggsgggsggsgsggsgsgsgswcllcc lee lee elle el lee elle B B ll 3 B ole SES EES ge CC SE Madi alors Reset Cancel Convert V Change Pixels Golor Separation E Gorvert to BW OK Pixels C Percent DI Absolute Preview M On T Flash TI False Color Bee Depending on the screen resolution there are three dif
16. A dialog box pops up for a pre selection what to rasterize V 6 7 E Section4 General Functions 93 7 sottelec E VPraster pro E VPraster E VPraster LT Rastenze Objects to Rasterize Rasterize only Vector Objects Erase Mode Rasterize Raster and Vector Objects All Vectors with Brace Mode Which Objects CG All Selection E Delete Objects after Rastenzation Cancel Objects to Rasterize Select the type of entities to be rasterized Rasterize only Raster Objects rasterizes only these elements into the Active Image Rasterize only Vector Objects rasterizes only vector data Rasterize Raster and Vector Objects rasterizes all of the entities of the drawing into the Active Image lf Erase Mode or All Vectors in Erase Mode is on all raster structures under laying the vector elements are erased The vector elements remain after rasterization or will be deleted if Delete Objects after Rasterization has been selected Which Objects Select whether A entities of the drawing or only a Selection will be rasterized If Selection is on you will be asked after OK to select the entities Delete Objects after Rasterization on off If on the selected entities for rasterization will be deleted afterwards If any vector data have been selected for rasterization no matter whether in Erase Mode or not a dialog box opens to assign the line Width for each Color used for drawing the vector elements Dimension in
17. C Untitled C Untitled C Untitled OK Cancel Load Se Reset The values for the two class limits determine the maximum widths up to which lines circles arcs etc are assigned to the layers L1 L2 or L3 The layer limits can be changed using the slider controls It_is not possible to enter values via the keyboard Preview offers a practical simple and precise setting of the limits if raw vectorization has already occurred and is displayed on screen After changing the limits using the sliders you can immediately view the resulting changes For each base layer L1 L2 L3 VP generates additional sub layers for arcs circles and other line types which belong to one of the three base layers according to their width classification See also Layer Structure in Appendix B 200 Section10 Raster to Vector Conversion Vectorization V 6 7 E 7 sottelec E VPraster pro VPraster Regeneration vPraster LT This command is used to regenerate the vector data In contrast to Redraw not only the screen is redrawn based on the internal data but the structural connections of the vector data are regenerated and displayed as well Regeneration is especially helpful for interactive editing of the vectors If for example several line segments are connected to form a single line or if a non orthogonal line is deskewed to run orthogonal overlaps or gaps may occur at the points where other lines e g hatch lines
18. E VPraster LT Window cut crop cut to format Deskew raster file Rotate raster file Mirror raster file Invert raster file Rubber sheeting 4 point multi point Scale drawing Despeckle raster file window B W 1 thru 128 pixels Fill holes in raster file window B W 1 thru 128 pixels Filter Smooth raster Copy move raster rectangle polygon Split raster file Merge adjust 2 raster files AutoCAD R14 2000 or AutoCAD LT 97 98 2000 Pentium CPU 32 MB RAM SVGA adapter with 256 colors min resolution 800x600 pixels min Pentium 300 or higher 32 64 MB RAM for B W or small color drawings 128 MB RAM for standard color drawings 400 MB free hard disk space for color drawings 1024x768 SVGA adapter with windows accelerator V 6 7 E 7 sottelec E VPraster pro E VPraster VPraster VPraster pro VPraster LT Scanner Interface Draw Erase Raster Elements Raster Editing Raster Object Tracing Line Following Settings Accuracy Color Operations True color operation possible V 6 7 E CalComp Colortrac Contex Imtec Oc Vidar WideCom Xerox Line polyline arc circle rectangle Copy Move Erase raster selection arc circle line polygon window pick or inside window Smooth raster selection arc circle line Fill raster Erase raster B W only Edit raster text Paste from file Copy to file Create by arc circle line polygon window pick o
19. Save Probes Cancel Process Probes Test Classification Load Classification Save Classification JI o Pick Probe Test Areas Probes C Area Line Text M Show Clear M Show AlOfActive Class V 6 7 E Section7 Color Reduction Color Separation Color Classification Filters 149 7 sottelec E VPraster pro E VPraster VPraster LT Pan and zoom commands can be used transparently The first step to classify an image is to define the desired classes Select New Modify Class from the dialog In the upper section of the appearing dialog enter a name of the class and assign a color target color Image classes can be defined like this sample Class Color buildings white streets black parks green You can enter up to 16 different classes colors Choose the target color of the class according to the image s color pattern or assign any color except magenta as this color is used internally by the program and lead to confusion by the user There is no interaction between the color pattern to be classified and the target color The second step is to window or individually pick representative colors probes for the class from the image With the combo box Active Class you select the class to which the probes will be assigned If you take more probes for a particular class the classification quality can A improve This is especially important if color patterns vary in different areas It is recommended th
20. Straightening GG Arch vw Angle Comection None B C Weak Deviation 3 0 degrees at Ground a foo Jon 00 degrees C Geo Untitled T Line Chaining Untitled Fi Greate Setres M GapJump 10 20 Ese spines Untitled Ge Orly Along Outines TO ee rte LCI TT Grid Snap og r ee Guer Scoss Intersections Cancel Load Save Reset First click on one of the empty entries Untitled in the Parameter Set list Then click Load and select the parameter file TUTOR PCF from the TUTORIAL subdirectory The file name will be inserted into the marked entry field The pre configured settings are now available 76 Section Tutorial V 6 7 E V 6 7 E 7 sottelec E VPraster pro VPraster VPraster LT Now click on the tab Layer and then on Preview The preview function requires your screen display set to 256 colors or more If the graphics board in use has less than 256 colors a warning message will be displayed You can now adjust your Line Weight classification dynamically Set the bar between red and yellow in such a way that you will get a good separation of line weight classes focusing on the dimension lines red color and object geometry yellow color Move the dialog box for a better view on the drawing Ideally in this case you want to separate the spring geometry from the dimension data Close the preview the first limit should be around 0 40 mm or 0 016 inch These values cannot be entered via
21. VPraster or VPraster LT The system driver for accessing the hardlock dongle will be automatically installed together with the VP HybridCAD software Administrator rights are necessary to install the hardlock driver under Windows NT After a successful installation of the software it is often necessary to reboot the computer in order to allow the operating system to update the DLLs especially for NT and AutoCAD users A dialog box will appear asking the user to restart the computer now or at a later time Section2 Installation 13 7 sottelec E VPraster pro E VPraster Performing the Installation W VPraster LT The setup is started automatically after inserting the CD into your CD ROM drive autorun Only if your Operating System OS does not support this or autorun is disabled you have to start the setup program SETUP_VP EXE manually from the root directory of the CD Installing under Windows 95 98 amp Windows NT 4 x 2000 Click on the Start button to activate the Control Panel from the Settings menu Double click the icon named Add Remove Software and follow the instructions Alternatively you may double click SETUP_VP EXE directly from the Explorer In the initial setup window click the item VP HybridCAD Products and select the desired program language from the dialog In the sequel you are guided through the setup dialogs allowing user defined settings Local Installation Follow the steps through the installatio
22. bu 94 Section4 General Functions V 6 7 E 7 sottelec WE VPraster pro E VPraster E VPraster LT Rasterize x Colori fei Width om 0 M Rasterize Color Rasterize Color If set to on all entities with the selected color will be rasterized Since VP HybridCAD uses the AutoCAD plotter driver for executing rasterization a long list of commands may be prompted in the command line during rasterization Just wait Rasterize to Paper Format Rasterizes all raster and vector entities into a new raster image A dialog pops up for specifying the size of the target raster image At the command prompt enter vprrtopaper Rasterize to Paper Format Form Size GIS EIEAENW New Form Resolution 200 DPI T Colored REES Scaling 1 fi D Paper Position Center C Adjust Manually Form Size allows to select the size of the target raster image from a list of standard formats The best fitting form is pre selected The format named Exact is a special format that adapts Its size to the extents of all raster and vector entities The button New Form opens a dialog box to enter the data of a new form The values refer to the setting of Drawing Units pixels mm or inches Delete Form deletes the selected form V 6 7 E Section4 General Functions 95 7 sottelec E VPraster pro E VPraster E VPraster LT Resolution specifies the desired resolution in DPI for the target raster image If Colored is che
23. sottelec Basics E VPraster pro E VPraster E VPraster LT e Land Survey engineers and Land Register documents e Any structural planning and design Everyone using a CAD system will inevitably face this question How do capture paper information for use in my CAD system in a manner that saves time and money At softelec we firmly believe that VP HybridCAD software clearly responds to this question in many positive ways and that it offers the best solution available for any application Raster data Vector data 2 Section 1 Scanners or other devices generate raster data when they scan a document In the case of a monochrome rendition the document s contents are represented as a matrix of black and white pixels In gray level rendition representation will also be in pixels commonly 8 bit corresponding with 256 gray tones Color scanning will of course result in color pixel representation with 8 12 16 24 or 32 bits of color depth The individual pixels bear no logical relation to each other They represent some sort of a digital photography of the document s content as computer data Figure 1 B W Raster Representation Pixel density is specified as number per unit of length in most cases as DPI dots per inch Numerous raster data formats exist TIFF GP4 RLC PCX BMP GIF etc they describe position and color of the pixels comprising the image Introduction V 6 7 E V 6 7 E 7 sott
24. B W TIFF uncompressed Group 3 and 4 Packbits NIF GP4 CALS Group 4 CAL Group 4 MIL CG4 RST C4 EDMICS IG4 RLC RLE CIT PCX BMP GIF Color Gray scale levels TIFF uncompressed LZW Packbits PCX BMP GIF JPG CRL TPE LSR Additional All monochrome gray scale or color raster formats supported by AutoCAD Vector AutoCAD supported formats Hybrid Raster Vector RasterDWG Output Formats Raster B W TIFF uncompressed Group 4 GP4 CAL Group 4 C4 EDMICS CG4 RLC RLE PCX BMP GIF Color Gray scale levels TIFF uncompressed LZW Packbits PCX BMP GIF JPG CRL Additional All raster formats supported by AutoCAD Vector AutoCAD supported formats Hybrid Raster Vector RasterDWG Image Formats Dependent upon the scanning resolution 64 000 x 64 000 pixel max General Functions Raster display on off Select Active Image Zoom Active Image Create raster image Raster snap Erase raster area rectangle polygon Erase raster background Regenerate Auto Regenerate drawing Rasterize AutoCAD entities Rasterize to Paper Format Plot print raster and or vectors VPraster pro VPraster only Dynamic line weight assignment GIF format limited to 256 colors max V 6 7 E Specifications 235 7 sottelec Functions of Raster Editor VPraster VPraster pro only Min System Requirements Recommended Hardware True color operation possible 236 Specifications E VPraster pro E VPraster
25. Default 2 mm or 0 079 inch Circles on off Min Diameter sets the lower limit for circle recognition Default 2 mm or 0 079 inch V 6 7 E Section 10 Raster to Vector Conversion Vectorization 195 7 sottelec E VPraster pro VPraster VPraster LT Line Types on off Toggles the recognition of dash dotted and dashed line types on and off An individual line type is usually generated for every line in the original which is not a solid line However the number of line types can be limited by using As many as At least three partial segments are required to be able to recognize a line type In the case of arcs and circles at least five are required As many as needed An individual line type is generated for each line found As many as The found lines are classified The value for As many as determines how many types of dash dotted and dashed lines are created The value of Max Dash Length is divided by the value of As many as Line types are then created consisting of dash lengths of once twice n times this fraction The classification occurs by assigning each found line type to the next larger line type If however the line types D1 Dn or DD1 DDn have been predefined in the source drawing their dash and gap lengths are used Default 3 Max Gap Length Defines the maximum gap length in a dashed or dash dotted line to be found Default 0 mm inch pixel Max Dash Length Defines the maximum
26. File Editing V 6 7 E Invert 7 sottelec E VPraster pro E VPraster E VPraster LT When you choose this function the cursor appears with a triple frame box which you position at the first starting point of the reference line you wish to define When you click on the first point the area is enlarged to a ratio of 1 1 The standard screen cursor appears allowing you to accurately pick the starting point of the magnified reference line with a mouse click After doing this the program zooms back to the extents and the cursor returns with a triple frame box again You apply the box in the same way to pick the end point of the reference line The program immediately begins the transformation of deskewing the image A progress indicator is displayed If deskewing is unnecessary the program displays a corresponding message The Raster Snap function F8 should be switched off for optimum deskewing accuracy This function inverts the Active Image e g white pixels become black and vice versa it is available for B W gray scale and colored raster files At the command prompt enter vprinvert Rotate Arbitrary V 6 7 E This function rotates the Active Image through any angle you wish A dialog box appears where you enter the rotation angle and select the basis of rotation on degrees Rotation Angle North 0 0 degrees You specify the angle by entering the value via keyboard absolute rotation angle North will rotate t
27. In the Colors dialog box you can modify the color deliberately Select as the Basic Color blue red 0 green 0 blue 255 and close the dialog box Just like the combination of colors these modifications can be undone and redone You also can modify several colors by selecting them subsequently and then clicking on Modify Color s You cannot modify any color to a new color that is in use In this case use the combine method V67 E Section3 Tutorial 63 7 sottelec E VPraster pro E VPraster Remaining Colors VPraster LT Three dominant colors are now apparent along with a few other random colors not having any color correlation to the dominant You can determine or compare the pixel number of these colors in Percent and Absolute by clicking on the respective color bars Another way to view the minor colors is by using the sliding Scale bar to the right of the Histogram When moving the slider up you will see the color bars expand or grow in height This amplified view helps to note the differential intensities of the remaining colors compared to the dominant colors These remaining low level or residual remaining colors generally just a few pixels can now be combined with any of the remaining major color of your choice and should not affect the image Select white either from the Preview or the Histogram then click on the left color label of the three remaining colors with the right mouse button Keep the button pressed and mov
28. VPHybridCAD Color Tools menu select Convert To Palette This function generates an indexed color image from the actual true color image At the command prompt enter vprrgb2pal Select Image Select the image to convert Transformation If the Active Image is an indexed color or gray scale raster file image call Palette Transformation from the menu VP HybridCAD Color Tools or click this icon At the command prompt enter vprtrans The dialog box for palette transformation appears 156 Section7 Color Reduction Color Separation Color Classification Filters V 6 7 E V 6 7 E 7 sottelec E VPraster pro WE VPraster VPraster LT Palette Transformation m Transformation Gamma Correction DI E Red G PL op SEH M Invert Lt reen E Blue I Connect Gamma 2 00 MV View RGB M Handles peak Baie AS Raten s torit C Bed C Green C Blue C Gray All M Move It is organized in three sections e Transformation e Output e Input Transformation determines how palette entries will be modified The Input and Output both contain views of the actual image Output View and Input View The Input View shows the original image the Output View the image based on the transformed palette On the left of Transformation the transformation name and a numerical representation Numerical View is displayed on the right a graphical representation of the transformation is shown Transformatio
29. a aaiae 142 BRS SS Eege 99 Regeneration of E e EC 201 BRS IIS oe EE 15 Remove Speckles B W files on 138 PRC VAC WCC EE 207 Fey ACS aigle 137 Seier Le Sense is ese AEREA SAE SS EEEE A Eaa 163 RUDDer Sheeting GE 1 E 163 Rubber Sheeting of Technical DraWwingS ENEE 172 Save Raster Mage ene een een enn ene ee eee eee 90 SAVE RISE DNN EE 92 See SAD En S EE 140 Eeer Eege 92 Scanner Interface Supported Scanners cccsecceseccseeceecesecceeeceueceseecaueeeueceseetaeeceueeesessaeeeseeeeaeetags 251 Scanner ResolUt ON EE 107 Scanning Be 141 SCEN E ele 107 Select FACT SNAG eegene 98 EE ge 125 DBElECE Master Ge CN 125 Select Kaster EE 126 Select Raster in Rectangle deeteeesiege Seege Get Seege SeEeg eege Geh ee eege 126 Select Raster Inside WindOW sssssssssnssrserrsrrrrrrnrrsrrerrrnrrnrrsrrnnrrnrnnrrerrorrnnrrnrrnrrorrnnrnnnrenrenrnrnnnnennnne 127 SEIECT Raser BL 126 S LET E E AE A EEE A OAA E EE et ane A OEE EAE tienes raceterencs 102 260 Index V 6 7 E 7 sottelec E VPraster pro E VPraster E VPraster LT betr EE 108 SNOW AS COI EE 98 Show Raster Image UNO E 93 EE 124 Smooth Raster B W files only 140 Software License Hardlock EE 11 Specials with AutoCAD 2000 and AutoCAD LT 2000 83 Specials with AutoCAD LT 97 98 2000 cccccccssececeeseeeceseeeeeeseeeeeseeeteeeeeeeaseeeeeaseeteegeeeseaseeesenseess 83 SCI Att ON EE 235 e ll EEN 214 Eet 163 ei le UR 175 Standard Parameter Files cccsscccseccseec
30. a green frame marks the work area and the cursor appears as a 4 Way cursor Click on the component s upper outline just right of the vertical axis The outline will be recognized up to the interruption on the right Left of the starting point you see an intersection The tracing process stops and a zoom window opens showing an enlargement of this intersection By clicking either in the zoom window or in the active raster image you determine the next trace direction In this example let the tracing continue to the left so click on the outline left of the vertical axis The tracing process will continue in the specified direction and will stop at an interruption The cursor then changes to an OK to ask you to verify the current line trace was correct If not you can click the Undo Trace icon command line vprbtrace to go back to the last ramification point Clicking on the right mouse button will undo the traced line while the left mouse button confirms Confirm the line with a left mouse click the cursor changes back to a 4 Way cursor The next fraction of the outline is to be attached to the polyline we have generated Keep the Shift key pressed a plus sign will be added to the cursor and click on the fraction The outline will be traced up to the next interruption Continue tracing the entire outline the same way At the final interruption the process stops the remaining gap will not be closed End the tracing mode by clicki
31. activate and specify the drawing aids Grid Coordinate Snap and Raster Snap Grid F7 The grid specified in the menu Options Drawing Aids can be switched on off with this icon or using F7 Coord Snap F9 The coord snap specified in the menu Options Drawing Aids can be switched H on off with this icon or using F9 Raster Snap F11 The raster snap specified in the menu Options Drawing Aids can be switched on off with this icon or using F11 Vector Snap F8 The vector snap specified in the menu Options Drawing Aids can be switched on off with this icon or using F8 Polygon Select F6 Allows the selection of elements inside a polygonal area Switches off mouse select functions Pick Window and Crossing while Polygon Select is switched on 104 Section4 General Functions V 6 7 E 7 sottelec E VPraster pro VPraster Redraw Ctrl R VPraster LT This option causes the display to be redrawn using the current data Distance F2 V 6 7 E Pressing this key enables measurement of the distance and angle between two mouse click points using a phantom line After the second point is set measurement information is displayed inside a pop up box The drawing unit and scan resolution parameters are used for calculation as determined by the DPI of the drawing and the base units set in the Settings All length measurements are also displayed in the User Units user coordinate system Dra
32. also switch off the display of previously picked probes with Probes Show The function Probes All Of Active Class displays all picked probes of the active class in the highlight color After generating a classification hit rate values in percent are displayed in the Active Class and in the Probes of Active Class listings You can review the probes with low hit rate values which are most likely the ones to prevent good results by selecting them with Probes of Active Class The active probe is displayed in magenta Discard it with Remove Probe and pick a new probe s instead Probe Hit Rate Probez Hit Rate Probe Hit Hate Probe4 Hit Rate Generate a new classification by pressing Process Probes in order to assign the new probes to the classification When the classification suits your needs you can save it with Save Classification The classification can now be applied to other images of the same type by loading it with Load Classification OK processes the entire image with a generated or loaded Classification Cancel leaves the dialog without prompting to save a generated classification Load Probes oads probes but the picked areas will not be displayed Save Probes saves the picked probes to disk Section 7 Color Reduction Color Separation Color Classification Filters 151 7 sottelec WE VPraster pro E VPraster Filter Functions VPraster LT With filter functions you can improve the image quality of a scan
33. and direction Arc 4 point Draws a counterclockwise arc with a defined radius in arc sub layer Name A 1st click point center 2nd click point radius 3rd click point start point arc 4th click point end point arc Arc with connection For drawing an arc with a tangential connection at two selected line ends in arc sub layer Name A After selecting the two lines radius position and if desired lengthening or shortening of the lines are defined with a third mouse click Pressing the Shift key creates orthogonal connections 214 Section11 Hybrid Editor in the VP HybridCAD Window V 6 7 E 7 sottelec E VPraster pro VPraster Circle Radius VPraster LT For drawing a circle by defining the center first click and radius second click in CG circle sub layer Name C Circle 2 point o For drawing a circle through two points diameter in circle sub layer Name C Circle 3 point For drawing a circle through three points in circle sub layer Name C and one minor third click half axis in ellipse sub layer Name E Ellipse For drawing an ellipse with the center point first click one major second click V 6 7 E Section 11 Hybrid Editor in the VP HybridCAD Window 215 7 sottelec E VPraster pro VPraster Text VPraster LT For writing text in the TEXT layer if a vector layer is currently active or in the ob RASTER layer if it is currently active After selecting this function dr
34. are provided with RESTRICTED RIGHTS for US Government customers Use duplication or disclosure by the U S Government is subject to restrictions as set forth in FAR 52 227 19 Commercial Computer Software Restricted Rights and DFAR 252 277 7013 c 1 ii Rights in Technical Data and Computer Software as applicable Manufacturer is softelec gmbh at the address set forth below V 6 7 E License Agreement i 7 sottelec E VPraster pro E VPraster E VPraster LT Legal Action This agreement shall be construed interpreted and governed by the laws of the Federal Republic of Germany Venue for any cause of legal actions shall be in the city of Munich Trademarks IBM PC AT and PS 2 are registered trademarks of International Business Machines Corporation MS DOS Windows 3 1x Windows 95 Windows 98 and Windows NT are registered trademarks of Microsoft Corporation AutoCAD and AutoCAD LT are registered trademarks of Autodesk Inc Recognita Plus is a registered trademark of SzKI Recognita AG softelec and logo Greek head design VPstudio VPmax VPlite VPraster VPselect RasterDWG DLC are registered trademarks of softelec gmbh softelec gmbh Joseph Seifried Strasse 8 D 80995 Muenchen Germany Phone 49 89 158 1430 e Fax 49 89 158 143 33 E mail info softelec com e Internet http www softelec com Il License Agreement V 6 7 E 7 sottelec E VPraster pro Table of Content B VPraster LT SECTION 1 INTRODUCTION
35. attach to this line Regeneration eliminates this effect and creates a clean vector drawing Regeneration can be done at any time when vectors are present Either all vector data or selected ones pick window crossing will be regenerated A progress bar appears during regeneration After Regeneration it is no longer possible to execute Undo Ctrl Z or Redo Ctrli A The following post processing parameters also affect regeneration Angle correction Gap jump Grid snap Small circle parameters V 6 7 E Section 10 Raster to Vector Conversion Vectorization 201 7 sottelec This page has been left blank intentionally 202 Section10 Raster to Vector Conversion Vectorization V 6 7 E 7 sottelec E VPraster pro m VPraster Section 11 This section applies to VPraster LT Operation Hybrid Editor in the VP HybridCAD Window General Information eos In the vectorization mode the Active Image and vector entities created by the GH vectorization process can be edited using VPHybridCAD s hybrid editing es functions The Object Creation function manages all layers line types and text styles as well as raster object colors The settings made in this dialog box apply to all draw edit functions see also Section 4 Layer ASTER f Drawing always occurs in the chosen current layer The color and weight d of elements displayed are determined by the settings entered for this layer in Object Creation tab Layer Objec
36. based on the drawing s paper format Usually technical drawings are created on transparent paper material with a drawing frame bearing an orientation to the paper format This drawing frame will be used as a scale reference for the necessary rubber sheeting process It is also assumed that the drawing s contents will remain in the desired scale after the completed rubber sheeting limit of raster file d ele ee upper margin m right margin I Gi Ca reference points Preparation Initially the drawing should be rotated so that the desired paper edge appears at the screen s top VP HybridCAD Raster File Edit Rotate After selecting VP HybridCAD Rubber Sheeting Drawing Format 4 Point the format selection box appears to define drawing formats and margin widths At the command prompt enter vprformat 172 Section8 Rubber Sheeting Split Merge V 6 7 E Form Size Crop Margins V 6 7 E 7 sottelec E VPraster pro E VPraster E VPraster LT Quick Calibration Cut to Paper Format Cut to Paper Format Form Size Dinaso A4 297 x 210 mm D w Cancel IV Different Margins Shae Margins Left 10 00 Right 10 00 Top hoo Bottom hoo Modify Form Delete Form New Form The list having the majority of standard forms will be used for processing the closest match to the dimensions of the raster file outer frame The button New Form open
37. be discarded For updating a VP network license hardlock the lock is attached to the VP server use the program UPDATELOCK EXE residing in the CD directory VPHardlock For more information please read the text file ReadMe TXT in the route directory of the CD Free updates do not require a password but it is important that you register your VP HybridCAD software for prompt notification Although you may update your current VP HybridCAD product by installing the new version into the same directory patching we recommend you do a fresh installation First uninstall the old version then install the new product version System Requirements 16 Section 2 The VP HybridCAD software has been developed using the most powerful and state of the art programming techniques specifically designed for high power PCs in order to be able to process the huge quantity of data of large images and technical drawings However proper operation requires a specific configuration of hardware and software to guarantee overall functionality The fastest CPU in your PC is the most desirable VP HybridCAD software requires at least 32 MB of RAM when running this application inside AutoCAD Drawing formats of DIN AO E size and larger gray scale or color images of any size require a minimum of 64 MB RAM 128 MB or more is recommended File size and entity contents of a drawing define the actual amount of RAM required In general The larger and denser the dra
38. ddac a O 87 Enable Network SearCh siiceescnnccnsnnestensaiieneandauibsneinaniinsedintsiansiieianeisanniedileuneebanetnnedindaeeounsnninteedaniunehsmseibdnausinasd 88 Erase Elements from Raster 133 Erase Rastel EEN 122 Erase Raster Under VECLONS E 204 Error and Ba 241 EXACT OUTING VectorizatiON E 189 leie E 206 UM RGS EE 130 Fiter Elend ee icasceiectcinasteesis eaaa oaaae Seoul ernaia rE aaa E RaRa 152 Filter Ee TEE 155 lg EEN 141 General FC CEO EE 83 RTE Ces EE 115 Mardlock RIVE 12 e uge RCI EE 217 Pde CC EDETI VE 119 FIOTIZOB CAN MITON EE 138 Hybrid Editor for Raster Vector Data 121 Hybrid Editor in the VP HybridCAD WINCOW cccseccssecceeeceseceeeeteeceseeeaeesaeeeeseeeeeteesegessaestaetees 203 Input of Reference Points Rubber Gbeetnng 169 ra gelen 217 227 installing the Software vseseiteencssccetasancientecintvieuvanse tendeasiticiwansaiietscteddesivwsqnintendendtise vaiseaceteicndnesincsesetoeuaanoeneaxeses 13 Installing the len EE e E 17 interactive Color SEPAlallON E 146 Jee ege e E 179 WI EEN 137 E WE e ME 210 LAY Si et AE 208 Layer D CHINO ME 110 258 Index V 6 7 E 7 sottelec E VPraster pro E VPraster E VPraster LT Blo 213 Line Type FAS SIA CFI cinco vnectn cats conseceatnn stew tatneatiteenacona tae neveinaneanenetea siesaiseate uetunesatnamtai union cuautaievnessieapenecusaslaniesnaies 208 Biewer lege RE 110 LINE Ie EE 204 Make E 206 Ve E 163 Ve E Cs e een ante rere T er te ne een mere eee c
39. degree of complexity cause long search times and poor search results even without finding a match In this event the alternate choice is to manually replace symbols with a block Symbols V 6 7 E Invoking this command brings up a dialog box displaying all loaded prototypes and the corresponding blocks Search Struct Nr 1 of 1 Symbols Block RES Create Add GND NAME d R6 Load VN e AN VALUE 205K ESA Modify ps When you click on a symbol name it is graphically displayed with the exchange block and activated for a Search To search for multiple symbols activate them by pressing Ctrl or Shift when selecting Section 13 Symbol Search Replacement 229 7 sottelec E VPraster pro VPraster Search VPraster LT The Search button is only functional after the activation of at least one prototype When you press Search the program searches the whole drawing or the previously selected areas for the selected prototypes The number of symbols found is displayed upon completion of the search Pstudio N 30 Symbols found The displayed block replaces all symbols found of a given prototype The block is fitted into the drawing in such a way as to provide maximum geometrical congruence of the original and replacement symbols A Please note that blocks are only rotated not scaled See item Modify for scaling Create Add An additional dialog box appears Remove Create Add to
40. end points of two selected elements line raw lines arcs are lengthened or shortened to form a corner Open polylines are closed An error message appears if it is not possible to execute this function The selected elements are connected in such a way that all of them end on the element which was selected first This occurs via trimming or extending If the element selected first is text all additional text elements are oriented towards the first one Other elements lines circles etc are ignored An error message appears if it is not possible to complete this command 206 Section 11 Hybrid Editor in the VP HybridCAD Window V67 E 7 sottelec E VPraster pro VPraster Review Text VPraster LT Use this function to verify and if necessary edit text extracted during vectorization The function can be used when parameters Text Separation or Text Recognition were activated and a value for the appropriate text height was set A dialog box appears with the raster text displayed at the top if a raster file is currently loaded In addition the corresponding text in the vectorized drawing is magnified and the vectors comprising the text are selected The scaling factor depends on the size of the text From this value choose Zoom State to increase decrease this factor In this dialog box you can change all text properties and edit the text directly using the keyboard A maximum of twenty four special characters are dire
41. function is activated all hatch elements turn to the color white in the drawing background Clicking on the element to be removed it becomes highlighted inverted in the list Use Remove to delete the element from the hatch which then becomes an individual element Color can be modified by choosing from the referring list To add lines to a hatch select the lines and the hatch block and choose Combine to Block block name HATCH 212 Section 11 Hybrid Editor in the VP HybridCAD Window V 6 7 E 7 sottelec E VPraster pro VPraster CAD Functions VPraster LT D en i Lem e H di Drawing always occurs in the current layer in the current line type and in the current color When you choose a vector layer the current color changes to BYLAYER in the RASTER layer it changes to the Draw Objects color selecting the RASTER layer using the pen icon or to the Erase Objects color selecting the RASTER layer using the eraser icon If the color is explicitly changed after selecting the layer the new color is used While drawing an entity all construction lines not the entity will be shown with a default width of 0 25 mm 0 01 inch This width is assigned to the CONSTRUCTION layer In Object Creation you can modify the width to your individual needs To save a new width and have this setting permanently available create the layer CONSTRUCTION in an empty drawing assign the desired line width and save this file under a name
42. is automatically activated ai The element is given handles so you can move handle with cross rotate and scale empty handles it When pressing the Shift key the element s original direction is preserved during scaling During a move operation the element s direction is constrained to n x 45 In Properties Enter relative distances in x and y direction may be entered into the coordinate fields using the character as prefix to the new value s If multiple objects are selected the handles disappear upon selection of the second element After choosing Move Object s a move handle and handles for rotating and scaling are assigned to the selected elements treated as one object Raster Objects are displayed only as rectangles in this mode Copy Object s After activation of this function the selected elements are copied and attached to the mouse for multiple placement Clicking on the left mouse button completes the copy function Copy to Clipboard Ctrl C Selected vector entities or raster objects will be copied to one of eight available slots of an internal clipboard When objects have been selected the Copy to Clipboard command Edit Copy to Clipboard or using Ctrl C will bring up the following dialog box V 6 7 E Section 11 Hybrid Editor in the VP HybridCAD Window 209 7 sottelec E VPraster pro VPraster VPraster LT Clipboard Choose Clipboard Entry G CR C3 CR CR CE ww Cg Cancel
43. license holder shall have the option to purchase Limited Warranty softelec warrants that the media containing the software is free from defects in material and workmanship This limited warranty is valid for a period of ninety 90 days from the date of delivery as evidenced by a copy of receipt provided any faults or defects that may in spite of the care taken in manufacture become apparent are reported to softelec within thirty 30 days of their occurrence The only entitlement granted by this warranty is repair or replacement of the supplied product at the sole discretion of softelec Regardless of the nature of any damage or loss in any way connected with the software sole and exclusive liability to be borne by softelec shall not exceed the purchase price of the product THIS PROGRAM IS PROVIDED AS IS SOFTELEC SPECIFICALLY DISCLAIMS ALL OTHER WARRANTIES EXPRESSED OR IMPLIED INCLUDING BUT NOT LIMITED TO IMPLIED WARRANTIES FOR MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE WITH RESPECT TO DEFECTS IN THE CD DISKETTE HARDLOCK OR DOCUMENTATION AND THE SOFTWARE LICENSE GRANTED HEREIN IN PARTICULAR AND WITHOUT LIMITING OPERATION OF THE SOFTWARE LICENSE WITH RESPECT TO ANY PARTICULAR APPLICATION USE OR PURPOSE IN NO EVENT SHALL SOFTELEC BE LIABLE FOR ANY LOSS OF PROFIT OR ANY OTHER COMMERCIAL DAMAGE INCLUDING BUT NOT LIMITED TO SPECIAL INCIDENTAL CONSEQUENTIAL OR OTHER DAMAGES U S Government Use This software and documentation
44. meet your drawing needs and should be saved with a new name The files are located in the SUPPORT subdirectory and are loaded into the first four positions General Tab These parameters control the amount of line straightening angle correction line chaining gap jump and grid snap V 6 7 E Section 10 Raster to Vector Conversion Vectorization 191 7 sottelec E VPraster pro VPraster Straightening VPraster LT This parameter influences the quality of line straightening as well as circle ellipse and arc extraction The following options are available None Weak Medium Strong The None setting passes raw vector data on as uncorrected post processed data While this setting achieves the highest degree of precision in the correspondence of raster structure and vector data the recognition and extraction of geometric elements is not possible This setting is recommended for artistic artwork such as logos Strong This setting forces the extraction of as many long straight lines long 2 point lines circles and arcs as possible The tolerance range is expanded to favor a greater degree of extraction particularly for architectural and engineering drawings Weak or Medium This setting aims for a compromise between the extraction of lines circles and arcs versus congruence with the raster image This usually leads to the generation of a larger number of fragmented line segments or for instance arcs instead of a circle e
45. moved up and down to scale the frequency bars of the histogram This option is intended for a better view of small frequencies Clicking the right mouse button and moving the mouse activates the window select mode in the Histogram View Each color inside the selection window will toggle from selected to unselected and vice versa When clicking on a color bar the color s frequency in the entire image is displayed in the Pixels area in Percent or as an Absolute value Colors that are in the palette but do not appear in the image unused colors are displayed in different ways In the Histogram they are displayed without a frequency bar In the button array unused colors are indicated by a circle on the action area Double clicking on a color bar opens the standard Windows Colors dialog box for selection 144 Section7 Color Reduction Color Separation Color Classification Filters V 6 7 E 7 sottelec E VPraster pro E VPraster VPraster LT A context sensitive popup menu can be opened by clicking the right mouse button The available functions are the same as those accessible through the Combine Modify Color s Export and Explode buttons See below for more information on using these functions The popup menu command Mark unused adds all unused colors to the list of selected colors Cancel Menu closes the menu without action Automatic Reduction The palette s total number of colors and the number of colors actually used
46. relevant text attributes Attributes Insertion Point V 6 7 E This function can only be accessed when a new block definition is being created and attributes can be assigned A dialog box appears in which you can move the insertion point change the block definition s layer and set attributes lf Convert Text into Attribute Definitions is activated a dialog box appears first for each text so that you can set the attribute definition see New Attributes m Layer of Block Reference BLOCKS DI m Attributes Insertion Point ISCH 7 Style IN v Default v Prompt Angle New Attribute elete Gffntote Cancel If Insertion Point is highlighted in the selection list it can be moved using the mouse the insertion point snaps to line ends and intersection points If an attribute definition is highlighted in the selection list the corresponding text is highlighted in color and has handles for moving and rotating In addition the parameters are displayed in the corresponding fields and can be changed as desired Clicking OK Cancel returns you to the Block dialog box A new block definition is provided in either case By choosing Cancel any changes made to the insertion point and attribute definitions are undone The button Attribute Insertion Point and the block name field are now inactive Clicking on OK again finally transfers the block definition into the drawing s database Section12 Blocks 225
