Home

VBSS100SL User Guide

1. 18 BH Am 19 UPGRADING THE VBSSTIRMIWARE EE SEIN TET REEF EOD OPE RUDI TU PT QU ODE PE EPOD OPER RED POL US SUPR EE 20 CAN OUTPUT IE TIBAIRENXFISQIEIEERESQIUINEAESIUTIES ERE EPASGHISARRRIINOASAS ERAN ERISERNRROIS ERA RRATAS A RIRN AR SREPERERI RAE NENII DISEASE ROREM AGER ATRRERIR AERE ARTRAS EAE 20 R5232 A uz Weluli r A 22 TECHNICAL SPECIFICATIONS 23 CONNECTION DATA 25 CONTACT INFORMATION FER E FERE D 25 Unit 10 Swan Business Park Osier Way Buckingham Bucks MK18 ITB England Tel 44 0 1280 823 803 Fax 44 0 1280 823 595 Email vbox racelogic co uk www velocitybox co uk VBSS100SL User Guide 100 Hz Speed Sensor EC Declaration of Conformity We declare that this product has been tested to and meet the requirements of EC Directive 2004 104 EC Ada
2. 11 LEVELANTENNAS M MM PME Ee MEM ME E ERU E EM EM 11 SLIP ANGLE TRANSLATION MN u 12 ANTENNA OFFSETS bee s II IS D SIM ALI C MM IEEE 12 CONFIGURING THE SPEED SENSOR ETERNA 14 HARDWARETONNMECTIDN C 14 SOFTWARE CONNECTION a 14 SETUP OPTIONS ciipiuiteiseiI ei HIPH xUNEdEDId E e OSEE SLEEPS SOENE EEES EEE SEEDEDE EESE SESSE 14 CIANTA 14 CAN m 15 16 e 17 piomm 17 ANALOGUE LL M 17 DIGITAL ee T 18 IM 3
3. ox lt R wOo VBSS100SL User Guide 100 Hz Speed Sensor VBSS100SL 100Hz GPS Speed Sensor User Guide i RACELOGIC Unit 10 Swan Business Park Osier Way Buckingham Bucks MK18 1TB England Tel 44 0 1280 823 803 Fax 44 0 1280 823 595 Email vbox racelogic co uk VBOX www velocitybox co uk VBSS100SL User Guide 100 Hz Speed Sensor Contents DECLARATION OF CONFORMITY asesesssssossssssesssssossssososssscsesssosossesososssscesesesososssscoesssosossesssosssosoesssosossssssesssosossssosossssssesssssossesssosssssossesssose 3 ARDWARE OVERVIEW 3 INTRODUCTION eC M 4 M EMEN RRC Te 4 i IRR TOR 4 SIANBARDINVENTORY PENES RISO IEEE vena ansnnesa saan 4 QUICK START GUIDE eere 1qqi E4909 TRAE ATEEEPISATKERTAR TI 09 US AR AR ARES 5 FOR SLIP AND PITCH MEASUREMENTS sep
4. 1 9803743 Degrees West This is a true 32bit signed integer West being positive 21 Distance 0 000078125 meters per bit unsigned Trigger distance corrected to nearest 10km h speed 22 Distance 0 000078125 meters per bit unsigned From start speed to end speed Decel test 23 Speed at start of Decel test 0 01 knots per bit 24 Speed at end of Decel test 0 01 knots per bit 25 Time of Decel test 0 01 Seconds per bit 26 Lap time 0 01 Seconds per bit 27 Split time 0 01 seconds per bit 28 Status Bit Start finish crossing Bit 1 Split line crossing includes start finish crossing 29 True Heading of vehicle 16 bit unsigned integer 100 30 Slip Angle 16 bit signed integer 100 31 Pitch Angle 16 bit signed integer 100 32 Lateral Velocity 16 bit signed integer 100 33 YAW rate 16 bit signed integer 100 34 Roll Angle 16 bit signed integer 100 35 Longitudinal Velocity 16 bit signed integer 100 36 Centre Of Gravity Slip angle 16 bit signed integer 100 37 Front Left 16 bit signed integer 100 38 Front Right 16 bit signed integer 100 39 Rear Left 16 bit signed integer 100 40 Rear Right 16 bit signed integer 100 Unit 10 Swan Business Park Osier Way Buckingham Bucks MK18 England Tel 44 0 1280 823 803 Fax 44 0 1280 823 595 Email vbox racelogic co uk www velocitybox co uk VBSS100SL User Guide 100 Hz Speed Sensor RS232 N
5. _ e Blank Course over cogm ground Mot output empty magnetic cE sog foo imo Speed overground _ was per hour fel 99 eem LL map S RACELOGIC X Unit 10 Swan Business Park Osier Way Buckingham Bucks MK18 1 England Tel 44 0 1280 823 803 Fax 44 0 1280 823 595 Email vbox racelogic co uk 4 10 www velocitybox co uk VBSS100SL User Guide 100 Hz Speed Sensor Technical Specifications Velocity Distance Accuracy 0 1 Km h averaged 1 0 05 lt 50 over 4 samples pm lue LL Absolute Positioning Accuracy with SBAS DGPS with SBAS DGPS gt 1 8m 9596 CEP Accuracy 001s 015 BaseStation 40cm 9596 CEP RTCM DGPS MR o Heading Acceleration nn iterate 7 Brake Stop Accuracy Trigger Activated Slip Angle Accuracies Pitch Roll Angle accuracies lt 0 2 rms at 0 5m antenna separation lt 0 14 rms at 0 5m antenna separation lt 0 1 rms at 1 0m antenna separation lt 0 07 rms at 1 0m antenna separation lt 0 05 rms at 2m antenna separation lt 0 035 rms at 2m antenna separation lt 0 04 rms at 2 5m antenna separation lt 0 028 rms at 2 5m antenna separation Definition