47. results in immediate reinterpretation of the text at a calculated search angle 05x45 Text 0 Dads T Upside Down Text Angle 0 0 T Fixed Angle Start Point xy 236 47 173 61 Text Style Ir DI bh 3 50 Lauer TEXT Se Color BYLAYER v OK Cancel Ox Clicking on OK enters the data the text is displayed in the selected text style and the selected vector elements are deleted Combine to Dimension Combines the selected elements lines dimension arrows text of a measurement 7 to a dimension block and transfers the block into the layer DIMENSION Please note the sequence in which you select the lines Select the dimension line first then the extension line s In any case a text string must be included in the selection 220 Section 11 Hybrid Editor in the VP HybridCAD Window V 6 7 E 7 sottelec E VPraster pro VPraster Combine to Block VPraster LT Fl The selected elements are combined to form a block A dialog box appears in which you can enter a block name of your choice Block name STAIR X Offset x y joo om Scaling x y fo ho Angle on Lauer jeLockss V Convert Texts into Attribute Definitions Attrib lnsert Cancel The last used block name is suggested and its geometry displayed When you accept it OK the selected elements are replaced by this block If you enter a new block name the geometry of the selected elements is displayed Click OK to form t
48. screen In the event that not all symbols are found or none at all try getting better results by varying the selected patterns in the prototype generation If all fails because of a poor drawing manually create blocks using the Block icon Deskewing is not necessary since you specified a deskew angle of zero degrees No real explanation necessary However if you also invoked the speckle command etc it will be aborted Do speckle removal separately 242 Appendix Error Messages Scanner Interface V 6 7 7E 7 sottelec E VPraster pro E VPraster E VPraster LT Error loading classification The classification could not be loaded the process was aborted The file may be corrupt Try to load again Error loading probes The probes could not be loaded the process was aborted The file may be corrupt Try to load again Error opening file The file could not be loaded try loading file again Error saving classification The classification could not be saved the process was aborted Try to save again Error saving probes The probes could not be saved the process was aborted Try to save again Error writing to palette file The palette file could not be saved the action was aborted Try another file name or disk File error reading signature The file you have tried to load has valid extension but was not generated with VP HybridCAD software Invalid file signature The given file is not a valid raster ima
49. single color automatically This is based upon probes taken from the image and then extracting the color pattern information into class information Imagine a scanned map having many shades of blue colors that represent water areas In order to reduce the number of these different blue tone patterns they will be gathered then classified automatically and assigned as a single class with the color BLUE At the end this color will be given a title nickname to symbolize water areas in the map Hence now the color graphic information has been simplified such as blue for water brown for land green for vegetation red for streets black for text and so on To attain a proper automatic classification you need to initially set the program to the colors you want to assign as these color group classes This is done by assigning color probes from representative areas in the image The program will then process and generalize this information to be used for the entire image The operational steps are described as follows Classification Select a color or gray scale raster file as Active Image and call Classification from the VP HybridCAD Color Tools menu or click this icon At the command prompt enter vprclassify The Classification dialog appears Classification Active Class m Probes of Active Class i Text 2 Probes Min Certainty 97 7 D Probe2 Certainty 99 6 D New Modify Class Remove Probe Load Probes
50. sottelec E VPraster pro VPraster VPraster LT The System Default values Shown in brackets can be re activated when clicking on the white on black and black on white buttons respectively Program Settings General Colors Shortcuts Preview Category Window Background Color Palette WW black on white white on black Shortcuts Tab Program Settings xi General Colors Shortcuts Characters Cancel For frequent insertions you can set up to 24 ASCII character strings as character shortcuts which are not available from a direct keyboard entry While entering or correcting text strings use Alt 1 thru Alt 9 and Alt A thru Alt O to read them back See also Appendix A Default shortcuts See above Dialog Box A For Advanced Windows Users You can also change the keys for reading back your special characters Use the registry editor regedit exe in your windows directory and search for the key HKEY CURRENT_USER Software softelec VPraster pro vp Shortkeys Modify the key names in the Map erase the old name and then enter a new one All modifications you made to the key names imply appropriate modifications in the Special Keys with key values from 1 to 24 If you are not familiar with modifying the Windows registry we strongly advise you not to attempt the above procedure 108 Section4 General Functions V 6 7 E 7 sottelec E VPraster pro VPraster Toolbars VPrast
51. that will be added to the bottom and top of the current drawing Copy the raster image with the AutoCAD copy command and place the copy in the upper part of the drawing Rotate the raster by 180 degrees position it at the top edge of the component and adjust it to the center line Select the lower raster image and move it to the bottom edge of the component just the way you did with the first object Execute the rasterization process with the default settings Rasterize only Vector Objects All and Delete Objects after Rasterization V 6 7 E Section3 Tutorial 37 7 sottelec E VPraster pro E VPraster VPraster LT In its final design the edited component should look like this 38 Section3 Tutorial V 6 7 E 7 sottelec Lesson Two Il Raster Objects complex i VPraster pro Editing VPraster LT During this lesson you will learn how to e edit complex raster structures e modify raster text Preparation Start with a new drawing and import the raster file BEARING TIF from the TUTORIAL directory V67 E Section3 Tutorial 39 7 sottelec E VPraster pro E VPraster Erase Raster VPraster LT Select Raster The hatch and lines of the cut section in the drawing at the lower right will be erased The center lines of the circle should remain Zoom in to the lower right section an g Click on the Raster Erase icon command line vprerase and select the mode Ye Select Polygon Draw a polygo
52. this command to combine individual See polyline segments e g on a map to a single polyline See also Section 4 Combine to Spline ag Combines the selected elements to a B spline See also Section 4 Combine to Arc Combines selected elements to an arc Combine to Circle Combines selected elements into a circle a Combine to Ellipse Combines selected elements to an ellipse Al Combine to Text Interactive Text Recognition Transfers the selected elements usually a window selection to the text 4 recognition routine Preferably those text passages which were not or only incompletely converted during automatic text recognition are selected It is possible to include previously interpreted text in the selection CH P A text recognition dialog box appears displaying a section of the selected raster area so you can check the process V 6 7 E Section 11 Hybrid Editor in the VP HybridCAD Window 219 7 sottelec E VPraster pro VPraster VPraster LT Recognized text appears in the Text window where it can be edited if desired Other values provided are Text Angle Start Point Text Style Layer and Color These values can be changed as well The Upside Down check box allows you to rotate the text by 180 The Fixed Angle check box freezes the search angle for subsequent operations to the set Text Angle The values for Layer Text Style and Color will also be kept Deactivating this option
53. to create a new element the new element is calculated according to the method of the least square error For example the outer end points of two lines being joined are not necessarily identical to the endpoints of the new line By applying the Regeneration command all elements which originally ended on the individual lines are drawn to the new line If elements with differing properties e g layer or line type are combined the properties of the resulting object are determined by the most important i e largest element There are two basic methods for combining elements Select the elements first then click on the function icon single call e Select the function by clicking on the icon then select the elements and complete the function by pressing Enter The function remains active for a subsequent operation multiple call Combine to Line Combines the selected elements to a single line The angle of the resulting line is d the mean angle of the combined elements Arcs can be combined to lines as well Combine to Ortho Line Combines the selected elements to an orthogonal line This function can be used to deskew individual non orthogonal lines 218 Section 11 Hybrid Editor in the VP HybridCAD Window V 6 7 E 7 sottelec E VPraster pro S VPraster Combine to Polyline VPraster LT Combines the selected elements to a polyline With the exception of lines any d element is exploded into its raw vectors Use
54. which stopped the transformation The speckle size is too large It can have a maximum value of number pixels The despeckling function limits the size of speckles and holes that can be found automatically Only objects consisting of less than number pixels can be found There are already vector data present in the vectorization area Do you want to clear them first Where you want to execute multiple vectorization commands on the same drawing the system keeps track of the vectorization areas in order to avoid overlaying vector data Click Yes if you want to delete previously generated vectors In some cases however it may be useful to obtain multiple vectorized data on top of each other for example generated by different vectorization methods Then click No to keep them V 6 7 7E Appendix Error Messages Scanner Interface 245 7 sottelec E VPraster pro E VPraster E VPraster LT There are too many elements selected The hatch processor can only handle 100 vector objects The area you want to hatch is too complex Try to simplify it using the Combine to commands This drawing is too large for the demo version If you choose Yes you will be asked to cut out a window click in the middle of a 1800 x 1200 Pixel large area you want to work on If you choose No you won t be able to use any VP HybridCAD function This is a limitation of the demo version of the VP HybridCAD software You can only process a small par
55. will be displayed in the Automatic field In the edit field you can enter the desired number of colors the palette should contain after the automatic reduction After Execute the image will be updated and displayed in the preview dialog window with the reduced color palette Undo and Redo will undo or redo the individual reduction steps This way you can test the effects of reduction on a varying number of colors For best results do not make a big reduction in the number of colors at AN one time but instead take several reduction steps As a suggestion choose 32 then 16 From here you can combine specific colors for additional reduction If the reduction leads to unwanted results use the Undo or Reset button and decrease the number of colors again from that point on Color Filling The cursor in the Preview is changed to a fill cursor to fill areas in the image with one single color The output color is automatically calculated Unwanted results can be discarded using Undo V 6 7 E Section 7 Color Reduction Color Separation Color Classification Filters 145 7 sottelec E VPraster pro g S W VPraster Interactive Color Separation VPraster LT There are two ways for picking a color Either by clicking on the respective button in the Histogram View or by clicking on an image pixel in the Preview In the latter the cursor appears as a pipette The selected color is indicated by the inverse pressed button state in the
56. without any security pal challenge User Change Password registered users only Changes a user s password A tl MonitorUser may only change his own password Change Password Ed SOFTELEC_DOMAIN Username Administrator Administrator Password EE Password Confirmation ez V 6 7 E Section2 Installation 21 7 sottelec E VPraster pro E VPraster E VPraster LT new user of the selected type either of type Administrator or MonitorUser will be created With the activated option On All Servers the system will try to newly register the user on all servers listed bearing his registration The password default is the user name Create registered Administrator users only Depending on the selected option a SOFTELEC_ DOMAIN Username Huber Password ES Password i Contitmatiors M On All Servers Administrator Cancel Delete only registered Administrator users have access to this command A dialog box appears to delete users from the user list All registered server users are displayed Deletion will not invoke any security challenges Delete User Administrator HAW KEYE Administrator Huber HAMEL YE Monitor Meier HAW KEYE Administrator Monitor ser HAE YE Monitor 22 Section Installation V 6 7 E 7 sottelec E VPraster pro E VPraster Section 3 This section applies to MVPraster LT Tutorial This tutorial has been designed to guide and teach you ho
57. 00 01 etc During the consecutive saving of all files the system adds two digits to the base name from 0 to 4 max defining the position of the split file in correspondence with the original file First digit Horizontal position Second digit Vertical position The origin 00 resides at the upper left After all files have been saved they will be deleted from memory Section 8 Rubber Sheeting Split Merge 175 7 sottelec E VPraster pro E VPraster Merge two Files VPraster LT Two raster files even having different raster data formats can be merged into one file Gol At the command prompt enter vormerge In order to allow subsequent editing and processing the maximum size of the merged file can not exceed the following values Total width max 64 000 pixels Total length max 64 000 pixels Total area 4 billion pixels y The process always merges the Active Image with one raster object The system requests to select one raster file and loads it A dialog box appears to select the appropriate merging method Adjust Object Merge m Mode C Cut Edge E Draw edade M Update View IT Opaque Cancel As is merges the two files as they are displayed on screen Move allows the raster object to be moved with respect to the first loaded raster file without scaling and or rotation according to one moving vector Then both files are merged Fit calls for two moving vectors whereby the raster obje
58. 229 ONS EE 229 e RE 230 CE AIO AUG EE 230 EE 233 Jermiove NNNnnn Nnnna 233 Eege 233 V 6 7 E Table of Content IX 7 sottelec E VPraster pro E VPraster E VPraster LT SPECIFICA KT LE 235 APPENDIX A ERROR AND SYSTEM MEGGSAGES REENEN EEN 241 APPENDIX B SCANNER INTERFACE cccceeeeeeeeeeeeee eee eeeeee ee eeeeeeeeeeeeaaeeeeeeeeeeeaaaes 251 INDEX SE 257 X Table of Content V 6 7 E 7 sottelec E VPraster pro E VPraster Section 1 This section applies to MVPraster LT Introduction Welcome to the World of Raster and Vector Congratulations on your VP HybridCAD software purchase from softelec a specialist and market leader in raster to vector conversion and hybrid editing software for the PC Since its introduction in 1990 VP HybridCAD software has constantly been improved for quality and productivity New algorithms and programming techniques have resulted in extraordinary quality improvements including needle pegging conversion speeds Our VP HybridCAD technology assures that you are obtaining the finest in professional products for your scanning archiving raster and vector editing and conversion applications What is VP HybridCAD and who needs It V 6 7 E The importance of raster data processing has seen notable growth in the field of CAD Legacy information such as o d drawings and technical documents often found as paper copies blueprints transparencies or come as gray level and color im
59. 9 COMPING TO S PING easesicnadanstainasncsnanctensivenaitenatainetvasnantenasivnsinetianatanstanatnbiionstieuneainetaatineatiensiaesnbdlansiacuianal 219 Combine to Text Interactive Text RECOQGNITION cccccccseeceseecseeceeeecseeceeceneeeseesaeeeaeeeesessaeesaeeees 219 Combined Mouse Keyboard Operation cccssccsseccsecceeecseccseeteeeceueecseesaeecegeeegeeteeeeeeeeeseesaeetaeeess 101 CUO Wie CS EE 184 GOOG E 115 CY I E EE 209 CO SUD EEN 122 CODY tO CIP DOAN EE 209 Conect Hate Di E 212 Create New EE Eege 92 Create Raster OID OC EE 122 Create Raster Object Erase Backoroundl ANNER 122 Create Add SYM Ol icesesonsivnessaveosscesionsiretcanaineainmacnetbanniuedivmscssiunsiioadermananidelnibasliebanaioadwntiounvbauwoeaness 230 Creating BIOCK S ea ie tersarecic ec tenceces das su naires euivaceeinose E ENEE E AEAEE E EE AEE AAE EE EAG 223 E CN 136 Eege EE 206 CUT TO Faper el E 174 V 67 E Index 257 7 sottelec E VPraster pro E VPraster E VPraster LT COEVI OY E 136 Default RE 107 EE ee 208 Delete Raster Background WE 98 DES ROV aneen E E aE EE A A EES 136 Dimension ATOW EEN 216 DIED UE 102 ren e 105 DONUT stietegge eegen 216 Draw Elements into Raster cccccccceccececcececueecueueaususaueusaueuseuaueevaueusaueusaueusaueusaveusevausevauseeaueesaneess 131 Bekaa aa fe TE 115 Reuter 106 Bif ite Ale in EE 98 Edit Raster FUNCTIONS EE 121 lte E 215 Enable Full Versio sincera te tees on coanrenidaw swan soonnse
60. 90 Hatch Angle ariane Line Distance Cancel General The following settings apply to all drawing functions Zoom n on first click on off In on position while in the drawing mode the software zooms in on the first mouse click of a set point for more precise positioning second mouse click Zoom Factor specifies the factor of zooming in from the current zoom state Default off Default Zoom Factor 1 4 Transparency Transparency is not available in VPraster pro V 6 7 E Section4 General Functions 117 7 sottelec E VPraster pro VPraster Polyline VPraster LT As Multiline on off In on position a new polyline will be drawn only of independent 2 point lines Each line can be assigned to different layer color and linetype while drawing Default off Create Block from Polyline on off After drawing a polyline this polyline becomes a block The Block Prototype is a dummy block reference not the geometry from which all its attributes are copied to the block The default block prototype AREA for example has the attributes CIRCUMFERENCE and AREA with the default values Circumference and Area assigned to it These attribute values are automatically calculated User defined Block Prototypes can be created with other attributes Default off Default Block Prototype AREA Allow Line Picking on off When activated existing lines or polylines can be picked which then become a vert
61. At the command prompt enter vprsp it You can split the Active Image into a maximum of 25 sections by positioning up to four horizontal and four vertical split lines on the drawing Each section is then saved into a separate raster file This function is especially useful to split large raster files which cannot be pro cessed in their original size The maximum size of the raster file to be split is Horizontal 64 000 pixels Vertical Unlimited When executing this command a box appears with operational instructions Then the raster file to be split must be selected and loaded A dialog box appears to define the number of horizontal and the number of vertical sections Sections Horizontal 3 Sections Vertical 2 Cancel If more than the maximum of 5 sections for each direction are selected an error message appears The status line calls for positioning of the first horizontal split line Follow these steps for positioning all horizontal and then vertical split lines e Click where the first line should be positioned e The split line appears in green e Clicking with the right button cancel deletes the last split line and you can reposition it e Continue until all horizontal and vertical lines have been selected Click once again after positioning the last line for total confirmation e Then you are requested to enter the base file name for all split files containing six characters max Two digits will be appended as
62. Command 193 0175 154 5829 0 0000 SNAP GRID ORTHO POLAR OSNAP OTRACK LWT MODEL Toolbars The VP HybridCAD toolbars can be handled like the AutoCAD toolbars except for the VPraster tools toolbar Additional removed VP HybridCAD toolbars can be reactivated with menu commands From the VP HybridCAD main menu open the submenu Show Toolbars A list of all VP HybridCAD toolbars is displayed select the toolbar you want to reactivate 24 Section3 Tutorial V 6 7 E 7 sottelec E VPraster pro E VPraster Move Toolbars W VPraster LT To move a toolbar into a new position click and hold the left mouse button on the edge of the toolbar Now drag the toolbar to any position on the screen When releasing the mouse button the bar will be set to this position The bar will appear as a separate window bearing a title bar when placed in the workspace When placed on the upper left right or lower frame it will be added to the toolbar space Using VP HybridCAD commands There three possibilities to call a VP HybridCAD function 1 The VP HybridCAD Menu This menu contains all VP HybridCAD commands 2 VP toolbars Most of the VP HybridCAD functions can be activated by clicking the corresponding icon of a VP toolbar Some toolbars are designed in flyout style i e you can only see one icon of this toolbar the last selected at a time 3 Command line Each VP HybridCAD function can be called via command line inpu
63. E VPraster pro E VPraster Add to Selection VPraster LT If this button is pressed subsequent selections are added to the current object Remove from Selection D If this button is pressed subsequent selections are removed from the current object Undo Last Raster Selection Undo s the last selection or de selection command Confirm Raster Selection Enter This icon or Enter ends the raster selection and proceeds in the current raster object function Raster Text Allows for interpretation and modification of raster text in the loaded raster image At the Command prompt enter vprdtext Window 3 Points lt Rectangle gt First Corner Draw a rectangle 2 points for capturing the raster text or type w to capture rotated raster text 3 points The original raster text will be selected for further processing according to the selection window All raster information within the rectangle will be transferred to the OCR using default settings 128 Section 5 Hybrid Editor for Raster Vector Data V 6 7 7E 7 sottelec E VPraster pro E VPraster VPraster LT Then a dialog box for text verification and modification appears Edit Raster Text Shortcuts 56 Text Angle fo 0 Start Point 105 24 52 35 Text Style 4 sl h 5 00 IV Rasterize Text M Show Text before Rasterizing M Create Vector Text cancel _ In the dialog box you can modify the text and any of the text properties A max
64. ES VALUE r Exchange Block RES R6 SPIN 205K Scaling 1 00 Y Scaling fi 00 Searching Parameters V 6 7 E If several different prototypes have been set up for a search the search tolerance values can be set individually for each prototype by using the Struct selection box The individual search structures are displayed Tolerance defines the permissible tolerance range for a search Range 5 thru 75 Default 15 Section 13 Symbol Search Replacement 233 7 sottelec E VPraster pro VPraster VPraster LT Max Gap is the largest break e g open line segments in the symbol contour in pixels that will be tolerated during a search Range 1 thru 20 Pixels Default 3 Pixels The values displayed have been calculated by the program during creation of the prototype Recommended minimum settings are Tolerance 15 and Max Gap 3 Pixels Exchange Block A different exchange block can be assigned to the prototype i e to all of its search structures All blocks contained in the drawing are available Use X Scaling and Y Scaling to adapt a block to the geometric requirements of the Original Please ensure that the block s connection shape and size correspond to the search symbol 234 Section 13 Symbol Search Replacement V 6 7 7E 7 sottelec E VPraster pro E VPraster Specifications This section applies to MVPraster LT General VPraster Series Input Formats Raster
65. Histogram View The color selected first will be the Target Color thus receiving a highlighted frame and a flashing action area To deselect a color click on the corresponding color button or click on a pixel of the respective color in the Preview while pressing the Shift key lf the Target Color is deselected all other selected colors will be deselected The Color edit fields display the target color s RGB values the CMY values are indicated in brackets When a single color has been picked the color s frequency in the original will be displayed in the Pixels field When several colors have been picked their frequency sum will be indicated in Percent or in Absolute values Preview The preview options apply to the Preview window On activates the preview Selected colors are marked in the Preview with the Target Color Flash toggles the view of the selected colors on and off automatically For better distinction False Color can be selected which shows the selected colors not in the target color but in a special complementary color Combine Picking several colors and then combining them to one identical color Target Color will reduce the number of colors The Target Color icon indicates the color the selected colors will be combined to Clicking on the icon a new target color can be specified in a color dialog box The icon will appear in pushed state with a highlighted frame When in pushed state a repeated click on the
66. Mode on off After tracing a polyline or spline a dashed line between the cursor and the end of the trace entity appears indicating that the next element to be traced will be appended For example if you have broken raster lines this option allows to easily combine trace elements Clicking the right mouse button will interrupt the Append Mode to start a new line lf Zoom to Line End is on the system automatically zooms in to the end of the last traced line This will help to find the next line to continue with Default off Trace Only One Direction on off lf Trace Only One Direction is on the selected line will only be traced in one selected direction After clicking the raster line for tracing two direction arrows will be displayed for selection of the trace direction Then tracing starts Default off Produce Splines on off Generate splines instead of polylines Default off V 6 7 E Section9 Interactive Tracing 181 7 sottelec Pick Trace Tab E VPraster pro E VPraster VPraster LT Trace Settings x Contour Trace Pick Trace Vectorization Method Centerline Vectorization C Outline Yectorization 15 Gi Line Chaining M Line Chaining T Create Splines Only Along Outlines Even Across Intersections m Straightening C None D Weak C Medium C Strong Artifacts m Gap Jump MV Remove Artifacts M Gap Jump 0 10 Vectorization Method Select Centerline Vectorization for tracing along
67. Next a line will be drawn over a fragmented raster line Zoom into the area around the upper horizontal measure line 33 This line s raster representation is interrupted at several positions Activate the Dynamic Width option command line vprpickwidth and start the function Draw Line command line vprdline Set the starting point of the new line on the left part of the measure line the width of the new line is adapted to this part Click on the opposite part of the measure line to place the end point there and end the function Move Raster The left vertical dimensioning string 55 is to be placed on the left side of the dimensioning line Zoom in to this area and click on Move Raster command line vprmove Mark the string selection mode Select Rectangle and end the selection Move the raster object left of the dimensioning line 74 Section Tutorial V 6 7 E 7 sottelec E VPraster pro VPraster Vectorizing the Raster File VPraster LT The edited raster file is to be vectorized Click on Vectorize command line vprvec to open the vectorization window of VPraster pro Praster pro Edit Entities Vectorize Display Options Help Switch to AutoCAD ajej Also elolelelgalclfShy al H o IN 2 pay slk J Zlu le m 22 163 295 717 SINISE ft 1 12 13 14 15 Te For Help press F1 0 selected 12 31 fe Raw Data Vectorization Vectorize In the respective dialo
68. Praster LT When choosing Linear Color Map conversion will be executed according to the standard color palette When choosing Computed Color Map a prescan will follow to define the existing colors in your actual original Out of these colors an individual color palette will be set up In the selection box the desired maximum number can be specified The dialog box disappears with OK followed by the prescan and the calculation of the color palette Then the selected function Scan Forward will be executed After every Stop action in the scan menu or when reaching the document end the current calculated palette will no longer be valid By repeating the scan action a new palette will be recalculated and assigned If you switch from Forward to Scan directly though the same palette will be used g Colors Gray Scale If the Active Image is an indexed color or grayscale raster image select the Color Reduction command from the VP HybridCAD Color Tools pull down menu bar or click on this icon At the command prompt enter vprreduce The dialog box for color manipulation appears containing the histogram of the existing colors in the raster image to improve the color presentation no frequency bars will be displayed for more than 48 colors Histogram Press lt SHIFT gt to deselect colors in previe indo EN r Automatic Color R G B C M Y Tones fom B tof Colors 8 Colors used Es 229 76 026 026 179 Le E Modify Co
69. Praster LT Ei Clicking on the icon or invoking the function brings up the following dialog box Yectorization m ectorization Method Centerline C Outline E Exact C Centerline Outline Threshold fis 4 f Area fe Whole Drawing C Rectangular Area Polygon Area Cancel Choose the vectorization method and vectorization area Vectorization Method Three vectorization methods are available e Centerline Vectorization e Outline Vectorization e Centerline Outline Vectorization Centerline Vectorization The middle centerlines of each raster structure is determined by thinning inward from the edges and displayed as line chains consisting of individual line segments In the case of raster structures with an area of more than 62 pixels centerline vectorization switches to outline vectorization for the remaining area e g after thinning inwards 62 pixels these remaining raster structures are represented by contours using line chains Centerline vectorization is the best vectorization method for technical drawings In order to avoid objects from hollowing out when using centerline do not scan above 600 dpi Raster line widths can easily exceed the 62 pixel threshold 188 Section 10 Raster to Vector Conversion Vectorization V 6 7 E 7 sottelec E VPraster pro VPraster Outline Vectorization VPraster LT Converts the contours of raster structures to line chains creating line structur
70. Praster LT The grid structure of the points in our example prompts for using the grid snap on second point method first In the Rubber Sheet Settings dialog box Rubber Sheet Settings E4 Setup User Coordinate System IT Raster Snap on first point k Automatic zoom Factor M Coordinate Snap From File Grid snap on second point x 100 000 IT Different grid y ao Grid Angle so T Show grid during input I Cut Window Cancel mark the options Grid Snap on second point set the grid distance to 100 00 and Automatic zoom Factor set factor to 1 2 Click OK The main dialog box Rubber Sheeting opens Rubber Sheeting S Function Helmen 2 Points sl Grid UCS Enit Fa belete a T Input Points Errors Load Save WE Cancel Since Grid Snap has been chosen a grid will be overlaying the whole raster image with the specified spacing This grid correlates with the origin At the grid s line intersections the reference points are expected At this stage of processing the grid is visible and can easily be modified e g if you see that the grid distance does not match with the raster image s reference points just click on Grid UCS and adjust the grid settings Now activate the Input Points option to start entering reference points The grid display will be switched off for a better view of the raster while the grid s functional significance is still active V 6 7 E Section 3 Tut
71. RACING cccccceccecseseereeeereeseeeereeeenes 179 Gen ral JEE ee 179 TACO SOCIO ee 180 C ntour WOT AD E 180 PICK MEAG Wa EE 182 EE 184 C ntour TAC ee 184 C nlour Ti aAC OTIC TEE 185 EELER 185 E Ee 186 SOP cc ol E 186 V67 E Table of Content VII 7 sottelec E VPraster pro E VPraster E VPraster LT SECTION 10 OPERATION RASTER TO VECTOR CONVERSION PEC TO k 891 187 General Information ccccccccceceecceccuscueeeeueeuseusaueueeusausaueaueuueueausaueausaueueeueausausaueueauseeeueeueeueausas 187 Vectorizing Generation Of Raw Vectors REENEN ENER 188 Vectorizaion IV CLOG E 188 PON a ee 189 POSE PIO COSSIING E 190 Faramieters POSE FI OCCSSING E 190 PRO CIV CT AONN WE 201 SECTION 11 OPERATION HYBRID EDITOR IN THE VP HYBRIDCAD WINDOW 203 General det 203 RE 203 OD CCE EE 203 Beie 204 Orthogonal Drowing aeyn aE TA a 204 Erase Raster Ctrl E under vectorsl 204 Eeer 205 Ondo Iir Z EE 205 FOO Eege 205 Redraw CUl R NEE 205 General Editing Erres ite cosets cts Sege EE EE SE Ek 206 Explode e ee TEE 206 E 206 WV ECOL EE 206 Ee 206 PROV OW EE 207 EE NBS eege 208 Layer Ee Il ET EE 208 Ene TYPE SICA ICEL EE 208 Text Style Aesignment NEEN 209 MOVE POD E 209 COPY Obiectisl AN 209 GODY to COD Card CUI EE 209 Paste from Clipboard Ctrl V cccccccccccsccseecceeceeeeeeeeeeeeeeeueeeeeeseseueeaeesseseueeeueesesaueseeseeesaeenaeees 210 Last Selecon CUl TL i E a A A E a 210 eer LA
72. Symbol Search Symbols can also be searched for and converted into blocks even with associated attributes First the search symbol prototype is created by selecting one or several target symbols which is then saved as a prototype symbol file and used for the search and replacement of matching objects The symbol files become a part of the user s library 8 Section Introduction V 6 7 E 7 sottelec E VPraster pro E VPraster Tracing Line Following VPraster LT The tracing module provides interactive and selectable raster to vector conversion of raster entities or areas Options include the generating of CAD entities lines circles etc or outlines polylines splines The latter is important in GIS ap plications The underlying raster of a traced element can be erased automatically if necessary H VPraster pro E VPraster Gray Scale and Color Processing E VPraster LT V 6 7 E Very simple yet powerful functions are available for color and gray scale images conversion reduction and manipulation Special classification algorithms provide for color pattern recognition assigning a new color to a selected pattern area The intelligent picking applies not only to B W structures but also to a color or a color pattern Section1 Introduction 9 7 sottelec E VPraster pro E VPraster Concept of this manual BR VPraster LT This manual has been organized to help you to quickly find operation terms commands and d
73. The Contour Trace function can only create polylines and splines The Contour Trace Linetype function when selected generates dashed polylines and splines Calling one of these functions opens a dialog to specify the work area for tracing Trace Work Area EN Work Area C Keep Current Work Area Ge Select Image as Work Area C Select Rectangular Work Area m Artifacts fe Standard MV Remove Artifacts C Size 4 Cancel You can select either Keep Current Work Area if a working area has already been selected or Set New Work Area if no working area is specified or a new area should be defined Select Image as Work Area The entire image becomes the new work area Select Rectangular Work Area The size of the new work area has to be specified by drawing a rectangle on screen The selected work area is prepared for tracing and marked with a colored rectangle Remove Artifacts When activated short line segments artifacts which would lead to a branch stop are removed upon preparation of the work area This function can take some time to run on large files Apart from the Standard setting you can also specify a maximum Size of artifacts to be removed This value is a fictitious value in the range 1 to 9 Section9 Interactive Tracing 179 7 sottelec E VPraster pro E VPraster VPraster LT Pick Trace can be used to trace along connected areas in B W images or along areas of minor color vari
74. VPraster Select columns WE VPraster LT Enter the columns of the X and Y coordinates which you can read from the head line of the displayed list Default X 1 Default Y 2 Input of Reference Points After completing the rubber sheeting set up a dialog box appears prompting the entry of reference points and choice of a rubber sheeting function If Grid Snap on second point has been switched on a grid appears displaying the reference net that need to be specified Use Grid UCS to properly adjust the grid s fitting The grid will be displayed until the Input Points checkbox is activated Input Points on off V 6 7 E Rubber Sheeting 7376 Fa40 gt 79 78 9941 Enor UU Function E Points sl Grid UCS Edit Paint Delete Se Errors Load Save Io Cancel The input of reference points can be switched on or off The checkbox is switched off by default When switched on the program is ready for input of reference points When Automatic Zoom and Grid Snap are selected the origin as set in the user coordinate system will be zoomed in to position the first actual point The program jumps to the origin If the origin has not been set on the first reference point the program zooms in to the lower left corner of the raster file default Origin You must search for the first point With a click on the actual point the target point will then be set automatically to the next grid point In the dialog box both t
75. a E E iea e Ee E OE E 126 V 6 7 E Table of Content V 7 sottelec E VPraster pro E VPraster E VPraster LT Select Rectangle E 126 Select Inside WiINndoW cccecceceececcecceceeceucceeeuseueuceeueuseuceueaueuueususeusuueueeusaueuueeueuseusausaueueeusaneas 127 POKE GME M EE 127 LE t EE 128 ei EE 130 MII ED dd glod 131 EE 131 EE eben 131 Ee 131 L t e 132 Ee 132 Erase Raster FUNCtiIONS cccccccecceceececeecueeuscuseeeueeusausaueaeeusausausaueueeusausausaueueeusausausaueuteusauss 133 Erase EE 133 E AC occ cpeeetenieesysauenaiaesswaninsaeasiiyeia A a uaielenieneign ventana 133 SO EE 133 FS E 133 Erase Eben 133 SECTION 6 OPERATION RASTER FILE EDITING ccccccceceececeecececeececeeceeeeeers 135 General Information ccccceceececeeceeccuscueeeeueeuscusaueueeuseusausaueueeusausaueeueueeueausaueueaueausausaueeeeutausas 135 Raster Functions deebegeede gedeien gedeien e dese 135 PAE RE 135 SEH 136 EEN 136 CO EE 136 DSO eeh EE een 136 TA VOTE ue Eeer 137 PROTA FIT E 137 EE EE 138 EE IVI OF visectinouincutcestnasanniennstswstioatinmetneaiamatiansanasknnnidontieadinmetncniamaieasenarknavisunteotinmetncelienrens 138 Remove Speckles B W files only 138 EE EE EE 140 GC lO Drawing E 140 SECTION 7 OPERATION COLOR REDUCTION COLOR SEPARATION COLOR CLASSIFICATION FILTERS csccceccceeecseeeseecseeeasecaeeeaeesaees 141 NS A eens esac sss ae re ee vt eebe 141 Scanning ONS ieee
76. a point or enter a value E VPraster pro WE VPraster VPraster LT Scans a drawing into AutoCAD At the command prompt enter vprscan 92 Section4 General Functions V 6 7 E 7 sottelec E VPraster pro E VPraster VPraster LT Large format scanners can be operated directly from within the program Depending on the type of scanner a corresponding dialog box opens to enter the essential parameter settings according to the respective scanner s specifications For more information regarding supported scanners and their operation see the Appendix Beach Dist site Neat San Pedro Pt Ki Pedro Pt Dist Wes SS Gen ga Backw sie cose Scan Mode Color 256 colors D Scan Width User defined sl Resolution 400 optical 400 IT Scan to File hi Sansa Browse T Palette E Brave B amp w Options Enhancements B amp W Options p Color amp Grayscale Options I Line Enhancement Threshold EE Brightness 4 Dymanie enhanc Adaptive Level E Contrast bo Backar Suppr fp Blur jo Dialog Box used for CONTEX Scanners WE VPraster pro VPraster Show Raster Image Info W VPraster LT A Dialog pops up showing all information about a selected raster image or the Active Image At the command prompt enter vprimageinfo Select Image lt Active Imager gt Select a raster image or press Enter Rasterize Entities Rasterizes vector entities into the Active Image At the command prompt enter vprplot
77. active disable the raster snap by clicking the Raster Snap icon D command line vprsnap Now mark the starting point of the reference line by clicking in the center of the corner The frame box reappears with the reference line s free end attached to it The program automatically zooms out to the general view Click on the upper right corner and mark the end point of the reference line in the center of this corner The edit process deskewing and mirroring starts immediately The image will be mirrored and deskewed Deskew and Mirror Method 2 For cleaning the raster file despeckling and deskewing you may use the function Auto Cleanup instead my Again Open the same original file and click on Auto Cleanup The raster data are automatically despeckled and deskewed Speckles which could be dots e g parts of decimal numbers or small lines from dashed lines etc remain unerased To finally mirror the file click on this icon and select Vertica Mirror or select a the function Vertical Mirror from the flyout Scaling The raster image is going to be scaled to fit to AutoCAD units At this time only the display of the raster image will be scaled not the raster file itself Therefore we will use the AutoCAD scale command 28 Section Tutorial V 6 7 E Editing the Raster Image 7 sottelec E VPraster pro E VPraster E VPraster LT By measuring the kitchen s width and length and by comparing the results
78. age will appear In this case more reference points ought to be entered or a lower function should be selected Button Functions V 6 7 E Save allows saving of reference values and settings to a file extension RYP preferably in the raster file s directory You also can export a text file extension TXT containing all information of the current rubber sheeting setup for documentation e g reference point coordinates Load will load a RYP file to continue with rubber sheeting operation Error Statistics opens an info box showing error statistics Number of Points 14 May Error 0 545042 E Min Error 0 013210 4 Mean Error 0 207040 May a Error 0 526507 E Mas r Error 0 223293 12 Delete Point deletes the current reference point Edit Point opens another dialog box to edit a reference point Grid UCS returns to the rubber sheeting settings Cancel will terminate rubber sheeting operations at any time OK starts the rubber sheeting After completion the corrected file will be displayed containing yellow and green cross signs to review the accuracy of rubber sheeting Termination with OK The new file should be saved Section8 Rubber Sheeting Split Merge 171 7 sottelec E VPraster pro E VPraster Rubber Sheeting of Technical Drawings E VPraster LT Cut to Paper Format Quick Calibration This function operates on the Active Image and is especially designed for rubber sheeting of technical drawings
79. ages photographs films color prints Redrawing them manually into CAD using CAD functions or a digitizer is very time consuming can be inaccurate and costly To overcome these drawbacks scanners for small and large formats are used to generate raster data digital photographs from legacy documents which can then be quickly converted to CAD entities VP HybridCAD is a family of software products with advanced raster editing capabilities as both stand alone and for use inside AutoCAD In addition image data can be converted into intelligent vectors your CAD system understands As an application to AutoCAD and or AutoCAD LT VPraster series software is capable of loading hybrid editing plotting and saving raster data of black white color or gray scale images RasterDWG is a true AutoCAD DWG format that contains both vector and raster data Raster can be in color gray scale or black and white A freeware utility called RasterDWG RDWG once installed into AutoCAD is all that is required to load view and plot the raster entities while in AutoCAD No more broken links to external image references because with RasterDWG it s all in a single file VP HybridCAD applications are for e Architects structural and civil engineers regional and interregional planning departments and facilities equipment and maintenance e Mechanical design and process engineering e Cartography and GIS applications in general Section1 Introduction 1 7
80. al filter options to be defined for the current original With three five and seven you can switch between the available filter sizes If a matrix size applies to a filter it will be listed in the list box Otherwise the filter will not be listed and the matrix elements receive a 0 default value Rotate 90 rotates the displayed filter a quarter turn clockwise Rotate 90 rotates the displayed filter a quarter turn counter clockwise Rotate 45 rotates the displayed filter an eighth turn clockwise Rotate 45 rotates the displayed filter an eighth turn counter clockwise The selection list provides for the selection of the available filters New opens a dialog box where a filter name that does not yet exist in the matrix size s setting may be entered No wildcard character will be accepted in the name If there are more than 13 characters entered the name will be truncated to this length automatically The list box will now display the name with a character at the end meaning the filter has not yet been saved Save will save the current filter to the registry The character disappears Delete removes the displayed filter Filters bearing the same name will be overwritten except those with different sizes The Same Average check box provides for a selection whether the filter s coefficient should be weighted in a way that the average value in the original remains unaffected This option has no meaning for filters bearing a c
81. al interpretative intelligence becomes evident with vector post processing Based on the topology of raw vector data it applies tolerance criteria and comparative interpretation techniques to recognize and extract lines circles arcs and higher elements such as text symbols blocks and hatch This process is controlled by parameter settings that can be adjusted to achieve the best possible result E VPraster pro E VPraster Product Features E VPraster LT The VPraster series of VP HybridCAD consists of powerful ARX applications to both AutoCAD R14 2000 and or AutoCAD LT 97 98 2000 In joint operation with the CAD system they provide the most efficient way to process and edit raster and vector data Moreover all CAD data e g raster and vector data can be saved in one hybrid DWG file RasterDWG Importantly this will ease the file administration and the exchange of hybrid drawings with other companies All VP HybridCAD software products are based on the most advanced 32 bit programming methods They also feature a high standard in user friendly operation and the integration into AutoCAD leaving no considerable difference in processing either vectors or raster General Raster Data Handling 6 Section 1 One or more raster files B W gray level or color can be imported or loaded as an external reference to a standard AutoCAD R14 DWG file or loaded from a RasterDWG file A hybrid drawing can be plotted with the standard AutoCAD
82. alog Scan Eow Halt Backw Cose gt Scan Mode Color 256 colors sl Scan Width User defined la Resolution 200 200 I Scan to File Browse IT Palette Keup Browse BA Options Enhancements Bw Options i FE line Enhancement Threshold fp E Dynamic Enhance Adaptive Level 25 a M Adentive Threshold Backgr Suppr fp Above screen interface may not always be available with WideCom scanners Functions The upper area of the dialog is divided into two areas Left window Display of zoomed area scaled 1 1 Right window Overview window A small frame indicates which area is currently displayed in the left window Buttons Scan Start scan Forw Prescan forwards Halt Halt prescan rocker mode Backw Prescan backwards Stop Stop scan Close Close scan dialog V 6 7 E Appendix Error Messages Scanner Interface 253 7 sottelec E VPraster pro E VPraster VPraster LT General Functions Scan Mode Sets the current scan mode B W gray scale and color Scan Width Depending on scanner type Format and or Variable With CalComp Oc Contex scanners e Variable Paper is left or right aligned e Format Paper is centered Scan Width is set according to scale on scanner Resolution Depending on scanner type fixed and or variable Scan to File Scan directly to file Palette Scan using a previously generated palette only in color mode Black White Options Depending on the scanner type the follo
83. also bearing transitions between the last two digits is to be replaced by the background color white i e both colors are going to be combined Zoom in the Preview to the number 10002 in the lower left section of the drawing To combine colors the following steps are necessary e select the target color e select the colors which should be combined with the target color e execute the Combine command In this case the bright red color should be combined with the white color to white so the white color is the target color V 6 7 E Section 3 Tutorial 61 7 sottelec 62 Section 3 E VPraster pro E VPraster VPraster LT To select the white color click on the white background raster with the pipette cursor in the Histogram the white color label below the bar appears to be recessed Being the first selection target color the color will be assigned a highlighted frame a flashing action area and displayed in the Target Color icon The RGB and CMY values are displayed in the Color field You can undo your selection of individual colors by either pressing the Shift key and clicking on the same raster pixel again or by clicking the color label in the Histogram dialog box Clicking on the first color you have selected highlighted frame the entire selection will be undone Add the light red tone between the digits to your selection by clicking with the pipette on one of the pixels As the Preview option is activated
84. anager server If this fails the user will be prompted to enter the password for a specific server Default Server This menu item allows for assigning the VPLicenseManager server to a local workstation for providing a network license if available Usually the client will after the first start up search the entire network environment for a VPLicenseManager server If this fails either by error or intention this option allows for entering a requested server for providing a license authorization If access to this server is denied or all licenses are exploited the network will be searched continuously for any other available VPLicenseManager service Installation V 6 7 E 7 sottelec E VPraster pro E VPraster E VPraster LT Choose Standard Server EN Standard Server SOFTELE C_DOMAIN Cancel The server can be selected from the list of existing servers Search Servers This function starts a new search for servers throughout the entire Ji network In general this will only become necessary if a new VPLicenseManager server has been added to the list and thus cannot be displayed yet Alternatively a server name can also be entered directly Server Add Server Add Server The entered server is added to the list It will be displayed in red if no VPLicenseManager server could be found on this computer Enter name of server S0FTELEC_DOMAIN Cancel Remove Server A selected server will be deleted from the list
85. and from top to bottom according to the Histogram View The selected color is exploded into its colors from the previous reduction step automatically or manually The colors remain selected and the Target Color shows the combined color Unwanted colors can be deselected as described above Load opens the load dialog for loading a color reduced palette VP Palette Included in this file are the image s original and reduced palettes You can only load a color reduced palette if the original palette and the saved reduced palette match In case you want to apply a certain color reduced palette to several scanned images you always have to scan to the same palette in order to use this feature Section 7 Color Reduction Color Separation Color Classification Filters 147 7 sottelec E VPraster pro E VPraster Save VPraster LT Save opens the save dialog for saving a color reduced palette VP Palette You can load the palette with Load in this dialog in the Scan dialog or with Raster Co or Load Palette Reset Reset will undo all modifications on the color palette and on filled areas It restores the original palette file In this case Redo will not be available Cancel Cancel will close the dialog box without changes to the original image Convert The conversion changes the original pixel values of the image if you choose the option Change Pixels This way not only the palette but every pixel in the image can be changed You sho
86. and when recessed with a lighter background it is active Moving a Circle Click on the dash dotted magenta center circle in the top view Two handles appear one containing a cross marks the center point of the circle the other one the radius Click with the left mouse button on the center point handle and keep the button pressed Now you can move the circle move it into the intersection of the two axes Release the mouse button and deselect the entity with a click on the right mouse button Create a New Hatch Click on the Hatch icon and select the outer and inner cyan circles in the top view of the spring object Then press the Enter key the spring s sectional view will be hatched Exit from this function by clicking the Hatch icon again V67 E Section3 Tutorial 81 7 sottelec E VPraster pro VPraster VPraster LT The vectorized and edited drawing is now completed Switch back to AutoCAD 7 Click on this icon or select Switch to AutoCAD from the menu to switch back to Ae the AutoCAD main window All vector data is transferred to the actual drawing H VPraster pro E VPraster End of Tutorial Going Ahead M VPraster LT We highly recommend that you review and edit our other sample raster files It is very important that you become familiar with VP HybridCAD software After a little practice you will become expert in determining the optimum methods and system settings Good Success with VP HybridCAD sof
87. angle This rectangle also defines the area of deletion in the current image Then edit the text in the dialog box on OK the rectangle area will be erased and the new text rasterized Zoom in to the dimension text 56 at the lower area of the drawing and start the function Draw Text command line vprdtext Since this is a horizontal text use the 2 Point rectangle default Drag the rectangle around the text starting at the lower left corner The dialog Edit Raster Text opens displaying the selected area with the raster text rotated if necessary so that the text appears horizontal and its OCR interpretation Modify the text to 74 and activate the option Show Text before Rasterizing This option allows to move position and scale the text after the dialog has been closed with OK The new text is placed as a raster object on top of the original text now erased Click the right mouse key to confirm the final position then the new text appears in the drawing The same way modify the following dimensioning numbers Originalno Newno 37 50 With some of the text strings having an angle you need to select them with a 3 Point rectangle Before clicking choose the Window option from the command line then click in the lower left corner of the text The second click specifies the angle and width of the text lower right corner the third click defines the text height upper right corner At the end the completed drawing looks lik
88. aps between individual line structures become too large the function will stop In this case you will have to start at a new line piece whereby the cursor is connected by a line to the end of the previous line indicating the append mode Go on this way until the end of the dashed raster line It is new converted into one dashed vector line End the trace mode For better display of the dashed polylines change the properties of each polyline by marking the LT Gen option CAD Tracing D 56 Section 3 CAD elements like lines circles and arcs can be vectorized as entities directly when using the CAD Trace function Call this function command line vprcadtrace and keep the current work area The needle and thread cursor appears Click on the drilling circle on the lower left The circle will be recognized and drawn automatically Now click on the upper drilling circle Only an arc will be recognized for the drilling has not been drawn all through originally To add the remaining fractions keep the Shift key pressed and pick all circle fractions successively Proceed the same way with the other drilling circles in the center section and on the lower left Tutorial V 6 7 E 7 sottelec E VPraster pro W VPraster VPraster LT Switch off the Raster Display for a better view of the vector data end the trace EN mode before Now the drawing should look like this Save the drawing as BEARING_1 DWG Editing Raster by Tracing
89. ar sample VPraster and the software then operates in the demo mode AutoCAD AN No Hardlock found or hardlock does not contain appropriate user license Starting Praster as Demoversion V 6 7 E Section 3 Tutorial 23 7 sottelec E VPraster pro E VPraster E VPraster LT A For VP HybridCAD Demos only A hardlock containing a license is not required However the maximum file size that can be edited using VP HybridCAD functions is limited to approx 1800 x 1200 pixels After importing a raster file larger than the limits and starting any VP command a message appears asking for the positioning mouse click the center point of a window to be cut out of the image for further processing This cut area can be fully processed with all VP commands including exporting to all supported formats Click the VP icon to start AutoCAD AutoCAD LT with the VP HybridCAD application The AutoCAD main window appears including the VP menu entry and the VP toolbars depending on the installed VP HybridCAD software The sample below shows AutoCAD 2000 with VPraster pro wf AutoCAD 2000 Drawing dwg EB faa File Edit View Insert Format Tools Draw Dimension Modify Window Help YP HybridCAD OSE SQ8 SROs CoO chs KBD eteaR es S B SS of Geo m ByLayer ByLayer mail ByLayer cl ByColor lol ele ell Bl slefole Ei gt a CEET EECH POR F8HOVONTOLSSN g ININELANPASCHBOBLR Command _options Command
90. aster Settings VPraster LT dialog box Click on the tab Contour Trace and set the Straightening option to Weak You can experiment with these values later Stronger settings will reduce number of vertices found that results in straighter lines such as found in mechanical drawings However a weak setting is advised for contour drawings for accurate contour replication ei Click the Trace Settings icon command line vprstrace to open the respective Trace Settings EN Contour Trace Pick Trace Straightening Tools M Show Zoom Window IT Assign Elevation Append Mode e Zoom te Wine Bad Medium C Strong T Trace Only One Direction T Produce Splines Leave the dialog box with OK Tracing Contours We are going to vectorize only the contours of the drawing s component To trace the contours click the Trace Contours icon in the Trace Mode flyout Ai toolbar command line vprtrace A dialog box comes up asking you to define a SE work area Trace Work Area EN Work Area C Keep Current Work Area Select Image as Work Area C Select Rectangular Work Area Artifacts Standard M Remove Artifacts C Size MS Cancel 54 Section3 Tutorial V 6 7 E 7 sottelec E VPraster pro E VPraster VPraster LT Close this dialog with OK to work on the entire image The work area will now be prepared for tracing As long as the contour trace function is activated
91. at line intersections e g as they occur in electrical and electronic wiring diagrams As with the recognition of dimension arrows the degree of recognition depends on the straightening parameter The user can set the donut diameter but the vectors in whole or selected must be post processed again to reflect the changed diameter Default 1 0 mm or 0 039 inch Ellipses on off Ellipses with an eccentricity greater than the set value are extracted Eccentricity is the degree of the ellipse s deviation from a circle the smaller the value the greater the likelihood that circles will be recognized as ellipses A Only horizontal ellipses will be recognized In order to increase the recognition quality for ellipses circle recognition should be turned off for example in the case of isometric representations which tend not to contain circles Default 0 10 198 Section10 Raster to Vector Conversion Vectorization V 6 7 E 7 sottelec E VPraster pro VPraster Blocks Tab VPraster LT This is where you specify extraction parameters for elements to be saved as blocks Parameters Post Processing EN General Basic Advanced Blocks Layers p Parameter Set Ce Mech M Hatching Opec Max Line Distance 8 00 Ground Angle Range 25 0 degrees at C Geo 45 0 45 0 45 0 degrees Untitled C Untitled IT Symbols C Untitled Prototypes C Untitled Cancel Load a Reset
92. at you do not reduce colors until you have completed classification of colors This will assure best construction of the color classification Pick Probe In Pick Probe select whether to take an Area probe a bucket cursor appears or Line Text structure probe a pipette cursor appears To pick a probe click with the left mouse button on the image The probe will be displayed in magenta hence do not use magenta as a class color If the picked probe is not appropriate for a specific class click the right mouse button to discard it or click on the button Remove Probe Pick one or more probes for each class 150 Section7 Color Reduction Color Separation Color Classification Filters V 6 7 E 7 sottelec E VPraster pro E VPraster Process Classification Reeg V 6 7 E Continue with Process Probes until all assigned probes have been taken The generated color classification is likely to generate bad results if the progress bar appears for a very long or a very short period of time After a color classification has been generated you can test it in a suitable area of the image with Test Classification The dialog disappears and the program prompts for a window selection for testing the classification in this area The results will be displayed You can cancel the selected test areas by pressing Test Areas Clear or you can suppress them temporarily with the Test Areas Show checkmark switched off For a better view you can
93. ata is saved to a raster file specified in the Save dialog You can select different raster file formats RasterDWG This command creates a DWG file containing all vector entities and raster data in one file The path of any previously inserted raster image will be deleted We will use the RasterDWG format From the VP HybridCAD menu select Save as RasterDWG or click this icon command line vprsaverdwg Save the file as ARCH_1 DWG Editing the Raster File Now the Active Image raster file is going to be vertically mirrored and deskewed Deskew and Mirror Method 1 V 6 7 E Click the icon Raster File Edit All command line vprrfe The dialog box Raster File Edit appears offering several editing options Raster File Edit T Cut Window l Crop M Deskew T Horizontal Mirror Invert Rotate CG t Reference for Rotation Horizontal 0 0 C North LU m Speckles Black Speckle Dirt Size fo Pick from White Speckle Hole Size jo Pick from OK Cancel DE Section 3 Tutorial 27 7 sottelec E VPraster pro E VPraster E VPraster LT Please mark Deskew and Vertical Mirror and click OK Next a reference line has to be defined to deskew the drawing accordingly In the workspace the mouse cursor appears as a triple frame box to indicate a zoom action with the next mouse click Click on the lower right corner of the floor plan The area around the frame box will be zoomed in If
94. ations in color images Pick Trace does not need a valid work area to be specified Delete Raster Background icon before tracing During tracing the raster elements Es To automatically erase raster elements following the tracing routine click the are covered with the screen s background color Trace Settings To edit trace settings click this button or choose the command Trace Options from the VP HybridCAD Tracing pull down menu bar The dialog box opens to define trace settings At the command prompt enter vprstrace Contour Trace Tab Contour Trace Pick Trace Tools IY Show Zoom Window Assign Elevation IT Append Mode Strong zoom te Line End l Trace Only One Direction Produce Splines cancel _ Straightening By setting the tolerance to Straightening Strong you can reduce the number of vertices This is particularly useful if you want to reduce the amount of data or the processing time required for long splines Default Weak 180 Section9 Interactive Tracing V 6 7 E 7 sottelec E VPraster pro E VPraster Tools VPraster LT Show Zoom Window on off During tracing a zoom window appears at branch points to provide an enlarged view for selecting the continuing direction of the trace Default on Assign Elevation on off After tracing a polyline or a spline you are prompted for an elevation This option can be useful to create 3D models of a contour map Default off Append
95. ave Reset T Line Chaining 190 Section 10 Raster to Vector Conversion Vectorization V 6 7 E 7 sottelec E VPraster pro VPraster VPraster LT The five tabs General Basic Advanced Blocks Layers are used for setting all parameters which control the post processing of vector data To obtain best results the parameter values should be adjusted to the requirements of the drawing on hand Using Save and Load parameter settings can be saved for later use By default settings are saved in the SUPPORT subdirectory with a PCF extension and can be loaded into one of the 8 parameter fields The selected parameter file overwrites all parameters with those stored in the file If a parameter value is changed manually the name of the active parameter file is set in parentheses Reset restores all parameter values to their default settings and deletes the parameter file name replacing it with Untitled Standard Parameter Files VP HybridCAD software includes four parameter combinations created for Originals of the following types e Mechanical MECH PCF e Architecture ARCH PCF e Cadastral maps GROUND PCF e Geological maps GEO PCF These four default parameter files are matched for sample images included in this installation and should not be used without modifications as defaults for your own drawings within this classification However these parameter files can be easily modified to
96. ave selected for loading is not recognized as a valid file format If the file for example is a valid TIFF file but without the extension TIF you can use the alias extensions described in Appendix B to be able to load the file Unsupported color information V 6 7 E The given file contains an unsupported color information Please use a conversion program that generates one of the following supported formats Extension TIF NIF PCX Format B W 256 colors paletted true color B W 256 colors paletted true color B W 256 colors paletted true color CAL MIL GP4 CG4 CIT IG4 RST B W RLC RLE C4 GIF BMP TPE LSR CRL JPG B W B W 256 colors paletted B W 16 colors 256 colors true color 256 colors paletted 256 colors paletted true color Appendix Error Messages Scanner Interface 247 7 sottelec E VPraster pro E VPraster E VPraster LT Update of Hardlock not possible More than one softelec Hardlock is connected to this computer None of the hardlocks currently connected to your computer is able to run this Version of VP HybridCAD If you have an update password for one or more of these hardlocks only one hardlock can be updated at a time Disconnect all other hardlocks but the one with the serial number according to your update password and try to start VP HybridCAD again Then follow the instructions Contact your dealer or softelec for assistance Warning Your reference po
97. aw a line to determine the text start point first click and its direction Use the Shift key for orthogonal placement A dialog box appears for text entry Shortcuts TEXT He 1 80 wh 0 70 S Cancel Use the text font to set text height and the width ratio as well Enter preset special characters under Options Settings Shortcuts using Alt 1 thru Alt 9 or Alt A thru Alt O or the menu item Shortcuts Dimension Arrow For placing a dimension arrow at the end of a dimension line first selection which la intersects with or ends on an extension line second selection The point ends at the second line See CAD Options regarding arrowhead size Pointing Arrow For placing a pointing arrow onto a line First mouse click selects the line on which you wish to place the arrowhead Second mouse click sets the position of the arrowhead See CAD Options regarding arrowhead size Donut For placing a donut at the selected position on a line In the area of line intersections or forks it is placed precisely at this position if it lies within range of cursor snap Donut size is determined by the active post processing parameter setup 216 Section 11 Hybrid Editor in the VP HybridCAD Window V 6 7 E 7 sottelec E VPraster pro VPraster Hatch Fill VPraster LT After selecting this function select the bordering lines in sequence Pressing Enter creates the hatch or fill solids inside the borders in accorda
98. below the hardlock driver and the hardlock dongle must be installed on the same computer Registration Fill out the attached registration form completely and legibly best done during installation and send it or fax it back to softelec You will receive technical support and update upgrade notices provided ou have properly registered VP HybridCAD software with softelec Registration of VP HybridCAD products with your VAR or reseller does not constitute proper registration and will prevent you from _ obtaining software support or immediate upgrades even those free of charge Uninstalling V 6 7 E To remove VP HybridCAD software from your computer click on the icon Uninstall If you have installed the same VP HybridCAD product twice without uninstalling the previous one only the last VP installation will be removed The hardlock driver will not be removed If the driver is not required by any other program you can remove it from the Driver list in the Control Panel Section 2 Installation 15 7 sottelec E VPraster pro E VPraster Updating Upgrading Patching E VPraster LT Software upgrades to a higher level VP HybridCAD product or updates to a new release of the same VP HybridCAD product may require a password that is issued to you upon purchase After installing the upgrade or update and starting it for the first time you will be asked to enter the password After successful entry the password can
99. by default the Preview immediately reflects the change in the image Activate the Flash option You see the Preview changing automatically between the Preview on and off state Thus you see the pixels being affected by the Combine command much better Verify that important information will not be lost in the image by zooming back to the general view It is easier to notice immediate changes when the Flash option is activated Click on Combine all selected colors will be combined to the target color Alternatively you can use the context sensitive popup menu click on the right mouse button in the Preview or the Histogram field Keep the changes the way they are Zoom in very close to an area of the image where a blue and a black raster line cross Both lines include a light gray tone Detect the exact color tones by clicking to both edges with the Pipette cursor In the Histogram dialog box you will see that only one color tone has been selected Both edges bear the same color tone so they cannot be combined to either blue or black Otherwise the black line would receive a blue edge and vice versa Solution combine to white with the background color Deselect the color and proceed as described above First select white as the target color then light gray Combine both colors Just remember that the first selected color is always used as the reference color to which all subsequently picked colors will be converted into The blue line primari
100. c Select Circle Select Line and Select Inside Window are only available with B W images 2 De selection is only available with B W images E VPraster pro E VPraster Select Arc VPraster LT Generates an arc object through three points SS Select First Point Specify start point on arc Select Second Point Specify end point on arc Select Third Point Specify third point curvature and direction At the Command prompt enter a The raster structure under laying the arc is selected Crossing raster structures are ignored However when using the functions Create Raster Object Copy Raster Move Raster or Smooth Object the generated object is traced completely Select Circle Fe Generates a circle object through three points on the circle a The raster structure under laying the circle is selected Crossing raster structures are ignored However when using the functions Create Raster Object Copy Raster Move Raster or Smooth Object the generated object is traced complete ly Select First Point Specify first point on circle Select Second Point Specify second point on circle Select Third Point Specify third point on circle At the Command prompt enter c V 6 7 7E Section5 Hybrid Editor for Raster Vector Data 125 7 sottelec E VPraster pro E VPraster Select Line VPraster LT Generates an individual 2 point line The raster structure under laying the line is selected Crossing raster structures are ignored Howe
101. caren ape cs ton E 141 Reducing Colors tal ee eege 142 PEEV N a A 143 ANS COC IN E 144 VI Table of Content V 6 7 E 7 sottelec E VPraster pro E VPraster WE VPraster LT Automate Reductio EE 145 Interactive Color Se eparatiOM EE 146 ellide ETC ul TEEN 149 ST Se EE 149 ASST AU a E 149 Te Me de 150 reiege Ee le E 151 Filter FUNG de posse eres sacceetceceaceceneenesegenceaesentsne teeta nancestiaaesaeatoncenniesaeaceuasneancaseagenseaatasnsaneieeteer 152 et 152 el dE 155 NIE CRT Gel ENT 156 GENTA ee 156 Convert EE 156 RTR FOG MeN ON EE 156 Palette Transformation Table 161 Histogram Dialog Box DisplayS cccccccecseeeeeeeeeseeeeeeeeeesaeecaeeeeesaeesaeseeesanssaaseeesanesaeeaeesanes 162 SECTION 8 OPERATION RUBBER SHEETING SPLIT MERGE o an 163 Multi Point Rubber Sheeting EE 163 ee 163 Set Up User Coordinate System ccccssccsseccseecseccseeceeeceueecseeceeeegeeeaeeteeeeeseeeseetaeeeeessaes 165 Rubber Sheet Settings ccsecireccdscansusdsocoxsanssnccesanemexsaceeungeeaxtmpesncoianeeiareanecsoodsenuassesaeesondaeteuscecees 166 Input Of Reference Ponts 169 Rubber Sheeting of Technical Drawings Cut to Paper Formiat cccccsseeesseeeeeeeeeeeees 172 Quick Calilbration ccccccccccesccecsesceeceeeeseueeuueausauseuseuseuueaueaueaueaueeuseuueausaueauseuseuusuusaueausausauenausas 172 FS a GON AE E EE EE E E E E E E E EE 172 EEN 174 SE 175 Merge EE 176 SECTION 9 OPERATION INTERACTIVE T
102. cating that a TFW file cannot be created V 6 7 E Section 4 General Functions 91 7 sottelec E VPraster pro E VPraster Enable Multipage Support W VPraster LT Activate this check box if you want to create or modify an existing TIFF Multipage file If an existing file has been selected in the Export dialog and this option is enabled the Multipage dialog is displayed where you can choose to append the current image to the selected file or replace an existing page Save RasterDWG Saves the drawing as a RasterDWG file At the command prompt enter vprsaverdwg A dialog box opens for selecting the file name and a valid directory RasterDWG is a special VP HybridCAD DWG format saving all data of your current drawing i e vector and raster data into one DWG file Especially the raster images can be saved into the RasterDWG file Even if no VP HybridCAD application is installed to an AutoCAD this file can be loaded viewed and plotted in AutoCAD using our free RasterDWG driver RDWG This driver is part of your VP HybridCAD CD You can share it with any of your customers clients etc Create New Raster A new and empty raster image is created At the command prompt enter vprcreate New Image Color lt Black amp White gt Type c for color or press Enter Image Resolution dpi lt 400 gt Enter a value or press Enter Insertion Point lt 0 0 gt Specify a point enter a value or press Enter Other Corner Specify
103. ch_nw kirsch_s r kirsch_se S v kirsch_sw kirsch_w za KA laplace1 laplace2 laplace3 sharpen v Ce speckle 3d deeppress jigglevert woodcut Color Reduction Color Separation Color Classification Filters 155 7 sottelec E VPraster pro E VPraster Palette Transformation VPraster LT General A scanned image containing up to 256 colors or grayscales will be based on pixels carrying an index that is scaled from 0 to 255 This index represents a specific color by its portions of the three basic colors red green and blue each basic color having a value from 0 to 255 that have been assigned during the scan process to a palette Hence a palette is a table where each of the image s colors max 256 or less is assigned proportions of the basic red green and blue color i e RGB The transformation of such a palette compensates of possible scan weaknesses e g contrast or brightness or to modify an image s color representation to individual needs This is of even more importance if a color scanner or the original document is not available There are several palette transformation functions to choose from depending on how the image should look like after it is transformed However each transformation function will not change the index structure of the image palette but only the assigned values for the three basic colors Thus the original pixel information remains untouched Convert To Palette From the
104. ck If you enter a new block name that hasn t yet been used the geometry of the selected elements is displayed Clicking on OK creates a new block definition with this appearance and the selected elements are replaced by a block of this type The insertion point of the block reference is placed in the geometric center of the block structure Offset determines the position of the block in the drawing If the default is not modified via the keyboard or F2 the insertion point is calculated from the geometry of the selected elements and the block definition Defaults 0 0 Scaling and Angle determine the size and angular placement of the blocks when inserted The block definition itself remains unmodified and corresponds to its elements in location and size Defaults 1 1 0 Use Layer to assign a layer to the block Default layer BLOCKS 224 Section12 Blocks V 6 7 E 7 sottelec E VPraster pro VPraster VPraster LT Convert Text into Attribute Definitions on off This check box is only accessible when generating a new block definition and when text have been selected When this option is turned on the selected text is interpreted not as geometric block elements but as attribute text if Attributes Insertion Point is clicked afterwards and attribute names are assigned If the selected or newly created block definition contains attributes without fixed values clicking on OK will bring up a dialog box for entering the
105. cked set to on the target image will contain the standard color palette and colored raster or vector entities are rasterized in color Scaling allows to set a scale factor for the target raster image Paper Position places the raster and vector entities on the target raster image With Center raster and vector entities are positioned on the center of the paper Manually allows for an individual placement of the entities After closing the dialog with OK use the mouse to position the paper frame Clicking OK opens the dialog for specifying line widths for rasterization see above Raster File Edit A set of raster file editing functions such as despeckling cut window deskew etc are available See Section 6 E VPraster pro E VPraster Split Raster Image VPraster LT Splits the Active Image into several raster files See Section 8 At the command prompt enter vprsp it Merge Raster Image Merges a raster file with the Active Image See Section 8 be At the command prompt enter vormerge Cut to Paper Format Cuts a raster file fitting to a selected format See Section 8 At the command prompt enter vprcutformat 96 Section4 General Functions V 6 7 E 7 sottelec E VPraster pro E VPraster Rubber Sheeting W VPraster LT A set of rubber sheeting functions is available See Section 8 E VPraster pro VPraster Vectorize VPraster LT ATA Vectorization and a set of editing tools is available See below and Sectio
106. ct can be scaled moved and or rotated according to the two vectors with respect to the first loaded file Then both files are merged Cut Edge similar to Fit uses two moving vectors for fitting the second loaded file to the initial one The function cuts both images along a line through the target points of the two vectors Draw Edge on off allows for drawing a user defined line for cutting both images instead of the line through the target points 176 Section8 Rubber Sheeting Split Merge V 6 7 E 7 sottelec E VPraster pro E VPraster VPraster LT Update View updates the display after entering each of the moving vectors only with B W images If one or both files are colored the display will only be updated prior to the final confirmation The Opaque option is only functional on B W images It allows for non transparent overlaying of two files If the two files to be merged must fit very precisely to each other then both files should be rubber sheeted prior to the merging process After file selection the first being the Active Image the second loaded as a raster object the moving vector s one or two depending on the merge mode have to be drawn The cursor appears with a frame box to be positioned in the region of the starting point of the first moving vector on the raster object When clicking that point the area will be enlarged and the normal cursor appears allowing for a precise pick of the starting poin
107. ctly available via Alt 1 thru Alt 9 and Alt A thru Alt O or using Shortcuts if pre configured Note that vector elements to be replaced with text can be included by selecting those elements If you ve selected an element by mistake deselect it by Shift and clicking the highlighted element s On occasion you may want to deselect a true line element converted to text Simply delete the text to restore the Original vector s This is a form of exploding DJ A4 oom State Shortcuts eck Test Angle o o Start Pont 205 82 43 25 Text Stile rz F ne ele Color EYLAYER sl IT Show Text after Editing Explode Closer Fause If the check box Show Text after Editing is activated clicking on Next will display the current edited text which can then be positioned rotated and scaled as desired before moving to the next text element by clicking Next again Enter V 6 7 E Section 11 Hybrid Editor in the VP HybridCAD Window 207 7 sottelec E VPraster pro VPraster VPraster LT Use Next and Previous to sequentially browse and if necessary edit all text elements All changes are automatically accepted The operation is complete when all text elements have been checked Explode separates the selected elements into their raw vectors Close Pause ends the operation The next time this function is chosen the process continues at the text element you checked last which allows you to make other correcti
108. d is active on both D The Smooth Raster function can be activated if a B W raster file has been loaded black and white speckles At the command prompt enter vorsmooth Original Smooth Raster Scale Drawing At the Command prompt enter vprscale Allows to scale a raster drawing in sotropic or Non isotropic mode A dialog box opens to select the scaling method and to enter the required values Scale Drawing O OOOO O 1 00 hop 1 Norlsotropic xw TF sg C ho 11 00 Cancel When sotropic mode is selected the drawing will be scaled with equal values in x and y direction A scale rate can be entered Default value 1 1 actual value target value Non isotropic mode allows for different scaling values in x and y directions Default value x y 1 1 actual value target value 140 Section6 Raster File Editing V 6 7 E 7 sottelec E VPraster pro E VPraster Section 7 This section applies to VPraster LT Operation Color Reduction Color Separation Color Classification Filters General When color or gray scale originals are scanned with corresponding scanner devices you will get very large raster files and possibly containing millions of colors To process these files in CAD programs it is important to optimize the color and gray scale information This can be done either by reducing adjacent colors combining colors or by leveling color transitions to reduce the information
109. default values thus irrevocably deleting the previously contained data If you want to keep them you have to save the parameter data to a PCF file first This function deletes only data in memory not the corresponding file on disk An Error number occurred during the Hardlock conversion Please contact your dealer You have tried to update your hardlock but the error number has occurred Contact your dealer or softelec for assistance Block name already exists Do you want to redefine it The system checks for already existing blocks in the vector data base If it finds matching block names only the original or the imported block will be kept If you click on Yes all instances of this block in the drawing will be updated the next time the image is redrawn If you choose No however the block definition in the imported file will be ignored Cannot cut object The requested operation could not be performed on that vector type or block Cannot load name reason The given file could not be loaded for the given reason Therefore the current action will be aborted Correct the problem and try again Cannot open file name System error code number The given file cannot be loaded The specified system error code depends on the operating system Reasons for the load failure include corrupted files or insufficient physical memory If this message reappears while having at least 5MB of free memory at program startup you hav
110. ds all unused colors to the list of selected colors Cancel Menu closes the menu without action To move around the Preview you can use the scrollbars There are several zoom commands available Zoom Extents shows the entire image in the preview window This is the initial state when the dialog opens Zoom Window switches the cursor in the preview into a crosshair for an image area selection to zoom Zoom In and Zoom Out Section 7 Color Reduction Color Separation Color Classification Filters 143 7 sottelec E VPraster pro E VPraster VPraster LT Zoom Previous shows the previous view of the image Zoom Next shows the view before the Zoom Previous state Zoom 1 1 switches the cursor to a magnifier glass in the Preview Click the desired center of the view with the left mouse button j L2 Le Histogram View In this area the image colors are represented either as a Histogram if 48 or less colors remain or as an array of buttons with one button for each color of the current palette The buttons are for the selection of colors if not picked from the image and for controlling which colors have been selected The histogram s column heights indicate the frequency of each color present in the original There is also an action button below each color column Clicking the action button adds or removes this color to or from the list of selected colors When the Histogram is displayed the slider on the right can be