6. GPS signal reception make sure that the antenna is fitted to the highest point of the vehicle away from any obstructions that may block satellite reception The GPS antenna works best with a metal ground plane underneath a metallic vehicle roof is perfect for this Please also note that when using any GPS equipment a clear sky view is important Objects in the surrounding area such as tall buildings or trees can block the GPS signal causing a reduction in the number of satellites being tracked or introducing reflected signals that can decrease the accuracy of the system Note that clouds and other atmospheric conditions do not affect a RLVBSS100SL s performance GPS antennas require a ground plane to operate correctly This helps to reduce unwanted reflections of the GPS signal caused by nearby objects and usually the metal roof of a vehicle performs this function However if a test requires an antenna to be placed either off the vehicle or on a vehicle that does not have a metallic roof a special ground plane antenna must used This has an internal ground plane and can operate perfectly without the need for mounting on a metal surface Ground plane antennas are available from your VBOX distributor NOTE VBSS100SL can struggle with maintaining dual lock if the antennas are placed too close to Roof Bars If a poor mounting position cannot be avoided then the use of elevated GPS GLONASS MEM RE ground plane antennas RLVBACSO68
7. Input Starts the brake stop distance measurement where the VBSS Lap pulse will calculate a Time and Distance for a Brake Trigger to OKm h test RACELOGIC Unit 10 Swan Business Park Osier Way Buckingham Bucks ITB England Tel 44 0 1280 823 803 Fax 44 0 1280 823 595 Email vbox racelogic co uk VBOX www velocitybox co uk VBSS100SL User Guide 100 Hz Speed Sensor Tests Tests 1 Deceleration Pr art speed ete er earl End speed Corrected distance start speed Lap Timing Splits 3 Gate width 25 0 2 Time before retrigger 10 0 s 5 2000 Start Finish Start Finish 52 4 309600 N 1 0 592393 9 Splits o Empty E Split to split time 1 Deceleration Here start and end speed of non trigger deceleration tests can be configured Auto Corrected Distance Start Speed This sets the speed sensor to use the nearest rounded 10km h speed when the trigger is activated For example if the trigger speed was 104km h then 100km h would be the nominated start speed for the corrected brake stop distance Corrected Distance Start Speed If the auto option is not selected the user is able to specify a speed value to correct all deceleration tests to 2 LapTiming Gate Width This sets the width of any gates set in the software This is a useful feature when two parts of a track run very close to each other or the pit lane is next to the start finish lin
8. inaccurate The measured distance between the antennas should be the straight line distance between the antennas regardless of the mounting angle It is not the 2D distance between the antennas as viewed from above The supplied tape measure will help ensure an accurate antenna separation Antenna A is the primary antenna from which all calculations are based Therefore the primary antenna should be placed relative to where you wish to make your measurements from For example If you wish to make measurements from the centre of the vehicle this can be achieved by placing the primary antenna at the centre of the vehicle or translating the position using the slip angle translation function in the Vbox Manager Unit 10 Swan Business Park Osier Way Buckingham Bucks MK18 England Tel 44 0 1280 823 803 Fax 44 0 1280 823 595 Email vbox racelogic co uk www velocitybox co uk VBSS100SL User Guide 100 Hz Speed Sensor Operation Interfacing with the VBSS Because the VBSS can be used in a number of ways it is common for the end user to integrate the VBSS connector into their own wiring harness A mating connector Deutsch ASDD606 09PN may be purchased from Racelogic for this purpose Please see the section of this manual Building an interface cable for the VBSS Before connecting power to the VBSS you should connect the GPS antenna this is because the VBSS will look for a connected GPS antenna and automatically adjust