111. e Raster the generated object is traced completely First Corner Enter value or specify first point Other Corner Enter value or specify rectangle At the Command prompt enter w Pick Element V 6 7 E The cursor is replaced with a pipette The Pick Element functionality depends on the type of raster file Pick Raster Specify point on raster At the Command prompt enter e B W Raster File Clicking on the raster with the left mouse button all pixels connected to that point will be picked and hereby selected Pressing the Ctrl key during a picking operation will remove all pixels connected to that pick point from the current selection Color Raster File Clicking with the left mouse button will generate a mono colored area object depending on the environmental color pattern Minor color variations of areas or dithered areas color patterns will be combined to the selection The generated object will be selected The target color taken from the palette is the closest color to the average of all combined colors Clicking on the raster again another area will be generated using the same search pattern and the same target color The generated object will be added to the selection Since undesired results may occur Undo will reverse the last operation The Select Polygon and Select Window commands are disabled until the raster pick operation is concluded Section5 Hybrid Editor for Raster Vector Data 127 7 sottelec
112. e added to or subtracted from the elevation value at each following line Increasing or Decreasing determines whether the step value will be added or subtracted If Stop and Show each Polyline is on the assigning process will stop at each polyline displayed in white black color and the dialog box shows the actual elevation value in the field Start at Elevation for manual editing lf Stop and Show each Polyline is off the whole process is performed automatically Use Edit Properties Enter for reviewing and editing the assigned elevations Elevation determines the elevation value of the currently processed polyline spline Skip ignores the assignment for the currently processed polyline spline Clicking OK will move the assigned polyline spline into the layer ELEVATION and step to the next polyline spline of the selection 222 Section11 Hybrid Editor in the VP HybridCAD Window V 6 7 E 7 sottelec E VPraster pro VPraster Section 12 This section applies to VPraster LT Operation Blocks General Information E _ In the following sections it is well to understand the distinction between a block definition and a block e A block definition defines the geometric structure of a block as well as the number and types of its attributes A block definition is unique and is not part of the displayed drawing e A block is the image of a block definition at a given position It can be rotated and scaled isotropic and non is
113. e an effect on the X Y coordinate system and all values and parameter settings that depend on them 106 Section4 General Functions V 6 7 E 7 sottelec E VPraster pro VPraster Default Text Font VPraster LT Selection of the default text fonts for creation of text styles All existing and scaleable True Type Fonts in your Windows system can be chosen Default Font Arial Scanner Resolution A raster file s resolution is detected and displayed whenever it is loaded When restarted or after the New command the program defaults to the value set in the Image Tab Pick Box Size This setting controls the size of the cursor square box used when selecting elements pick area Default 8 pixels Auto Panning With Autopan switched on the system automatically pans the view while drawing a new entity and thereby getting close to the border of the work space The parameters Delay and Pan Size define the delay time and the percentage of the current view to be panned respectively Default off Default Pan Size 20 Default Delay 0 5 sec Color Tab These screen colors can be user set Screen color Screen color white on black black on white e Window background black white e Raster background black white e Raster foreground light gray black e Crosshair green black e Image Border blue black e Move Grip black white e Other Grips black white V 6 7 E Section 4 General Functions 107 7
114. e average diameter of circles to be found This diameter is assigned to all extracted small circles Default 1 5 mm or 0 047 inch Extend Lines to Center on off This option extends lines ending at the circle but pointing at the circle s center all the way to the center of a small circle Assign New on off A new diameter can be assigned to recognized circles Default 1 5 mm or 0 047 inch Replace by Block Entity on off Each recognized small circle will be replaced by a block Instead of the default block MPOINT any block can be used Section 10 Raster to Vector Conversion Vectorization 197 7 sottelec E VPraster pro VPraster Arrowheads on off VPraster LT Dimension arrow recognition requires filled dimension arrows in the raster data whose points touch a line extension line The length of dimension arrows can be set by the user The length width ratio is set to 3 The degree of recognition of dimension arrows depends to a great extent A on their random design size and surface shape in the original Occasionally arrowheads are recognized at line intersections even though none are actually present the lines are merely thicker in some places The degree of recognition is determined by the straightening parameter the greater this value the greater the chance that dimension arrows will be recognized Default 3 5 mm or 0 138 inch Donuts on off This option searches for filled circles
115. e dialog box Scale Drawing command line vprscale Select the isotropic scaling with the parameter 1 0 3 9 or 100 depending on your system setup and click OK to start the scaling Start the function Save Raster Image command line vprsave You are asked to select the raster image to be saved exported click on the border of the floor plan A save dialog opens enter ARCH2 as raster file name and select TIFF as file type Click OK to save the raster Section3 Tutorial 33 7 sottelec E VPraster pro E VPraster Lesson Two I Raster Objects VPraster LT The raster object functions provide the tools for editing even complex raster layouts They enable copy and cut functions for parts of the raster which can be edited later using the move rotate scale and delete commands During this lesson you will learn how to e cut and copy raster objects e paste raster objects from files Preparation Start with a new drawing and load the raster file FLANGE TIF from the TUTORIAL directory Save the drawing with the attached raster file using the AutoCAD command Save as command line SAVEAS as FLANGE_1 DWG the raster file as FLANGE_1 TIF The raster drawing will be edited in two steps First the drillings will be corrected followed by adding another raster from a second file 34 Section3 Tutorial V 6 7 E 7 sottelec E VPraster pro E VPraster Drawing Construction Lines VPraster LT Switch off the Erase Ra
116. e new insertion point or Enter for the actual position At the Command prompt enter vprcopy Copying raster areas between images with different colors will cause unexpected results Move Raster V 6 7 E After the Raster Selection process the raster object is positioned on top of the Original raster It can be moved rotated or scaled When confirming its final position it will be copied into the current raster image at the new position and the first selected object is deleted Select Base Point lt X Y gt Specify the base point or Enter for the default value center of the raster object Angle Scaling lt Second Point gt Type a for rotating or s for scaling if applicable or specify new insertion point Angle Angle lt 0 0 gt Enter value specifying the rotation angle or press Enter for 0 Scaling Scaling lt 1 0 gt Enter value specifying the scaling or press Enter for scale factor 1 0 Second Point lt Second Point gt Enter point specifying the new insertion point or Enter for the actual position Section5 Hybrid Editor for Raster Vector Data 123 7 sottelec E VPraster pro E VPraster E VPraster LT At the Command prompt enter vprmove During the selection process the selected raster structures may show interruptions at intersections with remaining entities These interruptions do not apply to the moved or copied raster object Moving raster areas between images with different color
117. e point list Then click the AutoCAD icon Redraw All to redraw the raster Tutorial V 6 7 E V 6 7 E 7 sottelec E VPraster pro E VPraster E VPraster LT Open the Rubber Sheet Settings dialog box with Grid UCS Switch off the Grid Snap on second point function and confirm with OK The cursor changes to a frame box Now click on the upper right reference point The point will be zoomed in according to the previous zoom settings Place the cursor into the center of that point Cross and click The Edit Point dialog box opens Adjust from 4405703 06 1362699 20 To 4405703 06 1362699 20 abscissa distance ordinate angle Cartesian Coordinate Polen Goordinate Onentatiars aek Ui l counter cock wise east k DEG C GRAD clack wiee onh ba C RAD HERR TD Begin with vie cartesian coordinates Cancel It shows the point s actual value and the target value For the target value enter 4485700 as x value and 5382700 as y value Confirm with OK Proceed with entering more reference points upper left x 4485500 y 5382700 lower left x 4485500 y 5382500 lower right x 4485700 y 5382500 center x 4485600 y 5382600 Just like working with a grid snap the transformation function will change depending on the number of points you have entered since you have entered fewer points now only the Linear function is selected To rubber sheet a map accurately you have to enter a suffici
118. e raster snap the active mode can be changed clockwise to a different snap mode using the TAB key The different snap modes are displayed with the symbols shown in the dialog box With Marker Size and Marker Color the symbols can modified accordingly Default Marker Size 6 pixels Marker Color Yellow 86 Section4 General Functions V 6 7 E 7 sottelec E VPraster pro E VPraster Colors Tab E VPraster LT Program Settings EN Raster Snap Modes Colors License Category Draw Objects Current Color Erase Objects Speckles Holes Color Palette The color of the following items can be modified default values in brackets e Active Image red e Speckles green Draw Objects green e Holes yellow e Erase Objects blue License Tab Program Settings E3 Raster Snap Modes Colors License Network License License Server softelec_domain l Enable Network Search Instal H erdlock Driver Enable Full Version on off Allows the permanent setting to a VP HybridCAD full version product Otherwise the software operates in the demo mode and does not search for a license hardlock lf there is a Network License available with License Server you can predefine where to search for a VP HybridCAD network license V 6 7 E Section 4 General Functions 87 7 sottelec E VPraster pro E VPraster Enable Network Search on off E VPraster LT If set on the whole network will be
119. e raw vectors separated through Text Selection Height are grouped and displayed in the layer Text as pseudo text Le empty ASCII strings showing the raw vectors in white color They can be edited especially replaced by any ASCII characters with the Review Text function 194 Section 10 Raster to Vector Conversion Vectorization V 6 7 E 7 sottelec E VPraster pro VPraster Text Recognition VPraster LT When active all raw vectors separated through Text Selection Height are interpreted using the OCR function and converted into ASCII text strings See also Options OCR Options Text Search Direction The search for different text orientation can be limited The more directions are enabled the longer the text interpretation process will take only available with Text Recognition Selections are e Only Horizontal e Horizontal and Vertical e Arbitrary Direction Arcs on off In order to avoid unwanted arc interpretations arc recognition is determined by the Min Angle and Min Radius parameters Minimum Angle Only arcs including a greater angle than the value entered are recognized as arcs For technical drawings the value should be set to at least 25 since shorter arcs seldom occur The angle limit does not apply to arcs having a very large radius Range 0 thru 90 Default 25 Minimum Radius Lower limit for arc extraction Arcs smaller than the value entered are extracted as line segments
120. e the cursor to the right until all three colors are selected window selection and Combine them Review the raster image to ensure that you will not lose or color distort any important information when using this reduction operation Save Reduction The color reduction is now completed The color reduction method used can be saved for use on other similar images Click the Save button of the Histogram dialog and name the file KAT VPL Leave the dialog with OK make sure that the convert option Change Pixels is activated and Color Separation deactivated The raster will be changed according to the previous reduction At this point a Redo is no longer possible Color Separation 64 Section 3 Instead of saving the raster file reload the file once again ignoring save warnings Open the Color Reduction dialog Raster Color Color Reduction and load the file KAT VPL using the Load command A color reduction will be performed according to the reduction information saved in the VPL file Our raster image has now been reduced to four colors Each of these colors can be exported and saved as individual black amp white raster files You are limited to a maximum of 16 exported files It is important to first reduce to this maximum limit of 16 or less colors Activate the convert option Color Separation and click on OK Then for each color a B W raster file will be generated and exported Enter KAT_1 as the base file name The name for each
121. e the original drawing order Insert a third block WB1 DWG and attach the block to the lower wall next to the door scaling X scale factor Y scale factor 1 0 rotation 0 0 Insert the same block again right next to the previous block To convert the inserted vector entities into the raster they have to be rasterized Click the icon ARasterize Entities command line vprp ot The dialog box Rasterize A opens All vector elements should be rasterized and thereafter deleted Select Rasterize only Vector Objects All and Delete Objects after Rasterization Rasterize EN Objects to Rasterize C Rasterize only Raster Objects IT Erase Mode Rasterize Raster and Vector Objects E All Vectors with Erase Mode Which Objects CG A Selection M Delete Objects after Rasterization Cancel 30 Section Tutorial V 6 7 E 7 sottelec E VPraster pro E VPraster E VPraster LT Close the Dialog with OK The next dialog box displays the line width for rasterization depending on the color of the entity Click OK to accept the settings and to start the rasterizing This will take some time depending on the speed of your computer The editing results should look like this Save the changes to ARCH_1 DWG E VPraster pro E VPraster Erase and Draw Raster Tools VPraster LT The door to the patio in the lower part of the floor plan is going to be replaced by a wall For this we will use VP HybridCAD
122. e this e IB Wi Tutorial V 6 7 E 7 sottelec E VPraster pro E VPraster Lesson Three Merging two Raster Files VPraster LT During this lesson you will learn how to merge two raster files to form a new one Loading the First Raster File ml Start with a new drawing and load the raster file SUPPLY_A TIF from the TUTORIAL directory Loading and Editing the Second Raster File vprmerge Choose the file SUPPLY_B TIF in the TUTORIAL directory from the Eh To load the second raster file click the Merge Raster Images icon command line hy e Import dialog box V 6 7 E Section3 Tutorial 45 7 sottelec E VPraster pro E VPraster VPraster LT The dialog box Adjust Object Merge appears The raster can be moved rotated and scaled Choose Fit and click OK the cursor appears as a frame box in the workspace as in the deskew operation learned earlier Now you must specify a first pick point place the frame box cursor at the upper left reference cross of the last inserted raster and click on the left mouse button The program zooms in to this position while the cursor changes into a crosshair display Specify the first merge point of the image to be moved by clicking on the cross center The first raster image will be zoomed out and the frame box cursor reappears with a rubber band line Clicking on the right mouse button will undo your last step Proceed in the same manner as described above to specify t
123. e to Paper Format Raster File Edit Split Raster Image Merge Raster Images Cut to paper Format Rubber Sheeting Vectorize Edit Raster Erase Raster Draw Raster Tracing Color Filter Raster Snap Delete Raster Background Auto Regenerate Show Raster Dynamic Width zoom Active Image Select Active Image Regenerate Tutorial About VP Hybrid AD V 6 7 E Section4 General Functions 85 7 sottelec H VPraster pro E VPraster Program Settings M VPraster LT Settings are available for Raster Snap Colors and License At the command prompt enter vprsettings Faster Snap Modes Colors Licenze Marker Size fE Marker Color Intersection O End Point CH IT Center Yellow sl o Quadrant Raster Snap Tab If Raster Snap is on the desired Raster Snap Modes can be activated by clicking the according check boxes There are five modes available e Nearest snaps to the nearest middle point of the raster element e Intersection snaps to the nearest intersection of the raster element e End Point snaps to the nearest end point of a raster element e Center snaps to the center of the nearest raster circle or arc e Quadrant snaps to a quadrant 0 90 180 270 of the nearest raster circle or arc The sensitive area of the Raster Snap about 200 by 200 pixels at the present mouse position is fixed preset to guarantee the optimal usability with a maximum of speed While using th
124. e to re install the file V 6 7 7E Appendix Error Messages Scanner Interface 241 7 sottelec E VPraster pro E VPraster E VPraster LT Cannot save name reason The given file could not be saved for the given reason Therefore the current action will be aborted Correct the problem and try again Color already used No changes It is not possible to change the entry of a palette to a value that already exists in this palette The modifications you have tried are discarded Corner creation not possible Cannot find a cross point inside the search area or wrong selection Select two lines or two arcs or one line and one arc or one polyline to close it only The operation could not be carried out logically Ensure that there are no additional objects accidentally selected such as a stray arc or a third line Could not trim Object has no crosspoint with reference object or wrong selection Selectable objects polylines lines arcs and circles only as reference object The operation requires that the trim line or the line to which other lines will be extended be selected first if not the command aborts with an error message Ensure that there are no additional objects accidentally selected that cannot be extended such as a circle count symbols found When the symbol search completes its search it displays the number of symbols found If required the Redraw command display these blocks as a different color on
125. ection at a branch this function allows you to undo the last trace segment performed e g up to the previous branch At the command prompt enter vprbtrace The Undo Trace icon appears grayed out when the function is not available Section9 Interactive Tracing 185 7 sottelec E VPraster pro E VPraster VPraster LT If you wish to undo the tracing of an entire line use the Edit Undo Ctrl Z command or click on this icon Pick Trace To activate this function click this button or choose the command Pick Trace from the VP HybridCAD Tracing pull down menu bar Pick Trace can be used to trace along connected areas in B W images or along areas of minor color variations in color images This area is traced along its outlines or centerlines producing lines and polylines or splines in the current layer At the command prompt enter vprptrace This function does not need a valid work area In colored images the considered area and thus the tracing result are highly dependent on the click point Stop Tracing To activate this function click this button or choose the command Stop Tracing EX from the VP HybridCAD Tracing pull down menu bar This function ends the current trace mode At the command prompt enter vpretrace 186 Section9 Interactive Tracing V 6 7 E 7 sottelec E VPraster pro m VPraster Section 10 This section applies to VPraster LT Operation Raster to Vector Conversion Vectorizat
126. ed with a name of your choice with the PSB extension before it can be used in a symbol search If the prototype contains text you are asked to which attributes of the exchange block if available these text are to be assigned Accordingly the prototype does not display the text contents but the names of the exchange block s attributes Attributes Assign text 205K to Attdef VALUE sl Cancel If the exchange block does not have attributes or any prototype s text s are not assigned to the attributes the string text appears in the graphic display of the prototype If no exchange block is available as yet a block is created from the symbol structure which was marked first If it contains text a message appears prompting you to assign each text item the desired meaning from a selection list Section 13 Symbol Search Replacement 231 7 sottelec Add to Remove Close E VPraster pro VPraster VPraster LT Texts Declaration x Text to declare C Keep as text C Convert into attribute defintion Attrib Name Next End Remove from block definition The displayed text string does not become part of the exchange block Keep as text The displayed text becomes part of the exchange block Convert into attribute definition The displayed text string is removed from the block and converted to an attribute definition After you enter its name the text becomes the default of the attribute Insertion poi
127. eeecesecceeeceseccseeceeeceueeseeteeeceueeeaeetaeetageeeueesaeeseeeeesessaeseaeeees 191 SUS IG EE 100 VIMO Ae p AEE E EEE AAE A A E AE EE N E E A E AE EA cannes ome eosin neanuant 229 Ee D e E EE 16 RR GE 216 RRE 110 Text Style NSS IMIG EE 209 Threshold y GCLOFI ZA e EE EE 189 TIFF EX BO Op OS coris ieena eaire eaa Sinn Eara 90 TOOD eR E E A E A E E E A E aamsrseines 88 109 Tace SUNO E 180 BR dr BEE 206 TATE ON UE 23 Bia e M 205 Saito ee te e PRE E AA EPT A E E AET O 15 Updating 7 Upgrading 7 len UL e anaa NA EENE 16 eer Ee E 100 Vectorizing Generation of RAW Vectorsl 188 NIE Cet DW EE 138 VE e ite NICU EEN 84 VPF Froduc e 6 Working with Multiple Raster Images 83 E eet E 103 ZOOM ACUY ee 98 Aolo nam lige naii CLICK EE 117 V 6 7 E Index 261 7 sottelec This page has been left blank intentionally 262 Index V 6 7 E
128. elec E VPraster pro E VPraster E VPraster LT Today monochrome large format scanners are common in technical CAD applications These scanners generate binary raster data black and white pixels which make for extremely compact raster files resulting from high compression algorithms most well known formats TIFF group 4 or CALS group 4 In the field of cartography for instance satellite recording generates gray level and color images They usually contain additional information which are processed and analyzed in GIS applications Basically gray level and color raster files do not differ from binary raster data Their file sizes however disproportionately increase due to very limited compression options without loss of information Thus DIN AO E size color drawings may result in raster files of 500 MB or more All AutoCAD elements are vector data representing geometrical elements such as lines circles arcs text etc They form the basic elements in a CAD system and any other more complex drawing element will be composed of them Moreover all vector elements can easily be picked moved deleted or copied as entities on screen and in file of course Color coding serves as an additional information marker representing line width hierarchical structuring area bounds and others Figure 2 B W Vector Representation With the introduction of scanner technology manually created drawings are obviously easy to r
129. em while holding down Shift To cancel a selection or to deselect all selected vector elements press the right mouse button Section 4 General Functions 101 7 sottelec Settings E VPraster pro VPraster VPraster LT With Options Settings a dialog box opens to choose from or enter the system s general settings Program Settings General Colors Shortcuts Drawing Units Pick Box Size C mm ee ie i Inches a C Pixels Auto Panning Default Text Font TI Autopan vial sl Pan Size 20 E Scanner Resolution j5 Gm DFI Delay ta ZEC e From these three options e General e Colors e Shortcuts general settings such as measuring unit text font auto panning screen colors hotkeys etc can be selected in a way that allows for tailored configuration according to the user s requirements Display This menu contains the functions that control the on screen display and the zooming redrawing and measuring functions Status Bar Switches the status bar on off When switched on this is indicated by a check mark next to the item in the menu 102 Section4 General Functions V 6 7 E E VPraster pro VPraster Raster F4 VPraster LT This function toggles the display of raster data on and off When you load a raster file the display of raster data is enabled automatically This is indicated by a check mark next to the item in the menu Vector F5 This function toggles the display
130. ender as digital data The raster files created however are only of real use in CAD programs once they have either been made available by suitable software Either directly through a raster to vector conversion or through hybrid technology allowing for parallel editing of raster and vector structures Section1 Introduction 3 7 sottelec E VPraster pro VPraster Raster to Vector Conversion VPraster LT Every raster to vector conversion vectorization involves a process of interpretation in which the pixels of the raster images are converted to vector elements If the original document contains clear and unambiguous pixels the process generates a 100 vector file that can be edited in CAD programs However unclear or missing areas in a poor drawing caused by the effects of age the imperfect manual preparation and weathering of ink pencil or foil does not provide logical raster structures therefore the scanned image will be converted inaccurately Nevertheless using comparisons and approximations it is still possible to generate the most probable vector representation Once the raster file has been converted into a vector file modifications and corrections of any misinterpretations can easily be made with an elaborate source of smart editing tools There are different methods of vectorizing raster data depending on their color depth Since the vectorization process is based upon binary files i e the file must only contain act
131. ent number of A points On the other hand these points should have some distance between each other so that their x and y values differ considerably If that is not the case a warning message appears and or a lower class function is selected Section3 Tutorial 51 7 sottelec E VPraster pro E VPraster Editing Reference Points W VPraster LT You can edit individual points by highlighting the respective point in the selection listing and clicking on Edit Point The point will be zoomed in and you can modify the target value in the Edit Point dialog box Rubber Sheeting Click OK to start the rubber sheeting process this will take a few seconds When rubber sheeting is completed you can review the reference points on the image The values displayed now correspond with the map s coordinates Close the Rubber Sheeting dialog box with OK and save the raster file as MAP_1 TIF The raster map is now prepared for further processing 52 Section3 Tutorial V 6 7 E 7 sottelec E VPraster pro E VPraster Lesson Five Tracing Line Following VPraster LT In a raster drawing only certain lines are going to be vectorized The following steps are necessary e tracing contours e tracing CAD elements Tracing of Lines and Export of Generated Vectors Preparation Start with a new drawing and load the raster file BEARING TIF from the TUTORIAL directory V67 E Section3 Tutorial 53 7 sottelec E VPraster pro E VPr
132. er HA V 6 7 E Section3 Tutorial 35 7 sottelec BY EE E VPraster pro E VPraster VPraster LT Select the raster object and move it to the desired position using AutoCAD s Move function Click on the crossing point of the two circle center lines The object is now attached to the cursor Move it onto the intersection of the construction lines circle and line Do not press the left mouse key otherwise the object would be immediately inserted into the image Instead enter angle into the command line Now you can rotate the object around the selected base point deskew the object according to the construction lines Then click with the left mouse key for confirmation of the rotation and click again to end the move command The object will be inserted at the new position Now the lower left drilling is to be deskewed to the construction lines Again zoom in to this area and click Move Raster Since the drilling is connected to the outer circle a different selection method must be used to select the drilling only Select Inside Window is the appropriate selection method Drag a window around the drilling in a way that all raster parts of the drilling to be selected are inside the window Since the outer circle exceeds the window it will not be selected If the drilling was not completely selected Undo with the AutoCAD command the selection and try again When the drilling is fully selected green confirms the selectio
133. er LT When activated the following dialog box opens for selection of various toolbars to be displayed Active Toolbars iw Standard wi Coordinates iw Object Creation I Tupes and Styles wi Classification wf aster Objects i Color Manipulations Iw Raster File Edit When clicking on the check box Show Tool Tips and putting the cursor on the respective icon the functions descriptions will be displayed Object Creation The following dialog box appears Object Creation x Layers Line Types Text Styles Colors Red Dark Blue Red Blue Cyan Magent l Be Freeze All Magenta SCH F Ihawal Cuan Layers Line Types Text Styles and raster elements Colors can be defined or created for further processing They will stay permanently available when saved as a prototype drawing Once they have been created their names cannot subsequently be changed Unused entries can be deleted with Options Purge Table Entries V 6 7 E Section 4 General Functions 109 7 sottelec E VPraster pro VPraster Layers Tab VPraster LT Name color line width and status can be defined or changed Default layers L1 L2 and L3 Width Gives the displayed width of lines Width 0 00 means that these elements will always be displayed in a width of one screen pixel no matter what zoom factor has been set This is a common representation of CAD vectors since their actual line width for plotting is classif
134. er Vector Data 133 7 sottelec This page has been left blank intentionally 134 Section5 Hybrid Editor for Raster Vector Data V 6 7 7E 7 sottelec Section 6 E VPraster pro E VPraster This section applies to VPraster LT Operation Raster File Editing General Information The sub menu VP HybridCAD Raster File Edit contains editing functions only applicable to raster data They provide functions for clean up of scanned raster data All these functions apply to the Active Image Raster Functions The following editing functions affecting always the entire file can be run individually Function AutoCAD command e Cut Window vprcutwindow e Crop vprcrop e Deskew vprdeskew e Invert vprinvert e Rotate vprrotate e Horizontal Mirror vprhmirror e Vertical Mirror vprvmirror e Remove Speckles vprspeckles e Smooth Raster vprsmooth e Scale vprscale e Auto Cleanup vprclean Auto Cleanup SSC This icon or VP HybridCAD Raster File Editing Auto Cleanup starts an automatic despeckling filling raster holes and deskewing of the loaded raster file The maximum size of the removed speckles or filled holes is 128 pixels Speckles with a regular outline e g dots dots of dashed lines decimal dots will not be removed Deskewing is performed by selecting a major vertical line of the raster image At the Command prompt enter vprclean A V 6 7 E elements will Auto Cleanup of poor drawings e g weak thin and f
135. es which wrap around all of the raster elements This vectorization method is best suited for the conversion of originals containing filled areas text and logos Exact on off The standard Outline Vectorization will straighten vectors across edges to smooth the raster outline With Exact set to on the outlines follow exactly the raster This can be useful when vectorizing text outlines or in other applications Centerline Outline Vectorization Toggling between centerline and outline vectorization can be set to occur at any desired value in pixels by entering a threshold value One application for this combined vectorization method is the conversion of architectural floor plans in which the main walls are represented by broad filled areas These are converted to vectors with their contours Threshold This parameter can only be set with centerline outline vectorization Its pixel value determines the point at which filled raster structures are no longer represented by their centerlines but by their contours instead The threshold value must be carefully calculated It should be a value A wider than the widest line for centerline recognition yet small enough so as not to centerline objects that should be outlined Otherwise you run the risk of alternately switching between centerline and outline vectorization along the length of an element due to its varying widths Range 5 thru 32 pixels Default 15 pixels Area
136. es text strings are represented as different text heights though they appear to be the same height This is easily corrected Select all text strings they will receive the color magenta and click on the Set 73 Active icon For bulk conversion of text height of the entire drawing window pick the whole drawing then click the desired T Changing Line Types The extension line on the left has been drawn in dashes instead of dash dots Change this line type by selecting the line and then clicking on the Set DD7 Active icon Use the Redraw function to refresh the image The vertical dimension line next to the 55 text string consists of several line fragments due to poor raster quality which is often encountered Select the three line fragments you can also use window crossing and click on the Combine to Ortho Line icon The line fragments are instantly combined to a single line When combining lines non ortho lines become connected at the angle of the algebraic sum difference s Two or more vectors are required in order to be combined for arcs and circles Refer to your operating manual for more information Deleting Vectors 80 Section 3 Some of the raw vectors belonging to the dash dotted lines or circles have not been assigned correctly They are drawn as individual red lines e g in the case of the magenta colored circle The short line pieces can be deleted Also there might be some arrowheads in the center of the sprin
137. escription of functions The manual applies to the following VP products VPraster pro VPraster and VPraster LT The icon on the top right on each page indicates to which product s the information and or commands apply If specific commands on a page are limited to other products or product groups this is marked with a corresponding icon Great efforts have been made to define each function and each setting of a parameter only once in detail Therefore an alphabetic index provides a quick means of finding these descriptions Keys and key combinations are represented by enclosing the keys designation For example the Enter or Return key is shown as Enter whereas a key combination short cut opens as Ctrl C Menu and command line commands are printed in bold talics Functions that can be mouse clicked for activation deactivation in a check box are represented as on off Value entries are either quoted with the absolute value range by unit or they depend on the selected drawing unit bu The given value ranges do not necessarily define an internal limitation but specify a meaningful range be aware that using values outside of the normal range can cause unexpected results Default values represent values either set up during installation or which will be used e g when parameter values are reset Conclusion 10 Section 1 So once again we say Welcome to the softelec world of raster and vector This man
138. eted later for layer separation using automatic post processing techniques 4 Section1 Introduction V 6 7 E V 6 7 E 7 sottelec E VPraster pro VPraster VPraster LT Figure 3 Centerline Vectorization Outline vectorization is where the perimeter of all pixels is represented by closed polylines This hollowing out method is suitable for vector based representation of an area which centerline vectorization would normally render as a single line of relevant width Figure 4 Outline Vectorization The two methods described can also be used in combination as Centerline Outline Vectorization It is used when a drawing contains both line structures and solid filled areas A defined raster width value threshold determines when the vectorization process uses centerline below the threshold value or outline vectorization whenever the raster width equals or exceeds the threshold value Drawings having both thin lines and solid objects convert best using this method A small threshold value will be more sensitive to smaller solid objects or pixel clusters User experimentation may be required for best results Section 1 Introduction 5 7 sottelec E VPraster pro VPraster Vector Post Process VPraster LT The actu
139. ex or vertices of the new polyline Default off Arrowhead The size of either a Pointing Arrowhead or a Dimension Arrowhead can be defined Values can be entered according to the selected drawing unit The new values only relate to redrawing of these elements Default 3 50 mm 3 50 mm 1 38 inch 118 Section4 General Functions V 6 7 E 7 sottelec E VPraster pro VPraster Hatch VPraster LT Solid The hatch pattern is formed by a number of solids This option allows for the filling of vector areas Lines A normal line pattern will be generated according to the selected option Cross Hatch can be switched on or off In off position the standard hatch pattern is on Default off The values Hatch Angle and Line Distance specify angular direction and density of the hatch Default Angle 45 Default Distance 2 5 mm 0 1 Inch Parameter Post Processing processing or to load modify and save individual parameter files Detailed information for the proper setting of these parameters can be found in the Vectorization section on Section 10 A dialog box opens to choose from parameter sets for automatic vectorization post Parameters Post Processing EN General Basic Advanced Blocks Layers m Parameter Set Straightening C Arch WI IV Ange Correction queen C Weak Deviation 3 0 degrees at C Geo C Medium Se 0 90 45 0 S 20 0 A 60 0 d Ce Strong SE Ground Untitled V Line Chai
140. ferent dialog boxes which are slightly different in appearance but similar in operation the snapshot shown is the one for 1024 768 pixel see Section 6 for the other two In the field Automatic in the upper left section you see that this raster file contains 256 color entries but only 15 colors are used in the raster image Reduce the number of entries to these 15 colors by entering 15 into the edit field and click on Execute With this action no color has been changed or deleted in the raster image However the appearance of the Histogram changes only the 15 colors in use are displayed each as a frequency bar showing the proportionate use 60 Section3 Tutorial V 6 7 E 7 sottelec E VPraster pro E VPraster VPraster LT Histogram Press lt SHIFT gt to deselect colors in preview window m Automatic r Color A G B C M Y from 15 to 15 Colors 15 Colorsused Esecute 10 10 au 245 245 245 Load Save EE mmm sl mmm al nd d el Reset E j Ill Ir Pl el O SSC M Convert V Change Pixels I Color Separation gt Gonvert te BYS OK Pixels Percent DI Absolute Preview Mv On T Flash T False Color Selecting and Combining Colors directly from the Image First start with editing the color red using the Zoom Window function of the Dialog Box The digits consist of four different red color tones altogether The brightest one
141. for each of the remaining colors thus making a proper interpretation possible To reach this goal VPraster pro s and VPraster s built in scanner interface limits the number of colors to be captured to a maximum of 256 colors This is accomplished by using a color conversion table image palette based on either a standard color palette or an adaptive palette created during a prescan Using the color reduction process the original total number of colors can be reduced to create bold solid colors to enhance the image as well as to reduce the Original file size dramatically The overall goal is to reduce the number of colors or gray scale levels to a total of about 6 to 16 color values Color separation creates separate black amp white bi level raster files out of the remaining or individually selected colors These files can be processed just like any other regular B W files Scanning Colors After inserting an original and setting up the scanner see your scanner manual and or Appendix the assignment of a palette can be activated or an existing palette can be selected Otherwise a dialog box will appear after Scan or Forward to define the palette color map for the color reduction to a maximum number of 256 colors Scan Colors Computed Color Map Linear Color Map V 6 7 E Section 7 Color Reduction Color Separation Color Classification Filters 141 7 sottelec Reducin 142 Section 7 E VPraster pro E VPraster V
142. g To open the VP HybridCAD dialog click on the icon Load Raster Image command line vprload In the dialog box browse to VP s subdirectory TUTORIAL Select the file ARCH CG4 and click Open Import Look in tutorial Si ci EI Supply_a tif E Supply_b tif E Tutor tif File name Iech CA Bren Files of t a iles of type eO sl Cancel Cel Page No File Information Width 2985 252 73mm File Type CALS Type 1 Height 3690 312 42mm Compression CCITT Group 4 Resolution 300 dpi Color Table Monochrome Bilevel Pages 1 Placing Information no The raster image is displayed in the AutoCAD workspace at position 0 0 0 Tutorial V 6 7 E Saving a Raster File 7 sottelec E VPraster pro E VPraster E VPraster LT VP HybridCAD offers three different ways to save a raster image AutoCAD Save The AutoCAD command SAVE or SAVEAS creates a DWG file or saves changes to an existing file which includes one or several links to the raster files in use The menu command nsert Raster Images displays a list of all raster images including name and path of the corresponding raster file If you have created a new raster image or modified an existing raster file with VP HybridCAD you will be asked for a file name to also save export the new or modified image to a file VP HybridCAD Save This command allows you to select the raster image you want to save export into a raster file The raster d
143. g box select the settings Centerline Vectorization and Whole Drawing Both are defaults Keep these settings and start the vectorization with OK Note that this action only takes a few seconds depending on your PC speed The progress bar in the status bar displays the processing completion status The initial conversion result displays the raw vectors as an overlay above the EN raster data Both will appear in the same color To view the vectors you can toggle the display on off with the F4 key or with the Raster Display icon You can also use the F5 key or the Vector Display icon for switching on off the vector display Ei Click on the Vectorize icon or select from the menu Vectorize the function V 6 7 E Section3 Tutorial 75 7 sottelec E VPraster pro VPraster VPraster LT The initial conversion produces raw vectorization data and will purposely AN appear quite poor in quality and should never be exported as CAD Ready This first step of vectorization creates raw vector data that must be Post Processed to obtain the desired CAD entities such as lines arcs text etc Post Processing We ll now load a post processing parameter file that has been created for use with this image Click the Parameters icon or select from the menu Options the function Parameter Post Processing to open the dialog box Parameters Post Processing Parameters Post Processing General Basic Advanced Blocks Layers Parameter Set
144. g object not belonging there Select the line pieces and the arrowheads zoom in to the drawing to find all other short lines and click on the Delete icon or press the Del key All selected vectors will be deleted Use the Redraw function to refresh the display It may occur that several arrowheads are overlaying each other Le only the uppermost arrowhead has been deleted while the one underneath will now appear in display Keep on deleting all false arrowheads repetitively Use the Undo function to undo any delete action and to restore vectors that have been deleted by mistake Tutorial V 6 7 E 7 sottelec E VPraster pro VPraster CAD Tools VPraster LT Set Dimension Arrows Select CAD Options icon and set Length of dim arrowhead to 4 5 mm 0 18 inch none in the raster image Click on the Dimension Arrow icon then first on the dimension line and second on the extension line The arrowhead is set Repeat this procedure on the opposite dimension line end le Arrowheads are missing on the lower horizontal dimension line since there were It is possible that the dimension arrows on the lower left vertical extension line 7 3 were not recognized or that an arrowhead was set in error Delete any of the misplaced dimension arrowheads and insert new ones in the correct orientation Exit from this function by clicking on the arrowhead icon when finished Remember that when an icon appears extruded it is off
145. ge Either it does only accidentally have a known extension or it has been corrupted or overwritten Create a new file V 6 7 7E Appendix Error Messages Scanner Interface 243 7 sottelec E VPraster pro E VPraster E VPraster LT No block reference Create or import a block reference first The vector data do not contain a block for insertion Use the Combine to block command to first create a block Palettes do not match Loading cancelled The palette you have tried to load is not the same as the actual palette of the image Loading was cancelled and the palette remains unchanged Pick point is outside drawing boundaries The split line is placed outside the drawing If you have accidentally entered too many split lines first abort this command right mouse button and try again Requested palette type not found in palette file You have tried to load a VP HybridCAD palette file that does not contain all the information required for this operation The file was probably saved using Raster Color Save Palette You need a palette file saved using the Save option of the Color Reduction dialog Rotation is not necessary since the drawing does already have the requested orientation No explanation necessary Security key not found There is no access to the software hardware lock Check the key installation and try again You have not installed your hardware lock Connect it to one of the parallel ports of your compute
146. h classes e define the classes e perform the classification Preparation Start a new drawing with English default settings and load the raster file CITY TIF from the TUTORIAL directory 66 Section3 Tutorial V 6 7 E 7 sottelec E VPraster pro E VPraster VPraster LT Scale the raster image with the AutoCAD command Base Point 0 0 0 scale factor 400 Open the dialog box Units control menu Format Units and change the Precision to 0 In the command line enter Image quality and change the setting to Draft Classification Open the Classification dialog box with VPHybridCAD Color Tools Classification or click the Classification icon in the corresponding toolbar Classification Ea Active Class Probes of Active Class IO 0 Probes D D NeaadMocdtu Class Elei krone Load Probes Save Probes Cancel Process Probes Jest Classification Load Classification Save lleesiicatian Pick Probe Test Areas Probes Ce Area I Liner T ext e SHar Pe k Show E All Of Active Class SS Analyzing the raster determination of classes The first step is to determine how many regions classes the raster consists of In this raster image there are 7 classes e water e black text e red text e buildings e streets e parks e and as a special class the foreign trade zone ftz To define the class Water select the first class from the list box Active Class and click on New Modif
147. he coordinate system or orthogonal in relation to a reference line To draw a rectangle at an angle Closed Polyline press the Shift key after drawing the first polyline segment at the desired angle Any additional line segments will be drawn at a right angle to the first line segment Erase Raster Ctri E under vectors When redrawing or tracing raster structures Erase Raster can be used to simultaneously erase the raster original in the background If vector elements are selected when switching on this function the associated raster background will be erased Initially the raster structure is erased by simulation which appears as imperfect The erasure becomes complete and permanent after using the Rasterize command A This function is only available for B W raster files 204 Section11 Hybrid Editor in the VP HybridCAD Window V 6 7 E 7 sottelec E VPraster pro VPraster VPraster LT CAD Options P A dialog box opens for selection and value input For details see Section 4 CAD Options x M General r Polyline V Ae Multiline Zoom Factor 1 i IT Create Block from Polyline Block Prototype Arrowhead I Allow Line picking Length of point arrowh 2 50 m Hatch Length of dim arrowh 3 50 m Transparency IT Enable Solid Lines IT Cross Hatch C Fix Opacity at EI Hatch Angle 45 0 Vorable Line Distance 2 50 Undo Ctrl Z Clicking on this
148. he second end point of the line Specifically choose the upper left cross The raster will be re positioned according to the moving vector Next you must determine rotation and scaling factors Proceed as described above Place the second vector s starting point on the lower right cross of the last inserted raster object whereas the end point should be placed on the raster lower right cross After entering the points rotation and scaling processes will be executed while the cursor changes to OK if you now click on the right mouse button you can enter two new points for another rotation or scaling process Click on the left mouse button to confirm your previous action and to execute rasterization Since the second raster had been loaded with the raster Merge function the drawing size now has been changed and adjusted to the new raster drawing you have generated The result should look like this Save the raster as SUPPLY_1 TIF to the TUTORIAL directory 46 Section3 Tutorial V 6 7 E 7 sottelec E VPraster pro e W VPraster Lesson Four Rubber Sheeting E VPraster LT During this lesson you will learn how to e rubber sheet a raster image by using the multi point method e enter reference points with and without grid snap Preparation Start with a new drawing with Metric default settings and load the raster file MAP TIF from the TUTORIAL directory V 6 7 E Section3 Tutorial 47 7 sottelec Settings E VPraster
149. he Active Image After the selection a dialog box opens for selecting the format the file name and a valid directory The following formats can be exported TIFF GP4 CG4 C4 CAL RLC PCX BMP GIF RLE CIT JPG CRL With Options a dialog box opens when JPG or TIF formats are selected allowing for more detailed format specification lf JPG was selected you can here specify the Quality of the JPEG file Low Quality means high compression but also high color quality loss High Quality means low compression but image will remain in high quality TIFF Export Options Exporting raster images using the TIFF file format provides a choice of several compression methods strip sizes and to create an additional World File The current settings are saved and will be used for future TIFF export operations Modification of the settings is recommended only in the case problems are encountered when loading exported files into other applications For most images the default settings produce the smallest file sizes that can be loaded into most applications Clicking the Reset button all options are reset to default values TIFF Export Options Ed Strip Control C Auto Single Strip C Multi Strips Rows per Strip fo y Color Options Monochrome Options gt C Uncompressed C Uncompressed GG IZW Ce CCITT Group 4 Packbits m Coordinate System Write Out World File TF Multipage Control IT Enable Multipage Support
150. he Raster Selection process the raster object is positioned on top of the Original raster At the Command prompt enter vprobject Create Raster Object Erase Background 7 After the Raster Selection process the raster object is positioned on top of the EL Original raster The background corresponding to the object is deleted from the raster image At the Command prompt enter vpreobject E VPraster pro E VPraster Erase Raster W VPraster LT After the Raster Selection process the selected raster structures are deleted from the raster image At the Command prompt enter vprerase Copy Raster Original raster It can be moved rotated or scaled When confirming its final After the Raster Selection process the raster object is positioned on top of the position it will be copied into the current raster image 122 Section5 Hybrid Editor for Raster Vector Data V 6 7 E 7 sottelec E VPraster pro E VPraster E VPraster LT Select Base Point lt X Y gt Specify the base point or Enter for the default value center of the raster object Angle Scaling lt Second Point gt Type a for rotating or s for scaling if applicable or specify new insertion point Angle Angle lt 0 0 gt Enter value specifying the rotation angle or press Enter for 0 Scaling Scaling lt 1 0 gt Enter value specifying the scaling or press Enter for scale factor 1 0 Second Point lt Second Point gt Enter point specifying th
151. he actual and target coordinates are listed The cursor will jump to the next reference point according to the preset grid spacing and continues likewise until finished Section8 Rubber Sheeting Split Merge 169 7 sottelec E VPraster pro E VPraster E VPraster LT As soon as the minimum number of reference points is entered according to the selected rubber sheeting function the remaining offset from the target position for each reference point after the rubber sheeting process will be calculated and displayed According to the number of entered reference points the system will automatically select a higher transformation function and will calculate accordingly If the Grid Snap jumps to an area with a missing or unclear reference point sometimes you may even look at an empty screen you should first zoom out using the zoom icon or if you are out of the drawing extents then skip this point by using the right mouse button At each reference position cross signs and vectors indicate e Number of the reference point e Blue cross actual value e Green cross target value e Yellow cross attainable correction according to selected rubber sheeting function e Distance green yellow remaining offset from the target value After all reference points have been entered according to the grid spacing Input Points is switched off If the Grid Snap has not been activated only the Automatic Zoom then the cursor appear
152. he block If you choose HATCH as a block name this does not create a new block but the selected elements are combined to a hatch See Section 11 for detailed information about blocks and attributes Assign Elevation 100 Ci V 6 7 E Automatic After clicking this icon select the group of polylines splines to be assigned by drawing a line crossing the polylines splines The selected elements are displayed white or black depending on the background color Manually After first selecting polylines splines using the standard selection techniques pick window cross and then clicking this icon the elevation value for each polyline spline can be entered The element in process is displayed white or black depending on the background color Each polyline spline being modified will automatically be moved into the layer ELEVATION which has the default color green Section 11 Hybrid Editor in the VP HybridCAD Window 221 7 sottelec Automatic Manually E VPraster pro VPraster VPraster LT For entering the required elevation data a dialog box opens Assign Elevation Automatic Start at Elevation bag Step Size i 00 00 Ce Increasing C Decreasing Stop and Show each Polpline Manually Elevation p DO Start at Elevation determines the elevation value of the first polyline e g the polyline spline which was the first crossed by the selection line Step Size is the value of each step which will b
153. he raster file in such a way that the reference line is vertical after rotation Horizontal will rotate the raster file until the reference line becomes horizontal At the command prompt enter vprrotate Section6 Raster File Editing 137 7 sottelec E VPraster pro E VPraster E VPraster LT Entry keyboard Range 360 thru 360 Default 0 Horizontal Mirror The raster file is mirrored across the vertical axis y axis H At the command prompt enter vprhmirror Vertical Mirror The raster file is mirrored across the horizontal axis x axis At the command prompt enter vprvmirror Remove Speckles B W files only This function clears artifacts unwanted isolated clusters of pixels e g dirt from pre the raster data or fills in any vacant pixels holes in the raster A dialog box opens in which you set the number of pixels to remove or add The speckle and or hole size can also be set by picking a sample speckle and or hole from the raster file At the command prompt enter vprspeckles A The Remove Speckles function is only available for B W raster files Black Speckle Dirt Size fo Pick from White Speckle Hole Size jo EE IT Search in Window cen 138 Section6 Raster File Editing V67 E 7 sottelec E VPraster pro E VPraster E VPraster LT Black Speckle Size Here you specify the number of pixels that constitute the maximum size of artifacts you wish to search for The f
154. he raster image The line should have the same width as the border of the wall therefore click the icon Dynamic width command line vprpickwidth With this option the width of the First close the gap in the wall Click the icon Draw Line command line vprdiine raster at the start point is used to set the line width Click on the border line in one part of the wall and draw the line to the other part To avoid wrong width measurements select the start point of the draw line carefully avoid raster junctions or holes 32 Section Tutorial V 6 7 E 7 sottelec E VPraster pro E VPraster VPraster LT Setting the second point the line will be rasterized End the function and close the gap in the other wall border For a hatch of the wall deactivate the Dynamic Width option and instead set the Pen Width to 4 pixels Draw the hatch lines with the same spacing as those already included in the raster image For experienced user You can also copy a part of the existing wall use polygon select instead of drawing new raster lines The result of this editing should look like this Save the changes to ARCH_1 DWG Scaling and saving exporting the modified raster data V 6 7 E The scaling set up for this lesson only affected the display in AutoCAD To make the scaling permanent e g in the raster file we use a VP HybridCAD command From the flyout toolbar Raster File Edit select the icon Scale Raster Image to open th
155. he selected part of the image will appear as a magenta area overlaying the blue part of the image All pixels in this area become part of the probe The Active Class window shows Water 1 Probes indicating that one probe has been picked for the class Water As you will notice the dark blue edge of the water region has not been covered although it should be part of the class There are two ways to go on now You may either pick another probe containing these pixels or you remove the last probe and try to find a new one which includes all important color tones of this class We will go the second way Tutorial V 6 7 E V 6 7 E 7 sottelec WE VPraster pro E VPraster VPraster LT Click on Remove Probe he magenta area will disappear For the new probe click on one of the dark blue pixels on the edge The magenta area will cover a large area of the blue and of the yellow region this probe cannot be used Remove it click on Remove Probe or on the right mouse button and try to pick one of the less dark blue pixels The goal is not to find a probe that includes all pixels of the region class but to find a probe that bears all major color tones of the region The magenta area does not have to cover all pixels of the class since it already contains most of the dark blue pixels on the edge most of the lighter ones in the center and no yellow pixels To get a good probe click at the coordinates 382 755 the magenta area will look
156. hstiemnislontne Shona aaae Eae eai 99 VPraster pro Graphic Display ccssccscnaserseisesascdvsnnnsanscssananendensenseesbesernsatnsonnanvensentsaisenaanneans 100 General FUNCOMS E 100 SS RE 100 iV Table of Content V 6 7 E 7 sottelec E VPraster pro E VPraster E VPraster LT Usmg the e RE 100 Combined Mouse Keyboard Operaton 101 EE 102 ee 102 deed eegenen eebe 102 Raster FA EE 103 ell TE 103 COT E 103 Parn Cursor REYS econo eaei aaa aiii 104 OWOG PAWS a ee a o E 104 GG WET E 104 eieiei A EE 104 PASEO ondo F NEE 104 VECTOP O20 NEE 104 e el 104 FOO FAV ICU Ae R erna dees EN 105 PISA E 105 OD ONS srera E E E E 106 EE 106 EE EEN 109 EE 109 Purge Table el EE 111 Eege 111 OCR Option cccccscccncccseccceeccusecsueecanecusecsaeesauecesecsaussaueesseetaeenaueeegeesaeesaeeesaeetaeetageesaestaeesseeeneess 114 DAV FS EE 115 CAD OUPDUONS anraso inene i rE EAE EEAO RAE EOE E ERN ANNARAO i 117 Parameter Post Processing sisssirasemioniissiaia atn a a a a a Aaaa 119 ADON F rotes JE E 119 SECTION 5 OPERATION HYBRID EDITOR FOR RASTER VECTOR DATA 121 General Iprerktgeg Eege 121 Basic Editing e el Ee e TEE 121 Edit Raster hunn e tee eg gege EE Ee EES EE en 121 Create Raster Obert 122 Create Raster Object Erase Gackoroundl NENNEN 122 EAS EEN 122 CODY Fa EE 122 EE 123 OO OD CCl eebe 124 Raster ren E 124 SS E 125 Select CINC TE 125 eg rn E 126 Select F Ol YOON osisa cise rece ctesiesdsnerioattnwteseescandele
157. ial port connectors 25 pin male connector The hardlock will not work when connected this way and may even be damaged 12 Section2 Installation V 6 7 E 7 sottelec E VPraster pro E VPraster E VPraster LT Do not connect devices like a tape streamer a CD ROM drive or similar A equipment to the same parallel port as your hardlock Also running file copying applications like Laplink or similar products on the same parallel port causes malfunction to the hardlock or the application Installing VP HybridCAD Software General V 6 7 E The install program SETUP_VP EXE walks you through each step to successfully install and configure the software and the hardlock driver If your CD autorun is enabled the initial screen will pop up automatically upon insertion of the CD offering you several choices Also enjoy an introduction to the features and functions of VP HybridCAD following the multimedia show The Local Installation and the Server Installation are executed with the same setup which allows you to specify several options These include the target location and the components of the VP HybridCAD software Before starting the setup routine please make sure to terminate any running applications and read the file README TXT which is located on the CD To install a new version of your VP HybridCAD program you MUST uninstall the original installed product first Start and close AutoCAD at least once before installing VPraster pro
158. icon will cancel the entire selection Combine will generate a combination of the selected colors to the Target Color The Preview will be redrawn with the modified color palette Undo and Redo will undo or redo the individual modification steps 146 Section7 Color Reduction Color Separation Color Classification Filters V 6 7 E 7 sottelec E VPraster pro E VPraster Modify Color s VPraster LT Using Modify Color s selected colors can be changed to another color provided that this color is not used in the original If more than one color has been selected a new color value will be requested for each target color prior to executing the modification A double click on the frequency bar will also call up the color modification dialog box When the Target Color icon is in pushed state only the Target Color will be changed To select a new color the standard Windows Colors dialog box opens Undo and Redo will undo or redo the individual modification steps Entering new RGB values directly in the edit fields Red Green and Blue also can modify the target color However these modifications cannot be undone with the Undo option once executed Export Color Separation Explode Load V 6 7 E Export will generate an individual B W raster file for each of the selected colors After entering a file name all files will be assigned a three digit counter and saved in TIF format The colors will be numbered from left to right
159. icon will undo the previous editing function for a maximum of the last 32 editing steps This icon is normally grayed out until an edit command is executed however after choosing the Rasterize Save Vectorize Post Process Regenerate or Clear commands the undo command is cleared Redo Ctri A Use this command to repeat the last editing command that had been undone If no editing command has been undone this function is unavailable and the icon is grayed out Redraw Ctri R V 6 7 E The screen is redrawn or refreshed In the alternative you can use CTRL R Section 11 Hybrid Editor in the VP HybridCAD Window 205 7 sottelec E VPraster pro VPraster General Editing Commands VPraster LT Explode Origin Reduces the structure hierarchy of the selected elements Blocks hatch polylines splines and text are exploded and separated into their component elements Lines arcs circles and ellipses generated during vectorization are separated into their raw vectors in Layer PO This allows the user to correct misinterpretation resulting from post processing Use this function to cut lines circles arcs ellipses polylines and splines After you activate the command pick the element to be cut then use the scissors cursor to cut Click on the cut point with this cursor both component parts are automatically deselected A line is only cut if it runs through the snap box of the scissors cursor Make Corner The
160. ied by color Other width settings are possible Default value 0 00 mm inch Status on off When switched off elements in these layers will not be displayed New elements however can be drawn invisible in or transferred to these layers Line Types Tab Solid Dashed and Dash Dotted line types can be created or changed At least the line type SOLID must exist Default line types SOLID D1 and DD1 Text Styles Tab Allows for optional creation and modification of different Fonts Text Heights and Height Width Relations At all times T1 must be available Default text styles T1 T2 T3 T4 T5 and T6 Default text font As set in Options Settings Colors Tab When editing raster data the following elements display colors can be defined here Brackets show their default settings e Draw Objects red e Erase Objects blue e Holes red e Speckles green 110 Section4 General Functions V 6 7 E 7 sottelec E VPraster pro VPraster Purge Table Entries VPraster LT A dialog box opens for purging of created but unused layers line types text styles and block definitions Unreferenced T able Entries Purge Purge A Block Definitions When activated a dialog box opens listing all blocks saved in the current file including their graphic scheme The block definitions can be erased exchanged by others modified or attributes can be attached to them Block Definitions R 6 Delete
161. igh distance errors occur that will cause severe vector length or diameter distortions To correct this simply lower the rounding number and post process again Default 0 10 mm or 0 004 inch Section 10 Raster to Vector Conversion Vectorization 193 7 sottelec E VPraster pro VPraster Basic Tab VPraster LT In this tab you can choose text recognition OCR circle and arc extraction as well as recognition of dashed and dash dotted lines Parameters Post Processing General Basic Advanced Blacks Layers Parameter Set Tutor I Dash Line Types e As many as needed MECE Text Separation E As many as E f Arch Ge Text Recognition C GEO 3 00 Only Horizontal HES Bee Langin T Horizontal and Vertical Max Dash Length 5 00 Tutor Arbitrary Direction Arch M Arcs Mm Angle Mm Radius Untitled Untitled Text on off Choose the maximum Text Selection Height for searching text structures when either Text Separation or Text Recognition is needed Limiting the search to Horizontal and Vertical or Only Horizontal text will significantly increase the accuracy of recognition and search speed and should selected whenever possible The same applies for Text Height Text Selection Height Defines the maximum size of the isolated structures to be processed during separation or recognition Range According to drawing unit Default 4 mm or 0 157 inch Text Separation Th
162. imum of twenty four special characters if configured are directly accessible via Alt 1 thru Alt 9 and Alt A thru Alt O or using Shortcuts lf Rasterize Text is activated the previously selected raster structure will be deleted and the new text rasterized into the raster image If the option Show Text after Editing is on the edited text will be displayed after clicking ok Edit Text the text can be moved rotated or scaled Pressing Enter will first delete all raster structures previously selected with the rectangle and then rasterize the new text into the raster image lf Create Vector Text is activated the new text will replace the original raster as vector representation V 6 7 7E Section5 Hybrid Editor for Raster Vector Data 129 7 sottelec E VPraster pro E VPraster Fill Raster VPraster LT S 130 Section 5 Fills a raster area or removes raster structures from the image Creates monochrome raster structures with color images At the Command prompt enter vprfill Select seed point Specify point The cursor is overlayed by a bucket The Fill Raster functionality depends on the type of raster file B W Raster File Clicking on raster data erases all pixels connected to that point from the raster image Clicking on the background fills the entire background up to the raster border Color Raster File Clicking on raster data generates a monochrome area under consideration of the environment Minor co
163. in in User Units W VPraster LT Enter the origin of the coordinate system in User Units By default the lower left corner of the image will have the entered coordinates To specify a different point on the drawing press Pick UCS Origin to pick a position on the image Default x y 0 Rubber Sheet Settings After setting up the User Coordinate System a dialog box appears to enter rubber sheet settings Rubber Sheet Settings EN Setup User Coordinate System l Raster Snap on first point Automatic zoom Factor S 1 2 C From File Ge Grid snap on second point IT Different grid u Grid Angle 0 0 F Show grid during input T Cut Window Cancel Raster Snap on first point on off If suitable the raster snap option can be used for easy positioning of the reference point s actual position It is not recommended to use this setting unless this image grid consists of thin lines or reference crosses Default off Automatic Zoom Factor on off When switched on the area at the selected reference point will be zoomed in according to the selected zoom factor prior to positioning the reference point Default off Default value 1 2 166 Section8 Rubber Sheeting Split Merge V 6 7 E 7 sottelec E VPraster pro E VPraster Coordinate Snap on off W VPraster LT From File V 6 7 E If the reference points are evenly spread throughout the drawing on the connection points of a virtual grid or the coordi
164. ing a color 3 Set the Handles checkmark and click on the desired color s curve handle The parameter settings of a transformation can be modified in the Numerical View or in the Transformation View In the Numerical View select the parameter by expanding i e double clicking the desired color and click on one of the parameters You can modify the value either by moving the slider or by entering the desired value in the edit field The affected handle will be indicated by changing to a brighter color The Transformation View and the Output View display the new setting accordingly In the Transformation View dragging any one of the curve handles can modify the transformation To move the transformation curves with the appropriate handle the cursor symbol changes The Numerical View and the Output View will display the new setting accordingly The Steps and Lines transformation do not carry curve handles by default However you can place optional handles on the curves in the Transformation View by clicking with the left mouse button To remove a handle click on it with the right mouse button Reset sets the actual transformation back to its initial state Cancel closes the dialog without modifying the image s palette OK closes the dialog confirming the modifications to the image s palette Section 7 Color Reduction Color Separation Color Classification Filters 159 7 sottelec Output Input 160 section E VPraster p
165. ints may cause unexpected results We recommend you to select more reference points or to select a lower order transformation function Abort transformation The parameters of the transformation function change significantly with only small changes in the coordinates of the inserted reference points This produces unstable mathematical equations for calculating the target raster file after rubber sheeting causing unexpected results This message may occur when using the Quadratic or Cubic function with a small number of reference points Solve this problem by using a lower order function or insert more reference points We recommend inserting at least 16 points using the quadratic function and 25 points using the cubic function Wrong selection Select a line or a polyline You can insert a Donut only on a line or a polyline Wrong selection Select a line a polyline an arc or a circle You can insert an Arrowhead only along the specified objects Wrong selection Select a line a polyline an arc or a circle The selected object cannot be part of a contour for hatch Only the specified objects are allowed Wrong selection Select the point of the arrowhead on the selected object To insert a Pointing Arrowhead the selected object must be picked twice The second click specifies the point position of the arrowhead 248 Appendix Error Messages Scanner Interface V 6 7 E 7 sottelec E VPraster pro E VPraster E VPraster LT
166. ion General Information reas If a raster image has been currently loaded this icon switches to the vectorization GH mode The standard AutoCAD window is temporarily disabled and special VP HybridCAD functions are available for the Active Image When calling Vectorize again for an already vectorized raster image the previously generated vector entities will be displayed for editing Only the Active Image raster image is accessible in the vectorization mode No AutoCAD vector entities can be processed therein Only bi level monochrome raster data can be vectorized With color raster data you must first process color separation The vectorization process consists of two steps 1 Raw vectors are created from the raster data the entire file or only parts thereof using Vectorize 2 CAD elements text hatch dimension arrows and similar items are recognized during the second step Post Processing according to the parameters in the Post Processing Parameters Set In order to obtain optimal results the file or section to be vectorized should be prepared e g cleaned and corrected as well as possible using the raster file editing tools After leaving the vectorization mode the raster and all newly created vector entities are added to the AutoCAD database and displayed V 6 7 E Section 10 Raster to Vector Conversion Vectorization 187 7 sottelec E VPraster pro VPraster Vectorizing Generation of Raw Vectors V
167. ions If attributes have been attached selection with Attributes Insertion Points the insertion point angle and parameter can also be modified for each attribute When New Attribute is selected another dialog box opens to enter attribute specification corresponding with those of AutoCAD 112 Section4 General Functions V 6 7 E 7 sottelec E VPraster pro VPraster VPraster LT Add Attdef Attdet Name Default Value Prompt Angle Textstyle T Invisible T Constant Verify Preset cence Instead of using only one Default Value there are six predefined Default Values available in a combo box Circumference Calculates the circumference of the block Area Calculates the area of the block Angle Assigns the block insertion angle Y Position Assigns the y coordinate of the block insertion X Position Assigns the x coordinate of the block insertion Name Assigns the name of the block These values will only be active and displayed in an exported vector file DXF IGES DWG DGN An attribute can be assigned as e Invisible Attribute will not be displayed in block e Constant AutoCAD Flag Attribute value cannot be edited or positioned in block e Verify AutoCAD Flag here of no significance e Preset AutoCAD Flag here of no significance When attributes exist they can be selected and modified individually or can be erased with Delete Attribute V 6 7 E Section 4 General Functions 113 7 s
168. ive V 6 7 E Section 2 Installation 17 7 sottelec E VPraster pro E VPraster Monitoring VPLicenseManager M VPraster LT Introduction 18 Section 2 The VPnetManager application can be started on any computer operating under Windows 95 98 or Windows NT 4 0 2000 It monitors the activity of the VPLicenseManager After the first start of the application the following dialog appears a2 PnetManager File General Servers User sia ol All Infos Category Information MV Check Servers every 10 seconds Update Information Searching for Servers The application automatically starts to search the network for VPLicenseManager Servers The search may be stopped by selecting Servers Search Servers in the pull down menu or by clicking the icon once more After the search has been completed the left window frame displays the symbols for an active VPLicenseManager server with a green screen and with a connected hardlock module 7 8 SOFTELEC_DOMAIN G soltelec gmbh If the search is stopped before a valid server has been found a server can be manually added by selecting Servers Add Server or clicking this icon and entering the network name of the server With Servers Remove Server the currently selected server will be removed from the list Installation V 6 7 E d cn Ip IR Menus File V 6 7 E 7 sottelec E VPraster pro E VPraster E VPraster LT A red
169. ive foreground pixels on an inactive background B W images bi level can be converted without additional operation Vectorizing colored or gray scale images multiple color or gray level can only be achieved by generating binary images through color reduction and separation followed by converting and merging the conversion results as a single CAD file For example all red raster pixels can be separated as a raster object and converted using the same procedure as with B W images Similarly gray scale files can be vectorized by separating levels of gray For most technical drawings and documents and including cartography GIS applications there are two principal vectorizing methods plus a third alternative e Centerline Vectorization based on a skeleton thinning method e Outline Vectorization based on a outline tracing method e Centerline Outline Vectorization based on thinning and outline tracing Centerline vectorization is used if the image contains lines circles arcs and other more complex elements based on these elements but in the absence of solid raster objects The raster image is reduced thinned down starting with the edges of the areas of set active pixels until only the pixels in the center are left These are then replaced by a series of line elements polylines in which the nodes exactly reproduce the topology of the scanned image raw vector data Information regarding line widths in pixels is stored and interpr
170. keyboard instead use the sliders In the General tab you will note that the Straightening parameter is set to Strong This increases the tolerance and assigns the maximum line straightening i e rather arcs circles lines etc than polylines are generated Angles will be corrected at 0 45 and 90 i e the angle orientation of a 43 line will be corrected to 45 if the deviation tolerance is set for 3 The Text option in the Basic tab is set to Only Horizontal n the drawing however there is also vertical text dimensioning Change this setting to Horizontal and Vertical Switch to the Advanced panel and mark the setting for Arrowheads Measure the actual arrow length by clicking first into the enter field then pressing the F2 key Zoom in to one of the arrowheads and draw a two point line starting from the tip and ending on the base second mouse click The length value of the drawn line will now appear in the enter field and should be approximately 4 50 mm or 0 18 inch All other parameter values are pre configured for the included sample file You should review each one for understanding the values chosen Note that unused parameters will be grayed out It is important to remember that for optimum post processing you should not activate any parameter settings for patterns that do not exist in the image That is if your drawing does not have dashed lines leave the dashed line parameter setting off Avoid using rand
171. ks with basic AutoCAD entities such as lines polylines arcs circles etc Higher entities especially combined entities like blocks are not supported by the Delete Raster Background command Basic Editing Commands Edit Raster Functions Raster structures are combined to one object with Create Raster Object or Create Raster Object Erase Background The resulting object is copied on top of the original raster data EE Raster objects will be created as new raster images using the current AutoCAD layer and color This way they will be saved as separate raster images when saving the drawing Raster objects may be scaled rotated moved and copied like blocks All raster objects command are available in the menu VP HybridCAD Edit Raster V 6 7 7E Section5 Hybrid Editor for Raster Vector Data 121 7 sottelec E VPraster pro E VPraster E VPraster LT The functions Erase Raster Copy Raster Move Raster and Smooth Object do not generate Raster Objects on top of the raster image Instead they modify the raster data Erase Raster Create Raster Object Erase Background Move Raster and Smooth Object are only available with B W images All raster functions may be aborted with ESC Undo operate as usual On calling one of these raster functions the Raster Selection toolbar see below appears for selecting the appropriate raster selection mode E VPraster pro E VPraster Create Raster Object VPraster LT After t
172. l horizontal or vertical The Angle Correction function corrects individual lines within the drawing at 0 and 90 angles as well as at a maximum of three additional angles of your choice Deviation determines the maximum deviation from the reference angle that is to be corrected Since substantial angle deviations can occur in individual line segments in the raw data the value should usually be 2 5 If the value is too high you run the risk of snapping lines that should run within this angle setting without correction Default 3 When angle correction is set 0 and 90 are the default angles There are three other possible preferred angles that can be entered or measured using F2 Range 0 thru 90 Default 0 0 0 Gap Jump on off Grid Snap V 6 7 E Small breaks in the raster data due to faded and old originals can be joined together in lines circles and arcs up to a reasonable distance A high value setting will result in false lines or arcs If the value is set too high neighboring vectors can be connected To correct this simply lower the distance length and post process again Default 0 mm inch pixel The length of an orthogonal line the radius of an arc and the center point and diameter of a circle is rounded to the nearest grid snap value This is a helpful feature in parametric design issues but the drawing should first be scaled out to the original size If the value is set too h
173. length of a single dash element in a dashed or dash dotted line to be found Default 0 mm inch pixel Poor drawings with weak solid lines can generate false dashed lines It is A best to consider that if the drawing to be converted has only a few dashed line segments to leave this function off After post processing you can easily combine the line pieces to one line and then convert it into a dashed or dash dotted line 196 Section10 Raster to Vector Conversion Vectorization V 6 7 E 7 sottelec E VPraster pro VPraster Advanced Tab VPraster LT In this tab you set the parameters for the recognition of small circles dimension arrows arrowheads donuts and ellipses Parameters Post Processing EN General Basic Advanced Blocks Layers m Parameter Set GG Mech T Small Circles M Arrowheads C Arch Diameter 11 50 Arrow Length 3 50 l io C Ground IT Extend Lines to Center poo bees I Assign New 1 50 Diameter bo C Untitled Untitled T Ellipses Untitled l Replace by Block Entity MPOINT Min Excentricity 010 C Untitled Cancel Load Save Reset Small Circles on off V 6 7 E This option is for recognition of small circles up to a diameter of approximately 2 mm or 0 08 inch corresponding to approximately 25 pixels at 300 dpi with increased tolerance Arcs spanning an angle larger than 270 are closed to form full circles Diameter Enter th
174. like this Since all major color tones are included in this probe no additional probes are necessary for this class Change the active class to Buildings and zoom to the block between Battery and Sansome street Click right into the block s center Depending on which pixels you hit only a small area is selected or almost the whole block is covered Try to find a probe that includes most of the block s interior and most of the darker yellow pixels on the edge Do not hit any black dark gray pixels from the edge To get a proper probe for this lesson click on 473 438 In case edges should be part of a class probes have to include pixels of these edges If you do not want to include edges in a class make sure that no edge pixels will be selected in the probe As different probes alter the classification results it is essential that you use probes from regions with the following coordinates Section3 Tutorial 69 7 sottelec E VPraster pro E VPraster VPraster LT Pick Probe Mode 382 752 Buildings 472 437 387 448 71 385 713 389 Picking line text probes Select Text as the active class Change the Pick Probe mode to Line Text With this mode rather small areas will be selected Zoom to the text TELEGRAPH HILL and click on the letter R Try to find a probe that covers most of the letter but does not touch the yellow region Again it is important to be aware of the edges Use the coordinates 213 395 Change to