9. its gain for optimum performance from the connected antenna For more information about the GPS antenna and antenna placement see the section GPS Antenna Power The VBSS can be powered from a wide range of voltage sources including a Vehicle Cigar adapter a Racelogic Li ion battery pack or other source provided by the user The supplied power cable is un terminated The maximum operating voltage input must not exceed 30V DC Failure to observe this could result in damage to the VBSS NB That during extended use the VBSS case may become hot This is normal however it is good practice to mount the VBSS in a position where it has sufficient airflow around the case LED indicators There are 3 LED indicators on the top of the VBSS to show the status of operation PWR Indicates that the VBSS is powered correctly GREEN LED OK RED LED power on but box not working correctly SAT Indicates the number of GPS satellites that the VBSS has locked onto When the VBSS has no satellite lock the SAT LED flashes slowly to indicate that the VBSS is searching for satellites When one or more satellites are locked onto the LED will pulse the satellite count repeatedly with a short delay Short RED LED NO Sats GREEN RED LED GLONASS sat count if available The following diagram shows an example of SAT LED pulse sequence Sequence showing 1 Satellite Sequence showing 4 Satellites _ jJ LI LJ LJ tL d LI LI Lo Delay 1 2 3 4 De
10. you perform the AUTO LEVEL on a flat level section of road Note You must have dual antenna lock to be able to perform this calibration Selecting the Clear option will remove any offset applied to the pitch channel RACELOGIC Unit 10 Swan Business Park Osier Way Buckingham Bucks MK18 ITB England Tel 44 0 1280 823 803 Fax 44 0 1280 823 595 Email vbox racelogic co uk VBOX www velocitybox co uk VBSS100SL User Guide 100 Hz Speed Sensor Slip Angle Translation In twin antenna mode you may wish to take slip measurements from other locations on the vehicle for instance the centre of gravity or slip over the wheels This can be set using the SLIP TRANSLATION function in the VBOX Manager The five additional locations are set using longitudinal and lateral offsets from the primary antenna location antenna 1 in the picture below Longitudinal translation offsets should be defined as positive when forward of the primary antenna negative when behind the antenna Latitudinal translation offsets should be defined as negative when to the left of the antenna positive when to the right Gyro assistance VBSS100SL has an integrated gyroscope which requires the unit to be mounted flat The Gyro Yaw Rate will be used in the calculated slip channels as the signal to noise ratio is much lower than the GPS derived yaw rate Therefore no extra noise is added during the slip translation process yasyjo e 434e A X Longitud
11. 0 seconds since midnight or 14 hours 57 minutes and 16 90 seconds 3 Position Latitude mmmm mmmmm 100 000 311924579 51 Degrees 59 24579 Minutes North This is a true 32bit signed integer North being positive 4 Position Longitude nmmmm mmmmm 100 000 11882246 0 Degrees 58 82246 Minutes West This is a true 32bit signed integer West being positive 5 Velocity 0 01 knots per bit 6 Heading 0 01 per bit 7 Altitude 0 01 meters per bit signed 8 Vertical Velocity 0 01 m s per bit signed 9 Status 8 bit unsigned char Bit 2 always set 10 Status2 8 bit unsigned char Bit is always set Bit 1 Lapmarker Bit 3 brake test started Bit 4 Brake trigger active Bit 5 DGPS active 11 Distance 0 000078125 meters per bit unsigned Corrected to trigger point 12 Longitudinal Acceleration 0 01G per bit signed 13 Lateral Acceleration 0 01G per bit signed 14 Distance since reset powercycle 0 000078125 meters bit unsigned 15 Time from last brake trigger event 0 01 Seconds per bit 16 Velocity at brake trigger instant 0 01 knots per bit window smoothed over previous 4 samples 17 Lean Angle 16 bit signed integer 100 18 Radius of Turn 32 bit signed 100 19 Position Latitude DD DDDDDDD 10 000 000 519874298 51 9874298 Degrees North This is a true 32bit signed integer North being positive 20 Position Longitude DD DDDDDDD 10 000 000 11882246