175. lor are assigned to layer L2 A A for arcs Circle Center Point x y 68 80 104 20 Diameter 42 20 Layer L2 C X Line Type SOLID Color BYLAYER Cancel Some of the dimension lines however are displayed yellow instead of red This means that they were assigned to another layer because the arrowhead widths affected the average line width value These lines are easily transferred to layer L1 Select all dimensioning lines that are in yellow instead of red by clicking on them consecutively these lines will be displayed dashed as a highlight Then click on the Set L1 Active icon All lines previously selected will now be transferred to layer L1 and become red Reviewing Text 78 Section 3 Click on the Review Text icon A dialog box appears It displays the raster section of the first text string found along with the recognition result Also the text position in the drawing will be zoomed in and the selected text vectors are displayed and highlighted If the recognition is incorrect mark the respective character s with your mouse and enter the correction from your keyboard or from within the box s menu item Shortcuts Enter the sign via Alt 1 Shortcut function In the menu Shortcuts this special character has been defined by default Text Style text height Text Angle and Start Point may be edited directly Tutorial V 6 7 E 7 sottelec E VPraster pro VPraster VPraster LT Sometimes u
176. lor s d Export RR lt To Lalela 4 Color Reduction Color Separation Color Classification Filters V 6 7 E Preview V 6 7 E 7 sottelec E VPraster pro E VPraster VPraster LT The dialog boxes contain two main areas The Preview displays the image as it will look after any step of the color reduction and the Histogram View shows the colors of the image Depending on the screen resolution there are three different dialog boxes A which are slightly different in appearance but similar in operation The sample shown is the one for 1024 768 pixels See the last page of this section for other possible display resolutions The image display in the preview window can be changed using the three Preview options On Flash and False Color In the Preview the default cursor is a pipette which allows colors to be selected from the preview window by clicking with the left mouse button To select more than one color you can move the mouse for a window selection of all colors enclosed To deselect colors from within the Preview hold the Shift key while proceeding as described above A context sensitive popup menu can be opened by clicking the right mouse button The available functions are the same as those accessible through the Combine Modify Color s Export and Explode buttons See below for more information on these functions The popup menu command Mark unused ad
177. lor variations of areas or dithered areas color patterns will be combined There are two options available for the target color for this area Choose color Select lt Automatic gt Automatic The target color taken from the palette is the closest color to the average of all combined colors Se ect A dialog is displayed for selection of the target color Hybrid Editor for Raster Vector Data V 6 7 7E 7 sottelec E VPraster pro E VPraster Draw Raster Functions VPraster LT There is a set of draw erase commands for simple raster structures such as lines arcs circles etc They are based on the standard AutoCAD drawing functions Please refer to your AutoCAD manual for further guidance The entities you draw erase will directly modify the raster The current AutoCAD linetype settings are ignored To draw raster entities with a linetype use the standard AutoCAD commands and then Aasterize these entities o Drawing occurs with the specified pixel width By clicking on the Dynamic Width ER icon the line width can also be detected or calculated by clicking the raster element This assigned line weight remains fixed until a new width is detected This function is only available for B W raster files At the Command prompt enter vprpickwidth Due to the roughness of a raster element the dynamic width derived from it may differ by 1 2 pixels With colored images the current AutoCAD settings for layer color are used Dra
178. ly consists of two blue tones Select and combine them the order of color selection is not relevant The gray color tones will be combined to a new color To choose a new target color click the Target Color icon select the color black in the Windows dialog box Colors from Basic Colors red 0 green 0 blue 0 and close the dialog box Tutorial V 6 7 E 7 sottelec E VPraster pro E VPraster VPraster LT Now select the colors to be combined Zoom in to the black number 3846 in the upper half of the image Click the left mouse button and move the mouse to draw a rectangle around the last digit All colors found in this rectangle are added to the selection white and four gray tones Deselect the white color by clicking on the color label in the Histogram Combine the four selected gray tones to the new Target Color black Choosing Colors in the Histogram and Combining to a New Color Select the three remaining red tones by clicking on the respective color labels in the Histogram dialog box To change the target color click the Target Color icon The standard Windows dialog box Colors appears choose the color red from Basic Colors red 255 green 0 blue 0 and close the dialog box Modifying Colors The color blue is to be modified to the basic color blue Click on the color label in the Histogram dialog box Then select the Modify Color s function You also can use a double click on the blue frequency bar to change the color
179. n We recommend to choose typical as the setup type Server Installation Follow the steps through the installation You must choose the custom setup type and then check on the component Server Installation Files After a successful installation you will find the subdirectory client in your VP HybridCAD directory on the server This contains the file SETUP EXE which must be executed on every workstation client Through this setup the program icons will be created and the user specific files will be copied to the workstation Local Licensing During setup you will be asked whether your hardlock resides locally or on the network server Choose Local 14 Section2 Installation V 6 7 E 7 sottelec E VPraster pro E VPraster Network Licensing W VPraster LT During setup you will be asked whether your hardlock resides locally or on the network server Choose Network Server The next dialog prompts you for the name of the server bearing the hardlock dongle server You don t need to enter the two trailing backslashes e g type only SOFTELEC DOMAIN If you don t know the name of the dongle server you may leave this entry empty and proceed with the installation On startup VP HybridCAD will search the entire network for an appropriate VP license e g a hardlock However this may take some time if your workstation participates in a large network In order to use Network Licensing the VPLicenseManager see
180. n 10 Se E VPraster pro E VPraster Edit Raster W VPraster LT A set of raster editing functions such as erase move copy etc and some raster select functions are available See Section 5 E VPraster pro WE VPraster Erase Raster VPraster LT A set of enhanced erase functions is available See Section 5 Draw Raster A set of raster drawing functions is available See Section 5 Tracing A set of tracing line following functions is available See Section 9 Color Filter A set of color palette manipulations is available See Section 7 H VPraster pro VPraster Raster Snap F11 on off W VPraster LT The raster snap can be switched on or off Define the active Raster Snap Modes with VP HybridCAD Program Settings Tab Raster Snap At the command prompt enter vprsnap V 6 7 E Section 4 General Functions 97 7 sottelec E VPraster pro E VPraster Delete Raster Background on off under vectors W VPraster LT When redrawing or tracing raster structures Delete Raster Background can be used to simultaneously erase the raster structures in the background At the command prompt enter vprerase Auto Regenerate on off 3 If set to on an automatic regeneration occurs after every operation modifying the raster to keep the raster image in the background With large drawings this may slow down the performance of raster editing Then switch off and use the VP HybridCAD Regenerate command to update the display wheneve
181. n View The vertical axis in the Transformation View represents the Output values of the current palette black is on the bottom white on top In case you have chosen a colored image the axis is displayed in red green and blue Otherwise it will appear in gray The palette s Input values are represented accordingly by a horizontal axis black is on the left white on the right The Output axis color succession can be reversed using the nvert checkmark The following diagram shows how to read the Transformation View Section 7 Color Reduction Color Separation Color Classification Filters 157 7 sottelec E VPraster pro E VPraster VPraster LT er CC OertCO Input With two different transformation used in this example the same value of the Input palette is transformed into two different Output values The combo box allows selection of one of the available transformation Automatic Brightness Contrast Brightness Contrast Automatic Smooth Smooth Gamma Correction S Gamma Correction Steps Lines The transformation marked with li bear a default setting when selected depending on the image Automatic transformation do not carry settings that can be modified Transformations marked with can only be modified in the Numerical View Selecting a new transformation changes both the Numerical and the Transformation View To modify the transformation settings you can edit in both views When the Con
182. n and position the raster object at the new position Use moving the object center to the center of the drilling Deleting Raster Objects The lower right drilling indicates a wrong diameter It will be deleted and replaced by a raster object Zoom in to the lower right drilling and click on Erase Raster Use either Pick Element or Select Inside Window for selection If all of the drilling to be removed has been selected red confirm selection and the selected raster is deleted Copying Raster Objects 36 Section 3 The upper right drilling ts to be copied rotated and placed at the correct position in the lower right sector Zoom in to the upper right drilling and click on Copy Raster command line vprcopy Select Pick Element and click with the pipette on the drilling Confirm the selection and move the raster object to the lower right sector and position it with its drilling center on the crossing of the construction line with the circle Rotate the object 90 using Shift while rotating Confirm the final position right mouse key Tutorial V 6 7 E 7 sottelec E VPraster pro E VPraster Delete Construction Lines VPraster LT The construction line are no longer needed Select these vector elements and delete them When completed successfully the raster drawing should look like this Pasting Raster from a File M Load the raster file FLANGE_A TIF from the TUTORIAL directory This file provides a raster object
183. n around the area to be modified Close the polygon right mouse click or Enter All the raster inside the polygon is selected red 40 section Tutorial V 6 7 E 7 sottelec E VPraster pro E VPraster Deselect Selected Raster Structures VPraster LT Since not all of the selected raster should be erased some raster entities have to be deselected deselect previously selected raster entities Draw a horizontal line on top of the horizontal circle center line Start and end outside the polygon e g on the white part of the horizontal raster line SS Click on Select Line and keep the Ctrl key pressed whenever you want to The horizontal circle center line is all red again Le deselected Deselect the vertical circle center line the same way Now deselect the outer contour line of the component Use the selection modes Select Arc and Select Line Since the de selection cannot be completed in one step repeat the selection until all parts of the contour are deselected For de selection of the arrow use the Select Polygon command Accept the final remaining selection Enter The area should look like this a Create Raster Object The drilling at the lower left including the accordingly dimensioning will be newly deskewed to the circle center lines A copy of this part will be placed on the previously see above edited area V 6 7 E Section3 Tutorial 41 7 sottelec E VPraster pro E VPraster
184. nPlus III 800 ScanPlus II 1000 ScanPlus III 80 ScanPlus III 400 T ScanPlus III 600 T ScanPlus III 800 T ScanPlus III 1200 T ScanPlus III 1800 T ScanPlus Ill 800 T PLUS ScanPlus III 800 T COPY Colortrac CT 36 400 360 CX 360 GX 380 CX 380 GX Contex FSS 3000 MP FSC 5000 SP FSS 5000 MP FSC 8000 PSF FSS 8000 MP FSC 3010 PSP FSS 10000 MP FSC 5010 PSP FSS 3200 PSP FSC 6010 PSP FSS 5200 PSP FSC 8010 PSP FSS 6200 PSP FSC 5010 COPY PSP FSS 8200 PSP FSC 8010 COPY PSP FSS 10200 PSP FSC 3040 CHROMA TDS 8000 PSP FSC 6040 CHROMA FSS 4300 PSP FSC 8040 CHROMA FSS 6300 PSP FSC 3050 MAGNUM FSS 8300 PSP FSC 6050 MAGNUM FSS 12300 PSP FSC 8050 MAGNUM FSS 18300 PSP FSS 8300 PLUS PSP FSS 8300 COPY P P V 6 7 E Appendix Error Messages Scanner Interface 251 7 sottelec E VPraster pro E VPraster VPraster LT Imtec 3520 3720C Oc G6015 G6035 G6045 G6055 G6015 S 4710 G6035 S G6035 Sx 4720 G6045 S 4715 4725 4730 4740 4750 Vidar TruScan 800 TruScan Spectra TruScan Flash TruScan TITAN TruScan Select WideCom SLC436 SLC436C SLC836 SLC836C The software supports the following scan modes Black white Grayscale Color Indexed 256 colors max True color All other options will be activated or deactivated according to the specifications of the connected scanner device 252 Appendix Error Messages Scanner Interface V 6 7 7E 7 sottelec WE VPraster pro E VPraster Scan Dialog VPraster LT Di
185. nates are saved in a text file VP HybridCAD can assist you with the input of the actual coordinates by panning automatically to the target coordinates The user may only click sequentially the marked reference points in the drawing Default off From File allows to enter a file name and file settings in the subsequently displayed dialogs containing coordinate target values see below Choosing Grid Snap on second point you can setup grid properties for the target positions Enter the grid point distance for the X coordinate If the grid has a different spacing in the x and y direction switch on Different grid and enter the corresponding spacing into the X and Y fields In case of a rotated image enter the angle in the field Grid Angle Default Grid Snap on second point on Default X 0 Default Grid Angle 0 Images with rotated grids will be deskewed according to the grid after A rubber sheeting If the image should remain rotated set the value of the registry key HKEY CURRENT USER software softelec VPxxx VP RubberSheet KeepGridAngle to 1 Administrative rights are required lf Show Grid during input is activated the grid will be displayed permanently during the rubber sheeting procedure Default off Cut Window allows for drawing a window which limits the area of input of the reference points Only grid positions inside this window will be offered Default off For target reference points stored in a text file you can u
186. nce with the settings made in CAD Options At a selected text string inside the borders the hatch will be cut out to allow the text string to stay separate If the area to be hatched is not completely enclosed by bordering lines it can result in missing hatch lines Insert Block After they have been created blocks can be selected and inserted After placing a block it can be modified using the handles to move scale or rotate it After making any corrections confirm the operation by clicking the right mouse button The block is attached to the cursor for an additional placement Clicking the right mouse button a second time aborts the Insert Block operation See also Section 11 V 6 7 E Section 11 Hybrid Editor in the VP HybridCAD Window 217 7 sottelec E VPraster pro VPraster Combining Vector Elements vPraster LT The program allows you to combine selected vector elements to form a whole or even a new element These functions can be applied to vectors generated by vectorization as well as to manually drawn elements In this sense to combine means to group elements for example two or more lines segments to form a single line or a complete single arc Due to a poor original or imprecise drawings the vectorization process often results in broken lines several arcs instead of a circle etc Using the Combine to commands clean up can be accomplished easily quickly and precisely If several elements are combined
187. nect checkmark is on and a color image is to be processed then the three basic colors red green and blue will be treated together Thus only one curve Is displayed in the Transformation View Moreover the combined treatment of the three basic colors with Connect will set a primary active color It is the one that carries handles even if the Handles checkmark is not set It is also highlighted in the Numerical View or it is the only color that is represented by a curve if Show RGB is deactivated With Connect the active color s current attribute values will be assigned to the remaining two basic colors 158 section Color Reduction Color Separation Color Classification Filters V 6 7 E V 6 7 E 7 sottelec E VPraster pro E VPraster VPraster LT If the checkmark View AGB is on and Connect is off with a color image there are three curves each with a different color If Connect is on Windows 95 displays a yellow curve whereas Windows NT shows a RGB curve To modify only one color set Connect to off Then the active color s curve red green or blue is displayed Depending on the View RGB checkmark setting the other two colors will either be accessible too or they are not displayed There are three ways to select a specific color for modification Select the desired color Red Green or Blue in the Numerical View 2 Click with the right mouse button in the Transformation View window A popup menu appears for select
188. ned original before starting with color reduction or before vectorizing B W originals When filters are used originals should still contain 256 colors or 256 gray scales Filter Raster Image 152 Section 7 From the VP HybridCAD Color Filter menu select Filter Raster Image this function is only available if the Active Image is a color and gray scale image At the command prompt enter vprfilter The application of filters in image processing is a very complex subject that cannot be described in detail in this manual Only those with color processing experience should work with the items in this section since unpredictable and unwanted image manipulations are likely to occur otherwise Preview opens a window to view how the selected filter affects the actual image Use the scrollbars if available to move around the 1 1 scaled view of the image Close returns to the filter settings dialog The progress bar indicates the filtering process Filterpreview Color Reduction Color Separation Color Classification Filters V 6 7 E V 6 7 E 7 sottelec E VPraster pro E VPraster VPraster LT Custom Filter EN m Filter Mat Di m EEE Cal aT eta aa GEROCH e z bi EERE ERE ST aes SEREESE Rotate 20 Rotate a Rotate 45 Rotate as Name blur D New Saye Delete IV Game Average IT Remap weight Offset 0 Apply Filter Close This dialog box allows for sever
189. ng additional reference points or when these do not exist choosing a lower transformation function can solve the problem Imagine a square with different grades of distortion Rubber sheeting functions can correct the following distortions Helmert gt Linear gt Quadratic gt 164 Section8 Rubber Sheeting Split Merge V 6 7 E 7 sottelec E VPraster pro VPraster Set Up User Coordinate System M VPraster LT When selecting VP HybridCAD Rubber Sheeting General Multi Point a dialog box appears to set up the User Coordinate System The Active Image will be moved and scaled to fit these coordinate settings for the rubber sheeting User Coordinate System User Units Meters rm m Drawing Scale m Precision 1 1500 000 ww D ci in U ZE C 00 tigin in User Units ny x 0 00 C 9 000 w 0 00 9 0000 Pick UCS Origin M Show UCS Icon cancel _ User Units All standard units from pixels to miles are available for selection Default Millimeter mm Drawing Scale Select the scale of your drawing or any other scale if you wish to convert your drawing scale Default 1 1 Precision With reference to the selected User Units you can specify the number of decimal places Internally each value will be mathematically rounded to the last digit Default 0 00 V 6 7 E Section8 Rubber Sheeting Split Merge 165 7 sottelec H VPraster pro E VPraster Orig
190. ng the icon End Trace command line vpretrace and zoom to this gap KE Select the polyline click on one of the two end points and drag it onto the opposite one Deselect the polyline the outline is now vectorized as a single continuous polyline V 6 7 E Section3 Tutorial 55 7 sottelec E VPraster pro E VPraster Tracing Dashed Contours VPraster LT en i E The component s recess drawn in dashes is going to be edited To change the current line type from continuous to dashed click the AutoCAD icon Linetype and load the line type Dashed2 Close the dialog box and set this line type as active line type Start the Trace Dashed Contours function and close with OK the upcoming dialog Trace Work Area with the option setting Keep Current Work Area selected by default The work area remains unchanged and is marked by a green frame around the entire drawing Click the icon Trace Options and activate the Append Mode This mode has the same functionality as the Shift key a newly trace line will be appended to the previous one Click on the line fraction on the lower right of the centerline It appears marked in the current layer color Click on the line fraction just to the right of it This way the system will adjust the gap length to continue in the automatic trace mode The color changes to magenta for dashed line type The line tracing mode stops when reaching an interconnection proceed as described above If the g
191. nhancement Dark Enhancement V 6 7 E Appendix Error Messages Scanner Interface 255 7 sottelec This page has been left blank intentionally 256 Appendix Error Messages Scanner Interface V 6 7 7E 7 sottelec E VPraster pro W VPraster n d ex E VPraster LT Eeer 214 Arrowhead Definition E 118 PS SV UM ge EE 221 Attaching the Hardlock Dongle siceastncesccteaniossvereinnte teudincanince ena iantineaniceatiea uektieaenseaueieuactince 12 PUNTO C AID E 135 PUG Me AUN e cat cette eicta ner O E EE E E E E R 107 Automatic Color Reduction EE 145 Block RI gen ME 111 Sieten EE 223 CAD FC OS E 213 CAD ODO Steneschinsrernnivatencsitavscioinniansnnnsieemnuniaensitsieinissienssinesinonisciomauraanenrtieemoiersoenuaienanies 117 205 ER REN 184 Centerline Vectorization EEN 188 Centerline Outline Vectorization cccecceceecececceceeceuccuceueuueueeuccusuuseueuseueausuueusausaueeusuuausausauseuseseeans 189 COIE o E pen ceniensinauine cue petanduesanendeaee sm semunanusuraceuds mean see anendeenaecetanenees 215 CIOS EE FONI EE 214 Color Clas SIMIC AU OA EE 141 149 Color RI dt ge NEE 110 Color Ee Te e e EE 141 CGlOF SEO aT aio E 141 sin eil te EE 219 Beieleit de OC EEN 221 CGO VS ege EE 219 Beien eil to DIMENSl Oessoeri Ea a E E E aE 220 COMPING TO le E 219 Combine TO TEE 218 Combine to Ortho BT TE 218 COMDINE tO POLY IMG wscnsuacnsevivain insnnanmatacvumtaunsaniebiniwbtestnacsictvaanbeluaneaniiielnaa a ines boaaaonttaunie dein 21
192. ning C Untitled i M Gap Jump Ion j I Create Splines wire Only Along Outlines Se Grid Snap Jon C Even Across Intersections Untitled Cancel Load Save Reset Abort Process ESC Will end any active running process V 6 7 E Section4 General Functions 119 7 sottelec This page has been left blank intentionally 120 Section4 General Functions V 6 7 E 7 sottelec E VPraster pro E VPraster Section 5 This section applies to MVPraster LT Operation Hybrid Editor for Raster Vector Data General Information All editing functions described in this section operate on any loaded raster image This means that you are not limited to the Active Image All AutoCAD entities can be rasterized Thus you can use all of AutoCAD s drawing constructing functionality for editing a raster image Since VPraster series uses a special plotter driver for rasterization the line width is defined by the entity s color i e the color of its layer You can use standard layer control commands for a pre selection of the entities to be rasterized See Section 4 for further information on rasterization Raster Background can be used to simultaneously erase the raster data in the background Intersections or connections will be kept ES When redrawing with AutoCAD commands or tracing raster structures Delete A This function is only available for B W raster entities This function only wor
193. nitoring VPLicenseManager a snasnnunnsnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnennnnnnnnn ennen 18 MOCOU CON EE 18 VT 19 SECTION 3 TUTORIAL cccccceecceecseecesecesecanecaeecanecasesaeesaseeueeeueeeuseeeeesceesceeenenssaeess 23 Lesson One First STCDS wisicicsadcssicsscheciancdinenvissiawsetadeidusvactanieunitevarsssveniadeyacsenideineviarseuneniiveiniedares 26 Lesson Two l FagtertMuget seoestiietbtene Eege 34 Lesson Two Il Raster Objects complex Editing cccccccccsseeeeseeeeeseeesaeeesaeeesaaeessaeees 39 Lesson Three Merging two Raster Files cccccccseeeeeeeeeeeeeeeeeeeeeaeeseeeseaeesaeesaeessanesaeesaenes 45 Lesson Four Rubber SMGCUING zesgsogeeieeesgegekegeeg gege Eege EE dE 47 Lesson Five Tracing Line Following ccccccsseceseeeeeeeeeeeeeeaeeesaeeesaeeessaaesseeeesaeeessaeessanees 53 Lesson Six Color Reduction Separation KENE ENEE ENNER REENEN 59 V67 E Table of Content ili 7 sottelec E VPraster pro E VPraster E VPraster LT Lesson Seven Color Classification ccccccccceeeeeeeeeeeeeeeeaeeesaeeesaeeesaaeeesaessaaeeesaaeessaeessaeeenas 66 Lesson Eight Vectorization Auto R2V REENEN ERR EERR ENEE 73 SECTION 4 OPERATION GENERAL FUNCTIONS cccceceececceceeseeeeeeesenseneeeeesens 83 E Le 83 Specials with AutoCAD 2000 and AutoCAD LT 2000 ccc ccceeeeeeeeeeeeeeeeseeeeeeeeeaeeseeeenanes 83 Specials with A
194. nrecognized text can appear together with a recognized text string These vectors can be combined with the partially recognized text by picking the vectors you want to also combine followed by placing the cursor in the text frame and manually type in the desired text You also can deselect vectors not belonging to the text by holding the Shift key and clicking on the desired vector s 1 4 Zoom State Shortcuts 529 2 22 Text Angle 0 0 Start Point 53 53 d A4 Test Stole T2 ze Color BY LAYER e IT Show Test after Editing Explode Close Pause Clicking Next allows you to inspect the next text sequence for editing and so on Interactive Text Recognition The lower left dimensioning string 7 3 may not have been recognized which was purposely distorted which is why this text string does not appear during the process Review Text Drawings with very poor text imaging are best modified using the interactive text command Zoom in to this area and window select all vectors belonging to this text the P selected vectors turn into dashed lines as a highlight Click the Combine to Text icon CHE The raster area and the recognized text string are displayed in the dialog window H it shows correctly 97 3 click OK otherwise edit the text appropriately Now all text strings are correct V 6 7 E Section3 Tutorial 79 7 sottelec E VPraster pro VPraster Changing Text Heights VPraster LT Sometim
195. nt text size and parameters of the attributes can then be modified using Options Block Definitions Modify By default all PSB files are saved in the SUPPORT subdirectory An additional search structure with a different geometry is created for an existing prototype The program searches for this additional search structure just like another prototype but the same exchange block is used A search symbol prototype can contain any number of search structures even symbols of a very different appearance can be replaced by an identical new symbol block If you have made an incorrect selection click this button to delete a marked symbol The dialog box closes and the Search Symbols dialog box is reactivated No prototype is created 232 Section 13 Symbol Search Replacement V 6 7 7E Load Remove Modify 7 sottelec E VPraster pro VPraster VPraster LT You can load existing prototypes PSB files When a file is loaded the display shows the search symbol prototype as well as the block which is inserted instead of the symbol A currently loaded and selected prototype file is removed from the list The button is only active if at least one file is loaded The prototype s searching parameters can be changed In addition the symbol exchange block can be replaced by another existing block and the block can be scaled Searching Parameters Struct fi 4 of 1 Tolerance jis 4 NAME INLN max Gap Pixel E
196. nt snap modes are displayed with the symbols shown in the dialog box With Marker Size and Marker Color the symbols can be modified accordingly Default Marker Size 6 pixels Marker Color Yellow The status bar on the right displays the actual settings of the snap function The different colors of the snap symbols which represent different snap modes according to the dialog have the following meaning e Grey snap mode is turned off e Black snap is mode turned on but this snap type is not possible at the current mouse position e Green snap mode is turned on and this snap type is possible at the current mouse position Use TAB to select one of the green marked snap types for activation e Yellow the activated snap type is displayed It appears also on the drawing close to the mouse position if the snap can work A particular snap mode can be turned on or off by clicking on the respective symbol in the status bar A double click pops up the Drawing Aids dialog 116 Section4 General Functions V 6 7 E 7 sottelec E VPraster pro VPraster CAD Options VPraster LT A dialog box opens for selection and value input CAD Options EN M General Polpline M As Multiline T Create Block from Polyline l Block Prototype Arrowhead Allow Line picking Length of point arrowh 3 50 Length of dim arrowh 3 50 Hatch C Solid m Transparency Lines T Enable IT Cross Hatch FigGpacityat 1
197. nter EE 211 Comec Hate EE 212 CAD EE 213 FO E 213 Eeer 213 Eege 213 Gl sed FONIO usyan e n OEA EEEE 214 viii Table of Content V 6 7 E 7 sottelec E VPraster pro E VPraster E VPraster LT Eege 214 PA Sh DON EE 214 PAPE VA OI EE 214 ACN CONNECTION EEN 214 Crol RadiUS EG 215 e ee Cd EE 215 FETE e EE 215 EE 215 TOG EN 216 Dimension All OW cine isitisccannaveuncsduetinanntdioxnameisnenncanainesedneaittvenstsinnnamedutiemunsnanaacatsintuenstaeenaredssduunceedin 216 e Ee 216 DONUT EE 216 FATE CPD IAEE E A EE E E A A A E E A 217 INSE et 217 Combining Vector El toeutesaseguasess rsegseeagegst deed dE e 218 COOL EE 218 Combine To ee EE 218 Combine Re E 219 COMPING ee E 219 COPO FO ALG EE 219 COMPING TO CICE sissen a aeaa 219 COMDE EE 219 Combine to Text Interactive Text Recognmton 219 Combine t EE 220 COMDING Te 221 ASSINE 21762 410 E 221 SECTION 12 OPERATION BLOCKS ccccccceeeccceeecccececceseeccseeceseecneeecneneeeuees 223 General Information cccccceceeceeceececeecuscuseueueeusausaueueeueausaueaueuseusausaueaeeususaueueeueausausaveureusauss 223 ANN EU US states sce seis ecto eae cs ess ets esc ss oes ese 223 Combine to BIOCK EE 223 EE 227 Modifying Block Definitions A 228 SECTION 13 OPERATION SYMBOL SEARCH REPLACEMENT 229 General Information cccccceceeceeseeeeceeeeuseueeeeeeeusausaueeeeusaueausaueuseusausaueueaueusaueeeeueausauseueueeusauss
198. oefficient sum of 0 For this kind of filters the image s dynamic range will be shifted to enable the display of possibly generated negative values Section 7 Color Reduction Color Separation Color Classification Filters 153 7 sottelec E VPraster pro E VPraster VPraster LT Choosing Remap a new image palette will be calculated after filtering Otherwise the filtered image will be displayed with the prevailing palette Weight controls the filtering result being multiplied with the entered value thus stretching or compressing the generated result contrast Offset moves the filtering result is to brighter values with a positive offset and to darker values with a negative offset brightness Preview works in the same way as described above in Median and Blur Filters Apply Filter will activate the current filter option on the original Close exits from the dialog box If there are modified or new filters which have not been saved the user will have the opportunity to cancel the closing action in a dialog box Otherwise modifications on existing or new filters will be lost 154 Section7 Color Reduction Color Separation Color Classification Filters V 6 7 7E Filter Table We eng V 6 7 E Blur Filters Edge Detection Filters Effect Filters Section 7 7 sottelec E VPraster pro E VPraster VPraster LT blur gaussian crosshatch horizontal vertical kirsch_e kirsch_n E Kirsch ne 4 v kirs
199. of vector data on and off When you load a vector file the display of vector data is enabled automatically This is indicated by a check mark next to the item in the menu lt Zoom All zooming functions are contained in a submenu they can also be selected via icons Extents The drawing is displayed in full Its center is mapped to the center of the display Oe Window When you select this item you can define the window size by picking points with the mouse First click picks the first corner of the window Second click defines the window size and zooms the drawing in the window Pixel 1 1 pixel zoom Each raster pixel is represented by one dot on the screen In This option zooms in incrementally to the maximum pixel viewing level while maintaining the viewing center point Out This option zooms out incrementally maintaining the screen center point in view if possible Previous This option lets you work your way back through previous zoomed views The program remembers a maximum of 32 views It does not recall pan operations e ai la le V 6 7 E Section 4 General Functions 103 7 sottelec E VPraster pro VPraster Pan Cursor Keys VPraster LT Using the scroll bars on the bottom and right window margin or with the sub menu commands the image display can be moved in x and y orientation Drawing Aids This icon or Options Drawing Aids will show the dialog box Drawing Aids They serve to
200. of your choice as your new prototype drawing see also Settings Tab Files Section 4 For freehand drawing left mouse button or freehand erasing right mouse button in the raster layer B W or color depending on the raster file Direction of movement is constrained to n x 45 by pressing the Shift key Line weight is set using the Line Weight dialog box and applies to drawing as well as erasing For drawing individual 2 point lines For drawing a polyline with any number of corner points Complete the line by double clicking the left mouse button or press Enter See also Section 4 Close an open polyline by selecting it first and then choosing Make Corner Section 11 Hybrid Editor in the VP HybridCAD Window 213 7 sottelec E VPraster pro VPraster Closed Polyline VPraster LT For drawing a closed polyline with any number of corner points vertices Complete by double clicking the left mouse button or pressing Enter Hold the Shift key to draw orthogonal vertices to a previous vertex in any orientation Hold the Ctrl key to draw orthogonal rectangles Complete by clicking the second point For drawing a B spline through the click points Complete by double clicking the left mouse button or press Enter See also Section 4 Arc 3 point For drawing an arc through three points in arc sub layer Name A 1st click point start point arc 2nd click point end point arc 3rd click point arc curvature
201. ogram start will invoke a new automatic server search Section2 Installation 19 7 sottelec General Servers 20 Section 2 E VPraster pro E VPraster E VPraster LT Logon This menu item is available if a server has been selected by mouse click After installing the VPLicenseManager only two users are defined User Administrator password Administrator user type Administrator User MonitorUser no password required user type MonitorUser With the first logon the Administrator s password should be changed immediately When starting the VPnetManager a MonitorUser will initially be used not assigned to a password yet That means any user having access to the program will be able to view all license information except for information on other users logged on the VPLicenseManager but he does not have rights for modifications If no other information except for information on the servers shall be visible after starting the VPnetManager the user MonitorUser must to be deleted on the server However individual users may be provided with an account using a dedicated name and a password The user status may either be MonitorUser or Administrator Log on SOFTELEC_DOMAIN Username Administrator Password The user will be logged on to the server displayed Note that the user name and the password entry are case sensitive VPnetManager will attempt to log on the new user to any listed VPLicenseM
202. om or wild settings as this will only lead to unexpected results Refer to your manual for further instructions Confirm your settings with OK and click on the Post Process icon the parameter dialog box opens once again to let you check if the correct settings are active Start the Post Processing by clicking OK The process can include a total of seven processing steps depending on the parameters In the status bar the progress during processing will be indicated When completed the generated vectors will overlay the raster data as colored entities Switch off the raster display with F4 or by clicking the Raster Display icon for an isolated display of the vector data Save the file according to our previous settings in the Save and Save As dialog The VCF file is now ready for vector editing or final clean up before exporting it Section3 Tutorial 77 7 sottelec E VPraster pro VPraster Editing Vector Data VPraster LT During this lesson you will learn how to edit the vectorized data and to export the vectorized data into a DXF file Line Weight Classification In the vector display you will notice that the vector lines of the spring object are yellow in color as per the L2 layer definition Double click on one of two circles in cyan color to open the property dialog box Circle The selected circle resides in layer L2 C C for circles as defined for layer L2 Similarly you will see that the spring s arc elements in green co
203. on Histogram Press lt SHIFT gt to deselect colors in preview window Save Reset Cancel r Convert M Change Pixels I Color Separation P Gonvert ta BYN OK r Preview M On T Flash IT False Color eer e na 13 67 ary Color A G B C M Y Preview p Convert A ton 8 to Colors 8 Colors used Execute Bea P 20 026 051 204 _ s M On T Flash E Change Pixels a EI E T False Color Modify Color s Pixels Percent DS Absolute 13 67 fn m ERRER 162 Section7 Color Reduction Color Separation Color Classification Filters T Color Separation E Gonvert to B W Expot ox Emplone p s Load sm Reset Cancel V 6 7 E 7 sottelec E VPraster pro E VPraster Section 8 This section applies to MVPraster LT Operation Rubber Sheeting Split Merge Cut to Paper Format Multi Point Rubber Sheeting To complete the rubber sheeting of raster files efficiently especially in cartographic and cadastral applications the following parameter settings and functions should be considered 1 Step Adjustment of the coordinate system according to the specific map 2 Step Rubber sheeting set up 3 Step Entering of reference points including correction values if necessary 4 Step Completion of rubber sheeting with previous selection of the required transformation function The user will be guided through all necessary steps au
204. on mode and transfer the vectorized and edited entities to the AutoCAD window click this icon or the menu Switch to AutoCAD After invoking the VPraster pro vectorization mode the main program window is changed Praster pro Edit Entities Vectorize Display Options Help Switch to AutoCAD Sle Alsi slslajajalal Flv ol zg 2 IRN 29409 130 77 Delp Sl J u is ma 44 Fos gt SNA Zlnlolm Ser SNS E1251 1G 6 24 B 41 6 v ol eee 2 DEE ol js 2 glas ge J OF 4 f f A f f L f 8 d j 4 CH 12 36 joo VPraster pro vectorization mode showing all Toolbars V 6 7 E Section4 General Functions 99 7 sottelec E VPraster pro VPraster VPraster LT In Options Toolbars the user can activate his icon groups individually according to the needs of the specific application on hand Moreover these icon groups are subject to deliberate positioning on the screen even within the working area VPraster pro Graphic Display These pull down menus are available File Entities Vectorize Display Options Help Switch to AutoCAD Their sub menus contain all of the program s commands and available process routines Additionally the main functions can be activated directly either through icons or short cuts General Functions Icons are activated by clicking on the left mouse button When Show Tool Tips in Options Toolbars is activated and the cursor a
205. on the topmost raster image we will first insert the object into the area previously erased to the right Again we will use the Raster Snap function Move the raster object to the right until the cursor is in the area of the crossing of the two construction lines Change with Tab to the snap mode Crossing A colored cross indicates the snap point click with the left mouse key to insert the object Copy Raster The previously moved raster object will be copied and inserted to the eft Copy the raster object with the corresponding AutoCAD command Position the base point with the help of raster snap mode Center into the center of the drilling hole Follow the same procedure Move the raster object to the left and insert it with raster snap mode Crossing on the crossing of the two circle center lines Execute Rasterizing with standard setting in order to merge the raster objects with the raster image emm The dimensioning text is crossed by a vertical line Erase the part of that line interfering with the text using the function Erase Raster and selection mode V 6 7 E Select Line The edited part should look like this Section 3 Tutorial 43 7 sottelec E VPraster pro E VPraster Edit Raster Text VPraster LT 44 Section 3 We will modify some of the dimensioning numbers The procedure is as follows First select the text with a rectangle 2 Point for horizontal or vertical text or 3 Point for text at any
206. ons while running the Review Text function If the function is activated and elements e g text are selected only these will be processed Delete Del Deletes the selected elements There is no such icon in VPselect although the function is available Layer Assignment Br Raster 5 Selected elements are transferred into the Current Layer or into Layers L1 L2 and L3 The sub layers for arcs circles and line types are automatically addressed according to the selected elements Clicking on L1 L2 or L3 makes it the Current Layer Selection and placement of the Current Layer Line Type Assignment Bif The selected elements are assigned the Current Line Type while the elements are transferred to the corresponding layers if necessary Clicking on one of the three line type icons makes the selected line type the Current Line Type Every line type that has been set up can be selected and used as the Current Line Type 208 Section11 Hybrid Editor in the VP HybridCAD Window V 6 7 E 7 sottelec E VPraster pro i VPraster Text Style Assignment VPraster LT E Selected text is formatted in the current text style first icon or the newly selected text style which then becomes the current text style In k If other text styles have been set up in addition to T1 through T6 that style can be chosen here as the current text style Move Object s If an individual vector element is selected this function
207. ore than necessary use the AutoCAD command Undo This command is applicable on most of the VP HybridCAD commands For selecting the wash basin use the selection mode Select Polygon Draw a polygon around the wash basin Do not accidentally select parts of the wall where the wash basin is attached Close the polygon with a right mouse click or with Enter Section3 Tutorial 29 7 sottelec E VPraster pro E VPraster E VPraster LT After you selected all necessary raster entities to be removed from the image press Enter The selected entities are deleted Save the changes to ARCH_1 DWG Inserting and Rasterizing Vector Entities From a library three additional elements for the bathroom are going to be inserted SHOWER1 DWG from the TUTORIAL directory Insert this block at the upper right corner of the bathroom Keep the scaling and the angle of the block X scale factor Y scale factor 1 0 rotation 0 0 Start the AutoCAD command Insert Block click File and select the file d Insert another block WC1 DWG Place the block at the left wall of the bathroom keep the scaling X scale factor Y scale factor 1 0 but rotate the block by 90 degrees When you are done you may have to correct the position of the block move it to the wall It may occur that while working on the second block the first one disappears it is hidden by the raster In this case just click Regenerate command line vprtoback to restor
208. orial 49 7 sottelec E VPraster pro E VPraster E VPraster LT The program will zoom to the first grid point on the lower left Click on the center of the cross point Pa e After clicking the first reference point the next grid point will be zoomed in The grid points are addressed from left to right and from bottom to top Proceed the same way for all remaining reference points The points you enter will be numbered The target values grid points will be indicated as green crosses while the entered actual values will be displayed as blue crosses The deviation between both values is shown by a green line In the case that a residual error remains after the rubber sheeting process the actual value s new position will be indicated as a yellow cross In detail this will look like this e g for reference point no 6 Depending on the number and position of reference points you have entered the highest transformation function rubber sheeting function possible will be selected automatically in our example the Quadratic function is chosen Entering without Grid Snap 50 Section 3 Maps which do not contain reference points in a grid structure require the entering of points without the grid snap option We ll demonstrate this method with our sample map First delete all points you have already entered Click the button Delete Point in the Rubber Sheeting dialog box repeatedly to delete all entries from the referenc
209. ormation of an artifact is not important but the cluster must be isolated from touching larger raster objects Entry keyboard or via button Pick from Range 1 thru 128 pixels Default 0 White Speckle Size Here you specify the maximum number of pixels required to fill a hole The hole must be circumferenced by active pixels otherwise the hole will not fill Entry keyboard or via button Pick from Range 1 thru 128 pixels Default 0 Search in Window on off If you enable this option only the window in question will be despeckled OK starts the function or waits for pulling up a window A progress bar indicator is displayed Once the operation is completed the specific raster elements detected are displayed as follows Dirt green Holes yellow If the program has selected raster elements that you do not wish to remove even if they do not exceed the sizes defined in the Black Speckle Size or White Speckle Size settings e g the decimal points in numbers you can deselect any marked element by selecting Delete Marker at the command prompt and then select the elements to be removed pick window crossing and end the deselection with Enter With the next Enter the rasterizing process starts and removes the remaining speckles V 6 7 E Section6 Raster File Editing 139 7 sottelec E VPraster pro E VPraster Smooth Raster E VPraster LT The function eliminates rough surfaces and isolated pixels an
210. orner of the drawing frame box again to zoom in further and then position the end of the rubber sheeting reference line precisely on the raster corner final click Then proceed accordingly for upper right lower left and lower right After entering the 4th corner position the program zooms back to the extents All four reference positions are marked by green crosses OK will start rubber sheeting Save the new file Cut to Paper Format 174 Section 8 This function allows you to cut the Active Image as a definable format size At the Command prompt enter vprcutformat The drawing should first be deskewed and rotated to the desired orientation before starting this procedure On selection of the menu VP HybridCAD Cut to Paper Format the format selection box see Rubber Sheeting of Technical Drawings appears to select a fitting drawing format or to define new format settings After selecting the Form Size and the Margins click OK The cursor will then be replaced by a rectangle or a double rectangle if margins have been specified representing the new image boundaries Place the inner rectangle at the desired position with a left mouse click To rotate the rectangle by 90 press Shift while positioning the rectangle A new raster image will be generated according to the outer rectangle boundaries Rubber Sheeting Split Merge V 6 7 7E 7 sottelec E VPraster pro E VPraster Split a File VPraster LT V 6 7 E
211. otropic Any number of blocks of a block definition can be inserted in a drawing Selected elements can be combined to a block Only vectors can be part of a block definition You create a block with previously selected elements by using the Combine to Block command These become part of the file you are editing and can be placed at any location using nsert Block When switching to the vectorization mode all block definitions of the AutoCAD database will be also available These blocks will be displayed only with the name of the block definition A block definition can be assigned attributes whose procedure and functionality are similar to AutoCAD Assignment of attributes is especially important for symbol searches since replacing the found symbol with a block makes it possible to read the attribute text from the drawing Creating Blocks Combine to Block V 6 7 E The selected elements are replaced by a block A dialog box appears for selecting a block definition Section12 Blocks 223 7 sottelec E VPraster pro VPraster VPraster LT Block name STAIR Offset bk y 0 00 Scaling x y D D Angle 0 0 Lauer BLOCKS V Convert Texts into Attribute Definitions OK Attrib lnsert Cancel O The name of the last used block definition is suggested and its geometry displayed If an existing block definition is chosen from the list of available names the selected elements are replaced by that blo
212. ottelec E VPraster pro VPraster Review VPraster LT All blocks in the current file can be edited They will be displayed successively with their attributes as Previous Explode Close Clicking Next or Previous switches to the next or previous block Explode will restore those elements formerly replaced by the block by symbol search or by Combine to Block Close exits from function See also Section 12 OCR Options Recognition Level allows the setting of a tolerance threshold to define the acceptance level for each recognized character A character having a lower level will be rejected and displayed as question mark instead Experimentation for drawing extremes may be required However please do not expect the OCR of poor text to be improved Range 0 thru 99 Default 36 Character Set specifies the recognized letters or digits The text recognition can be customized to specific requirements in a drawing Selection options include e Any European language with definable special characters e Digits and definable special characters only Handwritten characters optional e Definable special characters only 114 Section4 General Functions V 6 7 E 7 sottelec E VPraster pro VPraster Drawing Aids VPraster LT b A dialog box opens for selection and value input Ce x Spacing fi UU x Spacing fio DU Cancel Y Spacing fi 00 Y Spacing fio 00 I RasterSnap TI VectorSnap
213. plot command Raster information and AutoCAD elements can be sent together or separately to the plotter Options for saving raster files include the standard AutoCAD procedure with indexed separate raster files and the VP HybridCAD RasterDWG procedure saving raster and AutoCAD elements in one single hybrid file This RasterDWG file is compatible with AutoCAD while all contained AutoCAD elements will be read by any AutoCAD system A freeware utility RDWG is provided to also display and plot the embedded raster information if VPraster or VPraster LT is not installed Introduction V 6 7 E 7 sottelec E VPraster pro E VPraster Scanner Interface VPraster LT The integrated scanner interface for the most popular large format B W and color scanners allows for direct capture of drawing data into AutoCAD Thus the time consuming process of activating any external scan software saving the raster data and then importing the data is eliminated See Appendix B for scanners supported H VPraster pro E VPraster Raster File Editor WE VPraster LT The professional raster file editor in VP HybridCAD products has been designed for extensive file editing of the complete raster image crop trim deskew rotate despeckle fill holes mirror the file split and merge raster files rubber sheeting etc The rubber sheeting function provides elimination of local distortions in the loaded raster image which can be caused by aging incor
214. pro E VPraster E VPraster LT The map is to be rubber sheeted in a way that the coordinates of the reference points correspond with the map s details In the menu VP HybridCAD call the sub menu Rubber Sheeting and select the function General Multi Point command line vprrubber You are asked to set up the coordinate system In the User Coordinate System dialog box User Coordinate System User Units Meters m m Drawing Scale Precision 1 11000 000 Co 00 0 00 D 4485500 000 GE D 5382500 000 C 0 0000 Pick UCS Origin T Show UCS Icon Carcel _ m Origin in User Units set the User Units to Meter since this map has been drawn in Gauss Krueger coordinates Set the Drawing Scale to 1 1000 as indicated on the map The lower left reference point on the map will serve as the Origin enter 4485500 for the x value and 5382500 for the y value Click on Pick UCS Origin Zoom in to the respective reference point on the lower left of the drawing and click on the center of the raster cross point The origin is specified Accept all other settings in this dialog box with OK Entering of Reference Points 48 Section 3 Next you will be asked for drawing aids The current raster map contains reference points which are structured in a grid The distance between each point is 100 m Tutorial V 6 7 E 7 sottelec E VPraster pro E VPraster Entering with Grid Snap M V
215. r LPT 1 3 and try again If a printer or some other device is connected to the same port it must be switched on to ensure proper operation of the hardware lock 244 Appendix Error Messages Scanner Interface V 6 7 7E 7 sottelec E VPraster pro E VPraster E VPraster LT The automatic zoom in feature will be disabled since the specified grid is too dense The specified grid is too dense to compute the related zoom positions In this case the automatic zoom in function is disabled but the grid stays active for the second point This may happen if the Drawing Scale or the Units of the User Coordinate System are not set up properly The entered Serial Number is not valid You have tried to update your hardlock but the entered serial number which is printed on the softelec label on your hardlock is not correct Please check your serial number and try again The entered Update Password or the Password Length is not valid You have tried to update your hardlock but the password s or the password length number of passwords is not correct Please refer to the information along with the software for the correct password s and password length Contact your dealer or softelec for assistance The raster transformation could not be carried out correctly since there was a internal error detected This message usually only appears when you ignore the Abort Transformation message During the transformation an error occurred
216. r SMall ge TE 197 Parameter Straightening E 192 SCH In El e scenene aE Eea ENEE EEEa oa 200 Paa KEE 194 Farameter Text RECOOMIUOM dcapnccancsscteaticcaressaqsntesiaeatencanente EE a o aa eE ED E ENERE 195 Parameter Text Search Drecton 195 Parameter Text Selection Hegaht NENNEN 194 Parameter Text Separation cccccccssccsseccseecsseceseccseecaeecesecsaeesaeeeegeesaeesaeeeageesaeesaeeseueesgestaessaeeesaess 194 Fatrameters Fost FrocessSiNg E 190 Paste ffrom CHDD OEIC assein aaea aaa ia a irii 210 V 6 7 E Index 259 7 sottelec E VPraster pro E VPraster E VPraster LT Eeer 213 ie et 107 Pick eS be te IO E 127 e EIA wcgisieaspuateaan ites waaenuuetesn pase vine E T arena npeueseun cubano unde caw ace mmenieca eeieass 186 PO AT e EE 216 Selliieten ge 104 ak Alte 213 OLY IS De II ON EE 118 POSE PO OSS S I eege 190 Progra e E 86 Properties Of Vector Entities ccccsccsseccsecceeecsseeceeeceneecseeceecegeeseetaeeeeseeeaeetaeeeegeessestaeesegesssestaeeess 211 PURGE Table gg careers sciee sane tte xnacaateeade Yetaeansiice aden Ea wane uote dane cee a eaneeee mde Reena ace ee eae 111 PIS COR i Se e o e RE 135 ASL WE el E 124 eege 97 RE EEA EEN 93 Raster to Vector Conversion ssssssssssrsrrrerrsrrrerrrrrrnrrerrnnrrnrrnrronronrrnrrnrrorrnntrnrrrnorrnnnnnnn ren rnnnnnnnenna 187 le EE 205 Se le 105 205 RECUCING GCOlOKS Gray SCA Ci steeinscnciehcice vaceaniiosetivien ance van silacuaice wont waandinca tities
217. r inside window selection Move Copy Scale Rotate Rasterize File or window area Background B W erasure of raster selectable CAD entities line arc circle Contour line Dashed contour line B W only Pick tracing Zoom window Produce splines Assign elevation Vectorization method Centerline Outline Centerline Outline Straightening parameter 1 pixel 0 0635 mm 2 5 mils 400 DPI Filter custom filter up to size 7x7 pixels Color reduction automatic interactive Color separation Color classification Load save palette Contrast brightness gamma correction Specifications 237 7 sottelec VPraster pro Vectorization B W Area Methods of Vectorization Threshold Max Size Accuracy Vector Post Processing Symbol Search Settings CAD Entities Settings Functions of Vector Editor 238 Specifications E VPraster pro VPraster VPraster LT File window or polygon area Centerline Outline Centerline outline selectable 5 thru 63 pixels 64 000 x 64 000 pixels 1 pixel 0 0635 mm 2 5 mils 400 DPI Whole file or selected items Line arc circle ellipse extraction Small circle recognition replacement Line width weight classification Line straightening line chaining Line type recognition dashed dash dotted Element and line width assignment to layers Angle correction Gap jump Coord snap Arrowhead Connection dot donut recognition Hatch extraction
218. r required At the command prompt enter vprautoregen Show Raster on off Ei Switches the display of raster images on and off s At the command prompt enter vprshowraster H VPraster pro E VPraster Dynamic Width on off VPraster LT If set to on the raster draw functions use the original raster width as line width WW See Section 5 At the command prompt enter vprpickwidth E VPraster pro E VPraster Zoom Active Image M VPraster LT Select Active Image Zooms to the Active Image s extents At the command prompt enter vprzimage Selects the new Active Image from the drawing At the command prompt enter vprselimage Select Image Pick the frame of a raster image 98 Section4 General Functions V 6 7 E 7 sottelec E VPraster pro VPraster Regenerate VPraster LT Executes a send to back command for the Active Image and a regen to update the display accordingly At the command prompt enter vprtoback Raster to Vector Conversion Basics After invoking the VPraster pro vectorization mode the main program window changes providing special VP HybridCAD functions for vectorization of the Active Image AutoCAD functions and entities are not available during this mode Most functions and routines can be activated through graphic symbols icons or by clicking on commands listed in the pull down menus Using F1 offers access to an extensive online help at any time In order to leave the vectorizati
219. ragmented raster show additional despeckling Always insure of good quality scans degeneration of the image due to Section6 Raster File Editing 135 7 sottelec H VPraster pro E VPraster All W VPraster LT This icon and VP HybridCAD All opens a dialog box where several editing EN functions for sequential processing can be activated At the command prompt enter vprrfe File Edit Crop IT Horizontal Mirror IT Invert Vertical Mirror Rotate co Reference for Rotation 2 sof C 90 C Horizontal fo 0 E 180 2 North fo 0 m Speckles Black Speckle Dirt Size fo Pick from White Speckle Hole Size fo Pick from e _ Cut Window This function cuts a section from Active Image for selective editing and conversion You determine the desired image area by dragging a window with the mouse The new raster file will contain information according to the selected window frame At the command prompt enter vprecutwindow This function erases all raster information from the Active Image outside of the selected window size The original raster file size length x width in pixels remains At the command prompt enter vprcrop Deskew This function lets you correct small skew errors that frequently occur during scanning The whole file will be aligned according to a horizontal or a vertical reference line At the command prompt enter vordeskew 136 Section6 Raster
220. raster file AN edit color filter tools tracing rasterization etc are automatically related to the Active Image The Active Image is shown in red all red for B W images a red frame for colored images V 6 7 E Section4 General Functions 83 7 sottelec E VPraster pro E VPraster E VPraster LT The Active Image name is displayed in the combo box of the Tools toolbar You can change the Active Image by selecting another name from the combo box Clicking this button or with the Active Image function from the VP HybridCAD menu you can also select a raster image to become the Active Image At the command prompt enter vprselimage VP HybridCAD Menu VP HybridCAD adds by default a VP HybridCAD menu item and 8 toolbars to the AutoCAD menu e General e Raster File Edit e Edit e Tools e Draw Erase Raster e Trace e Vectorize e Color Filter Except for Tools you can modify these toolbars via the standard AutoCAD too bar command The Tools toolbar is a special toolbar which cannot be modified Also this toolbar requires the space of a whole line in the AutoCAD dock bar 84 Section4 General Functions V 6 7 E 7 sottelec E VPraster pro E VPraster E VPraster LT All functions available in VP HybridCAD are located in this menu Program Settings Show Toolbars Load Raster Image Save Raster Image Save Hastert uc Create Raster Image Scam Show Raster Image Info Rasterize Entities Rasteriz
221. raster file will be extended by two digits incrementing from 01 to 04 Tutorial V 6 7 E 7 sottelec E VPraster pro E VPraster VPraster LT The new B W raster files which can be cleaned up and vectorized as usual should look like this 1 1 10020 lieth ko KO 450 2 ond KS 646 89 se 2000 oy d D RN oO ee KS 446 69 E KAT_103 TIF red KAT_104 TIF blue V 6 7 E Section3 Tutorial 65 7 sottelec WE VPraster pro E VPraster Lesson Seven Color Classification VPraster LT Another approach to reduce the number of colors is the classification method While color reduction is a palette based process that is the entries of the color palette are modified and each modification changes all pixels with this color The classification gets additional information from the position and the environment of each pixel e g color pattern so pixels of the same color can be matched with different associative color blends to different color patterns In this example classification of colors is preferable for raster images where pixels of similar colors relate to a specific meaning That is the many shades of blue relates to the water regions shades of green to the grassy parks white for the streets black for text etc By reducing colors to mean specific regions of the image you also significantly reduce the file size During this lesson you will learn how to e analyze colored raster wit
222. rect drawing design and or scanning tolerance errors This will result in high precision calibration which is especially important in cartographic applications GIS E VPraster pro E VPraster VPraster LT Oversized raster images exceeding the maximum processing capacities of VP HybridCAD software can still be loaded and split into as many as 25 single image files Additionally raster files can be merged with options of free positioning rotation and scaling for best placement to each other HE VPraster pro E VPraster Hybrid Editor W VPraster LT V 6 7 E The hybrid editor provides functions to edit raster data and vectors This includes the drawing of lines circles and arcs using different lines and line styles the copying and deleting of elements or areas and the editing and insertion of text and many more using the standard AutoCAD drawing and editing commands While drawing a vector entity the underlying raster data can be automatically deleted by user settings At any time however single or grouped elements can be made part of the raster file by rasterization Section1 Introduction 7 7 sottelec E VPraster pro VPraster Vector Editor VPraster LT On the vector side single vectors can be combined to lines circles or arcs Text generated by the automatic character recognition function can be reviewed and edited if necessary You can transfer elements to different layers correct angles and drawing erro
223. ree ene ieee ene Seer 176 Modiiy SOUS EE 147 Modiy SVD Ol NEE 233 Modifying Block AR re CN 228 Monitoring VPLicenseManager ccccscccsecceeeecseecaeeeeeeecseesaeeeeaeesaeesaeeeeaeesaeesaeeeeaeesaeesaeeseaeeseeesaeeees 18 Move ae Ee EE 209 Ville 123 Multi Point Rubber Sheeting ANEREN 163 To E Oe lo erence rer ter A ere ret ene A enn menor E N rrr rrr E E eer er A ne ttn rt ter rar 203 Gol e E e EH 109 OCR dt E 114 COINS IVS E 106 Blue tege EEN 189 Package Oe pica eee ene eh ee n en 12 Palette TPaNSTOPMatiONn siiscississiscaivesssnssseediesianersncsnabenstseatneiswnrtensdunsiinndineriaunnieesnediastacntanssinaeanatnasisnes 156 Palette Transformation Table s ssesnesnssneunnsnnsrenrrrnnrerrnrrrrrrnrrsrrorrrnrnnrrnrrorrenrrnrrnnronrnnrrnnrernernennrnnnnna 161 Fr ANN EE 104 Parameter Angle e te EE 193 elle 195 Parameter ge MCAS ancy cancxanreannssnnaunnescnrannanawcunemsauncevnnpestenieesineaisaimimpasgisanan edispaapaaiisinesyieimesnawsanivaesaaies 198 Parameter RT 195 Farameter DONUTS seomar erena n EA vnen pid tess Hees ein paee ee abe stant nes aoa eS 198 Paramete EDS vccstcnsinnsinnssnessanainatinnstansimedoaiianstansinedeatsonatnnsispaliaaioonatedsiguleatinnninestdaatuatvansinciiees 198 Parameter Gap JUM WE 193 Parameter E 1G SND EE 193 chee el E E 199 Parameter Line a IO ie toonesinasean dee meerncertesecmaseucsensesteneas teense an aaia a anaa 192 Parameter Line e EE 196 Parameter Line Width Classes AA 200 Paramete
224. requency Smooth The palette is modified so that in the Scalefactor Output each palette entry has the same frequency The scale factor modifies the transformation Gamma Correction Black and white remain unchanged Gamma while the intermediate palette values are modified Gamma lt 1 stretching of lighter values compression of darker values Gamma gt 1 stretching of darker values compression of lighter values S Gamma Correction Black white and the Turnpoint Gamma remain unchanged while intermediate palette values will be modified Turnpoint lt Gamma lt 1 stretching of lighter and darker values compression of values within the Turnpoint range Gamma gt 1 compression of lighter and darker values stretching of values within the Turnpoint range Steps A range of Input values is Handle X transformed to one Output value Handie Y g s Lines Multiple effects depending on Handle X individual value settings handles Handle Y V 6 7 E Section 7 Color Reduction Color Separation Color Classification Filters 161 7 sottelec Histogram Dialog Box Displays Dialog box with 800 600 pixels resolution Histogram WE VPraster pro E VPraster VPraster LT lim 3 Color A G B C M Y from 8 tol Colors 8 Colors used Ee E 2 204 5 51 026 051 204 LI el Combine Modify Colorfs Export Eypiode E 7 Load Dialog box with 1280 1024 pixels resoluti
225. ro E VPraster VPraster LT The Output area is organized in two sections the Output View and a set of buttons to modify the Output View and thus the image s palette Red Green and Blue display an image in the corresponding colors of the palette Gray generates a gray scale representation of a color image while A displays an image in all of the three basic colors The Output axis of the Transformation View reflects a modification to these settings Selecting Red Green Blue or Gray can also change the Numerical View and the Transformation View With Move set to on the Output View will be synchronized with the movements of the Input View sliders The Input View shows the whole image by default The view can be modified using the two sliders and the Zoom In and Zoom Out buttons The maximum Zoom In displays a 1 1 view of the image The Output View changes according to the modifications of the Input View Color Reduction Color Separation Color Classification Filters V 6 7 7E 7 sottelec E VPraster pro VPraster Palette Transformation Table VPraster LT Automatic Brightness The palette is stretched to fit the Contrast whole dynamic range without loss of information Brightness Contrast The brightness and contrast of the Brightness X image can be adjusted Brightness Y Contrast Automatic Smooth The palette is modified so that in the Output every palette entry has the same f
226. robes which are unique in this image Save the processed classification values with Save Classification to CITY_1 VCS With this file you can classify raster images with the same regional structure Click on OK and the image will be converted to seven colors corresponding with the seven generated classes 72 gt Section3 Tutorial V67 E 7 sottelec E VPraster pro VPraster Lesson Eight Vectorization Auto R2V vPraster LT During this lesson you will learn how to e prepare a raster file for the vectorization e vectorize the raster file e edit the vectorized data Preparing the raster file Start with a new drawing and import the raster file TUTOR TIF from the TUTORIAL directory The entire raster file is going to be horizontally mirrored deskewed and cleaned despeckled Next single raster elements will be deleted redrawn or moved Mirror Deskew and Despeckle To mirror the raster use the function Horizontal Mirror Next click on Auto EE TE Cleanup the raster data are automatically deskewed and despeckled V 6 7 E Section3 Tutorial 73 7 sottelec E VPraster pro VPraster Erasing Raster Elements VPraster LT The remaining speckles are to be removed eme Click the function Erase Raster command line vprerase select the x mode Select Rectangle and mark the remaining speckles To end the zama selection click on Confirm Raster Selection or press Enter Draw Raster Line
227. rrow is placed on an icon without clicking the function s designation opens Also a short description of the function is given in the status line at the bottom of the window Functions that cannot be activated in the program s current status appear grayed whether as an icon or as a pull down menu command Status Display There is a comment box at the lower screen margin showing the appropriate activated function with references to its meaning When no function has been activated the comment box remains empty while a For Help press EI indication opens Using the Mouse When positioned in the window s workspace the mouse pointer normally opens as a crosshair when moved to the menu bar the icons or the status bar it opens as the standard windows cursor 100 Section4 General Functions V 6 7 E 7 sottelec E VPraster pro VPraster VPraster LT A triple white frame box instead of the standard crosshair indicates that with the next mouse click this area will be zoomed in to scale 1 1 in order to allow a precise positioning of the next point click Selecting Vector elements in graphic mode can be done in three different ways e Clicking Click on the respective element within the cursor s snapping range Only one element will be selected per click When only one vector element is selected it is displayed bearing handles e Window You select elements inside a rectangle by holding down the left mouse button and dragging
228. rs or interpretation faults Different elements can be associated to form blocks and these blocks can be subsequently exploded In addition new vector elements can be generated moved copied or replaced Entering new text and hatch pattern creation are also supported All elements recognized during the vector post processing can be manually drawn Raster to Vector Conversion Raster files that you have modified or c eaned up using the raster editors can be vectorized using VPraster pro in whole as a single operation or in sections The vectorization process consists of two steps e Raw Vectorization e Vector Post Processing You select one of three vectorization methods followed by an automatic post processing operation The first step creates a raw vector overlay which is displayed in white above the raster image To complete the conversion the post processing is executed as a second step running on user defined parameters VP HybridCAD software provides an initial set of predefined parameter files PCF for various applications these files can be modified to meet specific recognition requirements and saved for later use Select a suitable parameter file make any modifications and then start vector post processing The result of this operation replaces the raw vector data with intelligent vector entities Colors are used to denote line width classes and different elements such as arcs circles text symbols blocks and hatches
229. s a dialog box to enter the data of a user specific form Values refer to Drawing Units settings pixels mm or inches The button Modify Form opens a dialog box to modify the specifications of the selected form Delete Form will delete the selected form This function erases all raster information within the specified margins e g between the two rectangles Default off Enter margin values for Left Right Top Bottom The 4 margins determine the distances between the drawing frame and the physical paper edge drawing format For example the length of the paper form taken from edge to edge of the paper minus both margins left and right will define the effective drawing frame s length after the rubber sheeting process While each paper format can bear different values for margin distances Save as Default saves the actual margins for permanent use with the selected form size Section8 Rubber Sheeting Split Merge 173 7 sottelec E VPraster pro E VPraster Different Margins on off W VPraster LT When on different margin values can be defined When off the Left margin value will be set for all margins After selection of Form Size and Margins and clicking OK the paper format rectangle will be placed on your drawing If there are margins specified a double rectangle will be displayed instead The upper left corner of the drawing frame will be zoomed in while the cursor appears as a triple frame box Click the c
230. s and a dashed line is drawn from the current cursor position to the end of the traced contour Upon clicking the left mouse button a new vertex will be generated at the pin cursors position From here the tracing may continue Contour Trace Linetype To activate this function click this button or choose the command Dashed Contour Trace from the VP HybridCAD Tracing pull down menu bar This function converts dashed raster structures into a dashed polyline or spline in the current layer At the command prompt enter vprdtrace On the first line click the current line segment length is converted The second click on the next line segment then determines the gap length and continues tracing automatically The tracer stops at branches and arrows appear for selecting the continued tracing direction In the main window or in the zoom window click on the arrow for the desired direction When pressing Enter the line will follow the most obvious direction yellow arrow Clicking the right mouse button cancels the trace at the current branch A This function might continue tracing on neighboring lines in tight spots A This function is only available for B W raster entities Undo Trace V 6 7 E To activate this function click this button or choose the command Undo Trace from the VP HybridCAD Tracing pull down menu bar This function is only applicable to the Contour Trace and Contour Trace Line Type H you select the wrong dir
231. s as a frame box to zoom in to any desired position for clicking a reference point actual position Then an input box appears containing the coordinates for the reference point as actual Adjust from and target foi position The target value may be entered modified by keyboard You may decide to either enter cartesian X and Y or polar coordinates distance and angle At least one cartesian coordinate value must be entered before you can input polar coordinates After OK the frame box cursor re appears while the screen switches to extent view If neither Grid Snap nor Automatic Zoom are activated the input box appears with each click on the raster drawing In this case the user will have to zoom in unassisted Clicking on nput will end enter mode of reference points Default off 170 Section8 Rubber Sheeting Split Merge V 6 7 E 7 sottelec E VPraster pro E VPraster Rubber Sheeting Function W VPraster LT Select the rubber sheeting function There are six different functions to choose from While in input mode the program suggests a suitable function automatically and will calculate correction values concurrently In proportion to the number of entered reference points the system will suggest a higher transformation function Le providing the highest attainable rubber sheeting precision A lower transformation function can always be chosen If the mathematical equation cannot be solved properly a warning mess
232. s in one direction from this point until it reaches the next branch or the end of the line Upon reaching the end of the line or if the process is canceled by clicking the right mouse button at a branch the opposite direction is automatically At the command prompt enter vprtrace The tracer stops at branches and arrows appear for selecting the next tracing direction In the main window or in the zoom window click on the arrow for the desired direction When pressing Enter the line will follow the most obvious direction yellow arrow Clicking the right mouse button cancels the trace at the current branch The OK cursor appears when a line has been completely traced Click the left mouse button to confirm the trace and generate the CAD element Click the right mouse button to discard the result To continue a line with gaps press the Shift key while clicking on the next part of the line In this case the 4 Way cursor appears with a sign If you are in the Append Mode a dashed line appears between the cursor and the end of the traced line and the next part will be automatically appended without pressing the Shift key Clicking the right mouse button will interrupt the Append Mode to start a new line 184 Section9 Interactive Tracing V 6 7 E 7 sottelec E VPraster pro E VPraster VPraster LT In order to add new vertices to a traced contour at the current position press the Ctrl key A pin cursor appear
233. s raster erase and draw tools Zoom to the door in the lower part of the raster image Erasing the old raster section Activate Dynamic Width Command line vprpickwidth to enable an automatic WW assignment of the line width while drawing or erasing raster structures V67 E Section3 Tutorial 31 7 sottelec E VPraster pro E VPraster VPraster LT With this command you specify a raster line that will be erased immediately Set the first point of the line on the door wing at top right and the second point on the corner of the wall The specified raster is erased End the function right mouse button or Esc Activate the Erase Line function by clicking this icon command line vpreline Proceed in the same way with the raster line representing the closed door and the line of the wall opposite of those already erased For the remaining raster line of the door start the Erase Arc function command line vprearc Set the start point of the erase arc at one end of the raster arc the fen second point to the middle of the arc and the end point at the end of the arc To erase part of the tiles use the function Erase Raster command line vprerase and Select Polygon Draw the area to be erased with the polygon to close the polygon press Enter Press Enter again for execution The raster is now prepared for further modifications Drawing new raster elements The line you draw will be rasterized immediately into t
234. s will cause unexpected results E VPraster pro E VPraster Smooth Object VPraster LT Limited raster entities e g line circle arc can be smoothed The selected raster objects are smoothly redrawn gaps are closed and the objects are straightened At the Command prompt enter vprosmooth A See above WE VPraster pro E VPraster Raster Selection a LT The following set of icons appear after activating one of the raster object functions for choosing the best suited raster selection mode Not all of the modes are available with some raster object functions Then some of the icons are grayed out Raster Selection agaaa ggj e Raster structures generated with any of the selection modes are displayed in the current Object Color default green Repeated selection will expand the object continuously if the button is active If the button is active while re selecting any previously selected raster entity or structure this part will be deselected from the total selection Pressing the Ctrl key while selecting will change the selection mode from adding to removing and vice versa 124 Section5 Hybrid Editor for Raster Vector Data V 6 7 E 7 sottelec E VPraster pro E VPraster E VPraster LT The Undo button or the AutoCAD Undo command u is available to undo the last selection step Clicking on the ei button or pressing Enter confirms the selection A 1 The raster selection modes Select Ar
235. scanned for a valid VP Network License if no license was found at the predefined location This operation may take some time If the Sentinel driver for the hardlock is not installed e g only the Demo Version is installed the button Install hardware lock driver is active Click on the button for installation A Administrator rights are necessary to install the hardlock driver Show Toolbars General For displaying the VP HybridCAD toolbars you can use the following functions and also the standard AutoCAD toolbar command Shows the General toolbar for basic raster Input Output commands At the command prompt enter toolbar Raster File Edit Edit Tools Shows the Raster File Edit toolbar for basic raster file manipulation such as despeckling cut window deskew etc At the command prompt enter too bar Shows the Edit toolbar for raster pixel manipulation such as erase copy move raster Also this toolbar offers enhanced raster selection functionality At the command prompt enter too bar Shows the Tools toolbar This is a special VP HybridCAD toolbar indicating the Active Image and containing buttons for Raster Snap Erase Raster etc At the command prompt enter vprshowtb 88 Section4 General Functions V 6 7 E 7 sottelec E VPraster pro E VPraster Erase Draw Raster W VPraster LT Shows the Erase Draw toolbar This toolbar contains some basic draw functions for erasing or drawing into the active ra
236. screen indicates that the computer is not operating or the net path may be wrong The blue screen indicates that the computer is not a VPLicenseManager server A yellow screen indicates that the computer is operating but another error has occurred If the hardlock is not attached to the dongle server the symbol for the hardlock is missing The following dialog box displays an active VPLicenseManager server on the computer SOFTELEC DOMAIN with one hardlock module containing 8 product categories each marked by a key symbol Each category may contain several licenses of that product In this example there are currently two licenses of VPstudio in use An Administrator is logged on to the VPLicenseManager server having access to one VPstudio license a PnetManager File General Servers User o Wl sa alel All Infos E E SOFTELEC_DOMAIN Category Information a softelec gmbh 33 Product Pstudio m ID x007E0B60 3 Version 1 ID x007E0B10 d Connecttime 44 sec i Status Running Z laen E Computer HAWKEYE IID 007E0420 33 User Administrator x mes ID x007E09D0 ID x007E0980 7 m ID x007E0740 E 8 VPstudio EI Administrator IT Check Servers every 10 seconds Update Information Exit The program will be terminated The server list will be saved automatically and will be available when starting the program once again Quitting the program when no servers are listed the subsequent pr
237. se this as a floating license where you can access VP HybridCAD on any networked computer but only one operation at a time You need to attach the hardlock to a network server dongle server running the VPLicenseManager so that the license s is accessible by other workstations The VPLicenseManager requires an additional installation and only is supported in Windows NT Hardlock Driver The workstation or server having the hardlock on its parallel port needs a system driver for proper operation This driver is provided with your package and is installed together with the VPHybridCAD software You may also install it manually by following the instructions found in the file README TXT on the CD Package Contents Your VP HybridCAD package contains the following e 1 User manual e 1 VP HybridCAD CD e 1 Hardlock dongle e 1 Registration form Attaching the Hardlock Dongle Attach the male side the side with the pins of the hardlock to one of your computer s server s parallel ports LPT1 2 or 3 Typically up to five hardlocks can usually be stacked together including a printer to the device s If a printer is connected it should be turned on to provide proper termination otherwise the hardlock may see false signals due to reflections that will cause the program to request a hardlock installation It is physically possible to attach the female side of the hardlock the side AN with the sockets to certain types of ser
238. se this function to read the target coordinates Clicking OK in the dialog Rubber Sheet Settings allows you specify the text file in a subsequent dialog if the this option is enabled Section8 Rubber Sheeting Split Merge 167 7 sottelec E VPraster pro E VPraster E VPraster LT File Settings Begin Coordinates with row fi Reset Separator iTabulatoi JM Space I Semicolon Peeseosoeceseosoeee l Comma Other m After confirmation of the settings with OK a dialog displays the number of the actual input points required Lines in the text file containing coordinate values must begin with a number at the first position Otherwise the line is suppressed Begin Coordinates with row Coordinate files that have been generated by other applications may contain additional text information If it is located at the beginning of the file you can skip it by entering the line number where to start the import of coordinate values You can get the line number from the displayed list Then all preceding data is removed from the list and the row number is set to 1 Default 1 Separator Select the characters that are used in the text file to separate consecutive coordinate value from each other In the displayed list you may check the correct settings X and Y coordinates must be displayed in individual columns 168 Section8 Rubber Sheeting Split Merge V 6 7 E 7 sottelec E VPraster pro E
239. specially when the raster circle does not have an even radius AY A setting of Weak or where the highest degree of centerline precision is required None is useful for geological maps or contour level lines when the Line Chaining parameter is used to generate polylines from raw data A setting of Strong or Medium is especially suitable for originals that are redominantly orthogonal oriented and not too dense mechanical engineering architecture etc Line Chaining on off This setting controls the chaining of individual lines bordering each other into polylines In the case of geographic contour maps for example polylines are produced if Line Chaining is activated The best possible conformity with the Original is achieved when Straightening is set to None but this creates large vector files because of the large number of vertices or Weak e Only Along Outlines limits chaining to areas between intersections e Even Across Intersections chains lines across intersections The direction of the smallest angle change at the intersection is chosen for chaining Create Splines on off is used to create splines instead of polylines 192 Section 10 Raster to Vector Conversion Vectorization V 6 7 E Angle Correction on off 7 sottelec E VPraster pro VPraster VPraster LT Despite the necessity of deskewing the raster file to a reference line using the raster editor parallel lines are usually not precisely paralle
240. speediest operation and does not generate network traffic even if part of a network except for file transfers on the network Server Installation On a computer network you may install the software onto the server hard disk User dependent configuration files are generated locally by a special client setup to allow customization It may take some time to start the software when the server is busy If the server is down or there are other network problems VP HybridCAD will not operate Software License Hardlock V 6 7 E A VP HybridCAD hardlock may contain one or more product licenses Regardless of the installation mode and the number of licenses controlled by the hardlock there are two methods of operation 1 Local Licensing You need to attach the hardlock dongle to one of the parallel ports of the computer where VP HybridCAD is installed Typically this method of operation is used if the hardlock contains a single license only Then for every additional VP HybridCAD installation an additional single license hardlock is required Local Licensing does not require the installation of the VPLicenseManager All Windows operating systems see above are permissible Section 2 Installation 11 7 sottelec E VPraster pro E VPraster E VPraster LT 2 Network Licensing This method of operation is used for hardlocks containing two or more VP HybridCAD licenses but also may be used for a single license If you want to u
241. ster VPraster LT Click on New Attributes again to create additional attribute definitions for this block definition Insert Block m Any available block can be selected and inserted After placing a block it can be modified using the handles to move scale or rotate it After making any corrections confirm the operation by clicking the right mouse button The block is attached to the cursor for an additional placement Clicking the right mouse button a second time aborts the nsert Block operation Insert Block Block Mame Scaling x y Da Da Angle on If attributes have been assigned a dialog box appears for entering the attribute text before placing the block V 6 7 E Section12 Blocks 22 7 7 sottelec E VPraster pro VPraster VPraster LT On the left side all attributes without a fixed value are listed the attributes are set with the default text After entering the information and clicking OK the block and its insertion point are attached to the cursor for placement The block has handles for moving isotropic scaling non isotropic scaling x and y direction rotating In addition every attribute not set with a fixed value has two handles for e positioning and e rotating Click the right mouse button for final placement Due to the multi placement function the block is again attached to the cursor or the dialog box for entering attribute values reappears Cancel or complete the opera
242. ster Background mode if it is still active command line n vprerasebg Draw two diagonal vector lines and a circle Turn on AutoCAD s Ortho mode and activate AutoCAD s Line function Draw a horizontal and a vertical line near the raster center lines in the image It does not matter if you don t place the lines exactly This will be done with the next step Turn off the Ortho mode and select the two vectors Start the AutoCAD Move function and set the Base Point to the intersection of the two vector lines Drag this point on the intersection of the two raster lines and place the vectors there Select the two vectors again and activate AutoCAD s Rotate function Set the Base Point on the intersection of the vectors and enter 45 degrees as rotation angle Select AutoCAD s Circle function Set the circle s center point to the drawing s center and increase the radius until the circle runs through the upper right drilling lebt Selecting and Moving Raster The upper left drilling is to be deskewed to the construction lines Zoom in to the left upper drilling and click the icon Move Raster command line vprmove The toolbar Raster Selection appears inside the workspace Since this drilling consists of an isolated raster element without connections to the rest of the drawing you can use the Pick Element for selection Click anywhere on the drilling element and it turns to the color green Since there are no parts missing in the move click Ent
243. ster image without the requirement of rasterizing At the command prompt enter too bar Trace Shows the Trace toolbar for tracing line following commands At the command prompt enter too bar Color Filter Shows the Color Filter toolbar for manipulation of colored and gray scale images At the command prompt enter too bar E VPraster pro VPraster Vectorize VPraster LT Shows the Vectorize toolbar for the vectorize command At the command prompt enter too bar HE VPraster pro E VPraster Load Raster Image a V 6 7 E When clicking this command a dialog box opens to select a raster file At the command prompt enter vprload All supported raster file types are displayed After selecting a file a preview is shown if the Preview check box is switched on and the file format is supported We strongly recommend to use this function to attach new raster images A to your AutoCAD drawing instead of the AutoCAD image attach command Only the Load Raster File will read and store all necessary information such as the image size the DPI value Dots Per Inch etc in order to support raster processes for example rubber sheeting etc Section4 General Functions 89 7 sottelec E VPraster pro E VPraster Save Raster Image W VPraster LT a Saves a raster image At the command prompt enter vprsave Select Image lt Active Image gt Select the raster image you want to save by clicking on its frame or press Enter to save t
244. t Each VP HybridCAD command always starts with the characters vpr AutoCAD LT 97 98 2000 There are no limitations in functionality for VP HybridCAD running with AutoCAD LT 97 98 2000 Only the command line operation implies some special requirements e A special command must precede the VP HybridCAD command image when using AutoCAD LT 97 98 vprlt when using AutoCAD LT 2000 After this command enter a space and the VP HybridCAD command e g image vprLoad or vprit vprLoad respectively e The Enter key for repeating the last command will not work with most of the VP HybridCAD functions V 6 7 E Section3 Tutorial 25 7 sottelec E VPraster pro E VPraster Lesson One First Steps BR VPraster LT During this lesson you will learn how to e oad save a raster file e edit the whole raster image raster file e edit parts of the raster image e export the image to a raster file raster Loading and Saving the Raster File ARCH CG4 Loading a Raster File 26 Section VP HybridCAD provides a special interface for loading raster files in addition to the AutoCAD native functions For the consecutive raster editing it doesn t matter which interface you use Depending on the raster file format used some raster files can only be read with either VP HybridCAD or with AutoCAD see also Specifications If you are running AutoCAD LT 97 98 2000 you can only load raster files using the VP HybridCAD interface Create a new drawin
245. t Color Raster objects are drawn in the user specified color The color indication icon E may show one of these designs on top of the color They indicate one of the following statuses e Across on the icon indicates the color BYLAYER e A blank icon showing only a color indicates that this color has been selected from the actual color palette After clicking the icon a dialog box appears showing the current color palette either the palette loaded with a color file or the VP default palette which contains 16 basic colors and 240 grayscale values The selected color becomes the current color and is shown on the icon Also the selected color will be highlighted in the color dialog V 6 7 E Section 11 Hybrid Editor in the VP HybridCAD Window 203 7 sottelec E VPraster pro VPraster VPraster LT By default the color BYLAYER is assigned to vector objects They are displayed in the color specified for their layer Once the Object Color is changed this color is assigned to all new drawn vector objects until either another color is specified or a new layer is selected If elements are selected the current color will be assigned Line Types Loun d The current line type is used for drawing In addition to Solid line types you can draw Dashed or Dash dotted line types Line and gap lengths are set in the Object Creation tab Line Types Orthogonal Drawing Pressing the Shift key constrains the drawing direction to n x 45 of t
246. t of your drawing which you can select arbitrarily from the loaded image Click wherever you like the left mouse button to cut out a valid drawing area for testing Please ask your local dealer to get a full version of the program This function is only available in the full version This is a limitation of the demo version of the software Please refer to your local dealer to get a full version of the program This function requires a display driver that supports 256 colors or more The layer preview takes full advantage of the features of the installed graphics board to achieve its tremendous speed This however requires installation of a video display driver supplied by your graphics board manufacturer that supports at least 256 colors Use Windows Setup to install your display board driver 246 Appendix Error Messages Scanner Interface V 6 7 E Unknown compression scheme 7 sottelec E VPraster pro E VPraster E VPraster LT The given file uses an unsupported compression scheme Please use a conversion program that generates one of the following supported formats Extension TIF NIF PCX CAL MIL GP4 CG4 RST RLC RLE GIF BMP C4 CIT IG4 TPE LSR CRL JPG Unknown file format Format Uncompressed compressed Group 3 and 4 LZW Packbits Navy TIFF Packbits CALS Group 4 Type 1 and 2 Run Length Coded LZW Only uncompressed EDMICS VI Group 4 Group 4 Intergraph Color JPEG The file you h
247. t with the next mouse click Once this is done the program zooms back to the extents the cursor has a frame box again to which the free end of the moving vector is attached The end point of the moving vector has to be defined in the same way on the first loaded raster file and then the 2 vector if necessary Fit mode After each vector has been drawn the graphic representation is updated accordingly moved rotated or scaled The right mouse button cancel deletes one set point with each click to allow redefinition into another or more precise position e g with four right button clicks all set points of the two vectors are reset Click once again with the left button for final confirmation and to start the merging process The new file is displayed and should be saved V 6 7 E Section8 Rubber Sheeting Split Merge 177 7 sottelec This page has been left blank intentionally 178 Section8 Rubber Sheeting Split Merge V 6 7 7E 7 sottelec E VPraster pro E VPraster Section 9 This section applies to VPraster LT Operation Interactive Tracing General Information V 6 7 E The trace function allows for interactive raster to vector conversion All trace functions work on the currently Active Image The raster file is loaded and should be cleaned up or corrected before proceeding Depending on the type of original the CAD Trace function can be used to generate CAD elements such as lines circles or arcs
248. ta due to faded and old originals will be automatically joined together with lines circles and arcs up to a reasonable distance A high value setting may result in false line or arc joins A If the value is set too high neighboring vectors can be connected Default on Default value 0 1 mm V 6 7 E Section9 Interactive Tracing 183 7 sottelec E VPraster pro E VPraster CAD Trace VPraster LT To activate this function click this button or choose the command Contour Trace from the VP HybridCAD Tracing pull down menu bar Using this option line circle and arc CAD elements are recognized and assigned to the current layer At the command prompt enter vprcadtrace After clicking on the CAD Trace icon the Needle and Thread cursor appears which is used for picking on raster data for conversion Pressing the Shift key which adds a sign to the cursor while clicking causes the last traced CAD element to be continued preserving the element type line arc circle of the element initially traced Arcs covering an angle of close to 360 are an exception these are converted to circles Contour Trace e To activate this function click this button or choose the command Contour Trace en from the VP HybridCAD Tracing pull down menu bar This function converts raster elements to polylines or splines in the currently active layer Use the 4 Way cursor to click on the line you wish to convert The trace module run
249. ter Properties Enter VPraster LT The properties of the selected element are displayed This function can also be activated by double clicking on an element Start Point bk y 71 06 184 92 End Point x y 127 10 152 60 Layer L1 e Line Type SOLID sl Color BYLAYER ing Cancel If several elements have been selected the following overview dialog box appears after entering this command or after double clicking following the last selection All selected elements are listed Selection List Number of Selections Close Showy UrnSelect Delete After using the mouse to select an element from the list clicking Show will display detailed information about the selected element This information can be modified using the usual procedures for selection and entry Click on UnSelect to remove an element from the selection list i e undoing its Original selection Click on Delete to delete a selected element from the list and the vector data If no element is selected the first element in the list is deleted V 6 7 E Section 11 Hybrid Editor in the VP HybridCAD Window 211 7 sottelec E VPraster pro VPraster VPraster LT Click on Close to close the dialog box and display the remaining elements from the selection list in the drawing with any changes you may have made Correct Hatch For false Hatch elements the Properties function allows you to remove elements from the grouping When the
250. the Red Text class and zoom to the red number 200 Click on position 285 210 Pick Probe Mode 212 396 285 210 Testing the classification 70 Section All previously defined classes have been assigned probes Now we are going to test the probes whether they contain enough information for a working classification Before testing the classification the probes have to be processed click on Process Probes The dialog Classification disappears and a progress bar shows up Depending on the processing speed of your computer this will take some time When the processing is completed click on Test Classification Choose the center area of the raster image as test area with a window frame The classification for this area will take some time Tutorial V 6 7 E V 6 7 E 7 sottelec E VPraster pro E VPraster VPraster LT Compare the results with the original image by switching the test area off and on click the checkbox Show in the Test Areas field The quality of the probes is displayed in the fields Active Class and Probes of Active Class Probes with a low percentage should be revised and replaced by more suitable one In the test area you will see some errors e the black street names are in blue e the black text in the water region is almost erased e the red text COIT TOWER is in black e there are white spots in the building region Obviously there were too few color tones included in the probes especiall
251. the center of line structures or Outline Vectorization for tracing the outline of filled areas or other two dimensional structures The Centerline Outline mode is a combination of both vectorization methods The specified Threshold is used to toggle between the two methods according to the width of the raster structures Default Centerline Outline Threshold 15 Straightening Artifacts 182 Section 9 By setting the tolerance to Straightening Strong you can reduce the number of vertices This is particularly useful if you want to reduce the amount of data or the processing time required for long splines Default Weak When Remove Artifacts is activated short line segments or line spurs artifacts which would lead to unwanted trace results are removed while tracing Default on A This function can take some time to run on large files Interactive Tracing V 6 7 E 7 sottelec E VPraster pro E VPraster Line Chaining on off VPraster LT If Line Chaining is on polylines or splines check on Create Splines are generated instead of single lines Default Line Chaining on Default Create Splines off With Only Along Outlines switched on polylines splines are generated only between intersection With Even Across Intersection the polylines splines continue at intersections into the direction of the least change of angle Default Only Along Outlines Gap Jump on off Small interruptions in the raster da
252. the mouse to the right All vector elements fully enclosed by the box are selected When only one vector element is selected it is displayed bearing handles e Crossing This is similar to Window except you move the mouse to the left A box opens with a dashed outline All vector elements touched or enclosed by this box are selected The appearance of elements changes to indicate that they have been selected Their colors may change or can appear in a brighter hue or be highlighted as another line type Combined Mouse Keyboard Operation V 6 7 E Pressing Shift while moving the mouse limits its angle of movement as follows e With 2 point lines including positioning help lines such as text direction etc only horizontal vertical or n x 45 directions are permitted e With polylines the drawing direction of the second and all further segments is limited to only follow a multiple rectangle n x 90 with reference to the first segment This allows the drawing of rectangle polygons having a base 1st segment at any angle Holding down Ctrl while placing a left mouse click on a selected polyline or spline will add clicking on the desired position of the line or remove clicking the vertex a vertex The moving handle s position of a selected single element can be changed by pressing Ctrl and Shift followed by a left mouse click on the desired position of the base point To deselect individual elements pick th
253. tion by clicking the right mouse button Modifying Block Definitions Using Options Block Definitions existing blocks can be modified attributes can be added or deleted and block definitions can be replaced 228 Section12 Blocks V 6 7 E 7 sottelec E VPraster pro m VPraster Section 13 This section applies to VPraster LT Operation Symbol Search Replacement General Information Symbols searches for vector structures identical or very similar to a preset prototype symbol The vector structures found are replaced either by an existing block of the same name in the drawing or by a block assigned to the prototype when it was created The blocks can be generated by the program see Section 10 The blocks should approximate the search symbol in size and appearance connections Prototypes of the symbol to be found serve as the basis for a symbol search in an original document The prototypes are created from 1 to 3 symbol structures in an original by marking them with a window Using the selected symbols VP HybridCAD generates a prototype with tolerance values and displays it graphically If you choose the symbol structures correctly you can precisely isolate the search symbols while allowing as much tolerance as necessary to ensure the recognition of as many symbols as possible Prototypes are saved as PSB files preferably in the SUPPORT subdirectory so they are available for other originals as well Symbols with a high
254. tomatically Choose the VP HybridCAD function General Multi Point to perform multi point rubber sheeting on the Active Image At the Command prompt enter vprrubber Rubber Sheeting Functions V 6 7 E You can choose from six transformation functions supporting different rubber sheeting requirements With each function a minimum number of coordinate values reference points is indicated for successful completion Min no of Original state ref points Arbitrary parallelogram Orthogonal local distortion increased local distortion Section 8 Rubber Sheeting Split Merge 163 7 sottelec E VPraster pro E VPraster E VPraster LT Reference points should be evenly spread out on the map If this is not the case local distortions can have an effect on the entire raster file Higher functions quadratic and cubic should be performed with about twice the minimum number of points When using a grid a minimum of 16 points quadratic or 25 points cubic should be entered Also there should be an even number in each of the x and y directions The Exact function can be used to correct any nonlinear distortion in a map or drawing It is especially useful if you need to correct particular points to exact positions However high deviations of the displacement direction within an area may lead to bent or cornered lines A warning message will appear in cases where the mathematical equation cannot be solved properly Enteri
255. tware 82 section Tutorial V 6 7 E 7 sottelec E VPraster pro E VPraster Section 4 This section applies to MVPraster LT Operation General Functions Basics The program design is in full compliance with conventions AutoCAD R14 2000 or AutoCAD LT 97 98 2000 Basic knowledge in the use AutoCAD is assumed Please refer to your AutoCAD manual for details concerning AutoCAD functionality Specials with AutoCAD 2000 and AutoCAD LT 2000 AutoCAD LT 2000 can open more than one drawing at a time with MDI Multi Document Interface This feature is not available when operating AutoCAD LT 2000 with VP HybridCAD This means AutoCAD LT 2000 VP HybridCAD can only use the SDI Single Document Interface feature Specials with AutoCAD LT 97 98 2000 There are no limitations in functionality for AutoCAD LT 97 98 2000 Only the command line operation implies some special requirements e A special command must precede the VP HybridCAD command image when using AutoCAD LT 97 98 vprlt when using AutoCAD LT 2000 After this command enter a space and the VP HybridCAD command e g image vprLoad or vprit vprLoad respectively e The Enter key for repeating the last command will not work with most of the VP HybridCAD functions Working with Multiple Raster Images i VP HybridCAD indicates one of the attached raster images of the current drawing as the Active Image All raster editing tools globally affect the whole image e g
256. ual will familiarize you with all the functions of VP HybridCAD software It is meant to be both a source of reference and a guideline to the latest raster vector processing technology The most expedient way to learn your selection of VP HybridCAD software is to first take the opportunity to view the VP TOUR multimedia from the CD though this tour is more specific for VP Win stand alone products but the command functions are identical Afterwards install the VP HybridCAD software selection you ve purchased and start with the Tutorial Section 3 and follow the applicable lesson series Once completed you will have command of VP HybridCAD that can only increase your CAD productivity Have fun with VP HybridCAD As a reminder please visit our web at http www softelec com for the latest information and updates Introduction V 6 7 E 7 sottelec E VPraster pro Section 2 This section applies to SE Installation Introduction The VP HybridCAD products VPraster pro VPraster and VPraster LT are AutoCAD Applications ARX and require AutoCAD R14 2000 or AutoCAD LT 97 98 2000 Depending on the configuration of your computer network you may install the software using different methods Local Installation This is the recommended setup where all program files are installed on the users computer If the computer is not on a network VP HybridCAD software can only be installed as a local system Also the local installation provides the
257. uld switch this option off if you only want to change the image s palette When saving a color reduced palette you can conserve the original image and read it back with Raster Co or Load Palette The Color Separation function is available from 16 colors or less It generates an individual B W raster file for each remaining color This file will be saved with a base name user defined and an appended two digit automatic counter If the palette has been reduced to only two colors the original can be converted directly into a B W raster image with Convert to B W providing further editing OK closes the dialog box and all modifications on the color palette will become permanent Hence there is an option to Export colors before closing the dialog box with Cancel This way colors can be separated into multiple B W raster files without any modifications in the original 148 Section7 Color Reduction Color Separation Color Classification Filters V 6 7 7E 7 sottelec E VPraster pro E VPraster Color Classification VPraster LT General The classification of colors is an alternative method to reduce the number of colors i e the amount of data in an image especially of color patterns The process as featured in VP HybridCAD software and described in this chapter is a combination of user interaction and automatic routines The principal concept of color classification is based on combining color patterns scattered over an image into a
258. unishable by applicable copyright law softelec is a licensee of Szki Recognita AG and is entitled to use the OCR software Recognita Plus exclusively in all VP products The use of this software constitutes agreement to the terms said herein If you do not agree with the terms of this agreement DO NOT OPEN AND INSTALL THE SOFTWARE promptly return the software including manuals binders hardware lock key written material and containers to the location from which you obtained them for refund Terms This license agreement becomes effective on the day of purchase and remains in full force until termination softelec may terminate the license in the case the purchaser fails to comply with any of the terms and conditions of this agreement The purchaser may terminate the license agreement at any time by returning the complete software recorded on diskettes and or CD s including manuals binders hardware lock key written material and containers Disclaimer softelec reserves the right to modify the hardware lock key the manual and or the associated software at any time particularly with the intent of further development and undertakes no guarantee to issue notification of modifications additions or further developments nor does the company obligate itself to implement such modifications additions or further developments in earlier versions of the manual or the software Any such modifications are considered upgrades in which the registered
259. utoCAD LT 97 98 2000 cccccssccccsseeeceeeeeececaseeeeeseseeaseesecaseeeausessenaseeseeaseess 83 Working with Multiple Raster Images cccccccseeeseeeeeeeeeeeeesaneeaeeeeesaeesanseeseeeeseeseeesaneneneaes 83 VP AVDA Te 88 TE 84 PO E 0A 5 eege 86 EE 88 POG Fa a ET AE E E E AAE E A E E A A T 89 Sav haster EE 90 Save RasterDWG eer 92 Create New RasStef eegene Eegenen 92 EE eebe 92 Show Raster Image Info EE 93 Rasterize e 93 haster e to faper EE 95 aeia EE 96 Spi Faster IMa E ebe 96 Me rg Raster MAJE w cccccccccscccsccccseccueceaseceuecseecaeeeeseesseesaeesaeeeseeesaeesaaeeeaeesaeesaaessaessaessaneeganegags 96 Cul lo Faper Fornal E 96 KUDDE d rraian onnsa EE AE EE EE D 97 Von O E Eege 97 EE 97 e 97 EE EE 97 L OIEI EENEI AA E ties A A A an taeesucmeetyeeaesaneese 97 OOO EE EE Ee Dese 97 Raster Snap F11 OMG issssnsassinssnondtinarenatesintaaareioiediandaSensndwasensisiwondauionwsdetndduawenwnanieandiwaiaenieaniess 97 Delete Raster Background on off under vectorsel 98 Auto Regenerate Feet ugegeteeatergegdente t uaneegteeegeCeateg euer Neger eb Celeekegette ett Neger 98 Show Raster Te rn OFM NW 98 Dynamic Wd e e Del E 98 EE 98 DOLE CE ACH VG E 98 FROG CNIGT AUC O EAEE ENA A ENE geed 99 Raster to Vector COnVersion cccccccccecsececeuccuscueeususaueueeuseusaueaueueeusausaueueeusausaueaeeueeusausauseeeusanss 99 Te EE 99 Main MEn cssiathntinedimmasnastvtnade afaasiaausisinatin dimmstnndiag eduinnbito
260. ver when using the functions Create Raster Object Copy Raster Move Raster or Smooth Object the generated object is traced completely Select First Point Specify line s start point Select Second Point Specify line s end point At the Command prompt enter E VPraster pro E VPraster Select Polygon W VPraster LT All raster pixels inside a closed polygon are selected Close the polygon with Enter With color raster images the Pick Element command is disabled until this raster operation is concluded From Point Enter value or specify first point of polygon To Point Enter value specify point or Enter to close and finish At the Command prompt enter p Select Rectangle All raster pixels inside a dragged window are selected With color raster images the Pick Element command is disabled until the raster operation is concluded First Corner Enter value or specify first point Other Corner Enter value or specify rectangle At the Command prompt enter r 126 Section 5 Hybrid Editor for Raster Vector Data V 6 7 7E 7 sottelec E VPraster pro E VPraster Select Inside Window VPraster LT Ed Raster elements representing continuous lines arcs circles etc are selected if they are located entirely inside the selection frame Elements which extend beyond the frame will be ignored Crossing raster structures are ignored However when using the functions Create Raster Object Copy Raster or Mov
261. w Line Draws a raster line with the specified line weight ky At the Command prompt enter vprdi ine Draw Polyline iF Draws a raster polyline with the specified line weight At the Command prompt enter vprdpline Draw Arc Draws a raster arc with the specified line weight At the Command prompt enter vprdarc V 6 7 7E Section5 Hybrid Editor for Raster Vector Data 131 7 sottelec E VPraster pro E VPraster Draw Circle VPraster LT EI Draw a raster circle with the specified line weight At the Command prompt enter vprdcircle Draw Rectangle Ei Draws a raster rectangle with the specified line weight At the Command prompt enter vprdrectang 132 Section5 Hybrid Editor for Raster Vector Data V 6 7 7E 7 sottelec E VPraster pro E VPraster Erase Raster Functions GES The raster structure underlying the drawn entity is erased while intersecting or connecting structures will be kept A These functions are only available for B W images Erase Line Erases a raster line K At the Command prompt enter vpreline Erase Polyline Erases a raster polyline V SSES At the Command prompt enter vprep ine Erase Arc cg Erases a raster arc At the Command prompt enter vprearc Erase Circle Erases a raster circle e At the Command prompt enter vprecircle Erase Rectangle Erases a raster rectangle At the Command prompt enter vprerectang V 6 7 7E Section5 Hybrid Editor for Rast
262. w to use the VP HybridCAD software products including the VP HybridCAD Demos We strongly recommend that you complete all of the tutorial exercises otherwise you will not be able to appreciate VP HybridCAD s editing and conversion capabilities You will be guided step by step through all major command operations as well as setting up the program s parameters for optimum conversions Please note that this tutorial will not detail every command or parameter settings Detailed information on commands settings and processing procedures can be found in the following sections Latest information on updates and product news are also available on the softelec web site at http www softelec com Getting Started After installing the VP HybridCAD software you will find the VP icon within the VP program group AN For full versions of VP HybridCAD software products only Any VP HybridCAD full version needs a valid license for execution For a local operation attach the hardlock dongle to the parallel port male side of your computer If a printer or other devices are connected to this port the hardware lock should first be attached to the printer port followed by the printer cable For network operation the VPLicenseManager must be installed on the computer in the network where the hardlock dongle has been attached for installation details see Section 2 If a valid license cannot be found during startup the following message will appe
263. wing Units User Units mm Millimeters mm d 79 62 1990 43 dx 67 25 1681 26 dy 42 62 1065 45 B 324 degrees Resolution 300 DPI You can also use this function to measure parameter values that depend on drawing data You click the parameter field and select the Distance or Angle function by pressing F2 The result is transferred directly to the parameter field and displayed there Section 4 General Functions 105 7 sottelec E VPraster pro VPraster Options VPraster LT General system settings definitions and parameters are determined and saved here Additionally the parameter panels controlling vector post processing can be loaded here Settings Toolbars Object Creation Purge Table Entries Block Definitions OCR Options Drawing Aids CAD Options Parameter Post Processing Abort Process Esc Settings A dialog box opens where you can select and enter different system settings Program Settings EN General Colors Shortcuts m Drawing Unts Deck Box Size x Lie i Inches Pixel Niege egier Pixels m Default Text Font T Autopan DS sl J Pan Size 20 x m Scanner Resolution 300 DPI Delay 05 sec 8 Auto Panning General Tab Drawing Units You can choose mm inches or pixels The drawing units you select determine how the raster image will be interpreted in terms of units of measure The units hav
264. wing and the more recognition options are selected the larger the amount of RAM required Otherwise disk swapping will become necessary and will noticeably slow down program operations Installation V 6 7 E 7 sottelec E VPraster pro E VPraster Installing the VPLicenseManager M VPraster LT The VPLicenseManager needs to be installed only if you have a computer network and the hardlock is attached to a remote computer dongle server This software controls and manages the VP HybridCAD licenses in the network Requirements The VPLicenseManager may be installed as a service only on a Windows NT 4 0 2000 computer server or workstation It will not operate under Windows 95 98 The software clients may run under Windows 95 98 or Windows NT 4 0 or higher It is necessary that the clients have access to the dongle server an account must exist for each user We strongly recommend to install the VPLicenseManager on the Domain Controller Server Installation For the following steps you must to be logged on to the dongle server as Administrator Follow these steps for installation 1 Attach the Hardlock Module to the server s parallel port 2 Install the Sentinel Driver from the VP HybridCAD CD CDROM DRIVERS SENTINEL WIN_NT SETUPX86 EXE 3 From the VPLicenseManager directory on the VP HybridCAD CD run the following program VPLMSetup exe 4 Reboot the server After rebooting the VPLicenseManager service is act
265. wing functions are available Line Enhancement Increases the line thickness Dynamic Enhance Increases the contrast Adaptive Threshold Area dependent thresholding Threshold Standard threshold 0 thru 255 Adaptive Level Contrast threshold 0 thru 100 Background Suppression of speckles 0 thru 100 Suppression Color and Grayscale Options Brightness Range 128 thru 128 Contrast Range 10 thru 1000 in Blur Filter to reduce dithering in color scans 0 thru 3 If no palette has been selected for a color scan the following dialog box appears after pressing Scan or Forw Scan Colors Linear Color Map le z Cancel 254 Appendix Error Messages Scanner Interface V 6 7 E 7 sottelec E VPraster pro E VPraster VPraster LT Computed Color Map The system performs a prescan to calculate an optimized palette for the current drawing The palette size can be selected between 4 and 256 colors Linear Color Map A standard palette will be used for the scan The palette represents the whole color space 8 16 27 125 or 216 colors max can be selected Description of Terms Different manufacturers use different terms for the same functions of their scanners The following table shows the terms used by VP HybridCAD software and their equivalents Adaptive Threshold Adaptive Area Threshold 2D Adaptive Threshold Adaptive Level Area Brightness Background Suppression Variability Line Enhancement Edge Enhancement Dynamic E
266. with the given floor space we found that the floor plan has to be scaled as follows Metric 3 9 English 100 Start the scaling by clicking the Scale icon of AutoCAD s Modify toolbar In the command line you are asked to select objects click with the cursor on the frame of the raster image if selected it will appear with a hatch Press Enter to end the selection mode Now you are asked for the base point enter 0 0 in the command line The last parameter you are asked for is the scale factor enter 3 9 or 100 depending on your system setup After the image has been scaled you can check the results by repeated measuring The kitchen s width should be 340 its length 400 units To save the current status use the AutoCAD s Save function This command keeps the current file format so that the RDWG file ARCH_1 DWG will be updated Deleting Moving and Copying Raster The bathroom installation in the upper right part of the floor plan is going to be rearranged the toilet and the wash basin will be removed and vectors from a library element will be inserted Deleting Raster Elements V 6 7 E Zoom in to the bathroom and click the function Erase Raster command line vprerase The toolbar Raster Selection appears in the workspace for choosing the appropriate selection method Select the mode Select Rectangle and drag a window around the toilet The selected raster structure appears green If you have accidentally erased m
267. y Class Enter in the Class dialog box Water as class name and choose the color Blue Close the dialog box and define all classes the same way according to this table V 6 7 E Section 3 Tutorial 67 7 sottelec E VPraster pro E VPraster VPraster LT Class Name Color 4 Buildings i Yellow 6 Parks Green 7 JEITZ Foreign Trade Zone Red Classifying colors The next and main step is to define probes for each class A probe consists of pixels selected from the raster that later ought to be part of this class By defining probes the class gets information about what color tones it should contain It is not necessary to select all color tones of a class selecting color tones means selecting pixels with the desired color tone this will be done later automatically However it is important to select color tones that cover the range of the class color For instance the water region has color tones ranging from bright blue to dark blue In this case the bright and the dark blue tone must be selected with one or more probes in addition to some but not all color tones in between Picking area probes 68 Section 3 Start with the class Water Select Water as the Active Class and switch the Pick Probe mode to Area The cursor appears as a bucket indicating that you can pick rather large areas Zoom to the second water region on the top of the raster image and click in the lower half of this region below the red line T
268. y for the black text To get better classification probes additional colors have to be picked For the black text we only looked at black text on yellow background For improvement we also have to consider black text on green on white and on blue background Take the probes from the areas that were assigned to the wrong class Pick Probe Mode Text 716 463 E 378 331 a 107 385 For the classes Red Text and Buildings click probes at the following coordinates Pick Probe Mode 77 304 Buildings 261 383 Clear the test area and test the new probes Don t forget to process the probes first Now the results look much better than before however it can still be improved The black text on the yellow background is to thick Some color tones belonging to the buildings class were assigned to the text class Section 3 Tutorial 71 7 sottelec E VPraster pro E VPraster VPraster LT They have to be picked with a probe of the buildings class Pick Probe Mode Buildings 266 409 Once again test the classification Process Probes and Test Classification Now the text reads better Saving probes and classification Click on Save Probes and save your classes with the assigned probes to CITY_1 VPS If you have similar raster images you can create a VPS file containing classes and belonging probes that are likely to apply to these images as well Then for each raster image load your VPS file and just add the classes and p

Download Pdf Manuals

Related Search

Related Contents

Document complet  Manual del usario v1.3 A X I S 5 6 0 0    EntelliGuard G Trip Unit Type GT-H  Samsung SPF-85V Priručnik za korisnike  Cisco ASA5555-K9 firewall (hardware)  StarTech.com 6in TX3 Fan Power Extension Cable    Carson OD-75 magnifier  取扱説明書(PDF：1.55MB)  

Copyright © All rights reserved. Failed to retrieve file