12. Gga Gsa GII Gsv 2 Vtg Gst Zda 1 Mode This selects whether the Speed Sensor outputs data in the Racelogic format or the NMEA message format 2 NMEA Messages If the NMEA message format is selected more options become available Baud Rate The required serial baud rate can be selected from this drop down menu Update Rate The update rate of the NMEA messages can be changed using this drop down list Message Selection NMEA messages can be selected and deselected for transmission by checking and un checking the boxes next to each message type I O Analogue Output Analogue output Speed Enter the maximum for the speed range you wish to measure Default speed is set to 400 kmh The maximum speed at 5V can be in the range 10 1000 kmh Lap pulse Lateral acceleration Longitudinal acceleration 2 Speed at5V 400 0 km h Analogue output Speed Lap Pulse When this option is enabled the VBSS will output a 5V pulse when a Start Finish line is crossed The duration of the pulse in milli Seconds can be adjusted by entering a different value The polarity of the pulse can be changed to either a rising or falling pulse by clicking the Polarity button 2 Lateral acceleration C Longitudinal acceleration Pulse duration 250 ms Polarity e Analogue output Lateral Longitudinal Acceleration Select the range you wish to use from the pull Speed down list La
13. MEA output The RS232 output is present to provide a connection to a computer for configuring the settings of the VBSS through the VBSS setup software It also can output NMEA format messages The VBSS can output 8 types of messages the most commonly used are GPGGA and GPVTG the contents of which are shown below SGPGGA hhmmss ss Latitude N Longitude E FS NoSV HDOP msl m Altref m DiffAge Di rotatron cs s R2 LP ASCII String Format Description sGPGGA P Message ID GGA protocol header hhmmss ss hhmmiss sss 092725 00161229 4 UTC Time Current time 87 dddmm mmmm 4717 113993723 24 Latitude Degrees minutes 5 or Sssourh Longitude dddmm mmmm 00833 9159012158 Longitude Degrees minutes 3416 PF character WEE indicator E east or W west ES digit Position Fix indicator Table 41 NoSV numeric 078 Satlites Used Range Oto 12 Fio nei 19 715 Horizontal Dilton of Precor Disi m WsLANude eme ME nis es pAitrer blank 480 eid ps Mee DiffAge numeric second Age of Differential Blank Null fields when DGPS is Corrections not used DiffStation numeric Diff Reference Station ID EL BEEN 5B 18 End of message SGPVTG cogt T cogm M sog N kph K cs CR LF ASCII String Name Fomat unis description Messen Vis eroi hende
14. basic current setup GPS Info shows details on fitted GPS engine 6 Write to unit After making changes to setup the write to unit button must be selected to upload settings 7 GPS Information Technical details about the GPS engine installed in the connected unit 8 VBOX Information Serial number and installed firmware version of connected unit 9 GPS Coldstart Clears almanac stored in the GPS engine Only to be used when struggling to gain SAT lock Unit 10 Swan Business Park Osier Way Buckingham Bucks MK18 ITB England Tel 44 0 1280 823 803 Fax 44 0 1280 823 595 Email vbox racelogic co uk www velocitybox co uk VBSS100SL User Guide 100 Hz Speed Sensor CAN The CAN output consists of up to 13 CAN messages To see details of the default CAN output of the VBSS go to the CAN format section at the end of this manual CAN 1 Enabled 500 00 kHz default 250 00 kHz 125 00 kHz 1 Baud Rate The software has four common baud rate values 1 00 MHz 500 kHz 250 kHz or 125 kHz The user also has the option to select a custom baud rate 2 CAN termination Resistance The internal CAN termination resistance can be enabled or disabled here 2 3 CAN Settings Transmitted identifiers CAN output identifiers 1 Actual ID 301 02 8 303 8 8 m a Parameters in CAN frame 3 Satellites UTC time Latitude 3 ongitude Speed Heading 3 eig
15. e as lowering this value can stop the virtual line being triggered by the incorrect area of the circuit Time before retrigger This allows the user to set a number of seconds during which the brake trigger will not be reactive after having been pressed This is to avoid trigger bounce during tests CAN Pulse Width This option controls the duration of the lap time and splits CAN pulse Other lap timing CAN channels such as Lap Marker SF crossing pulse or gate crossing pulse mare set to a 1000ms duration or the highest analogue or digital pulse duration setting if greater Note For a Lap beacon pulse to be output by the VBSS ensure valid virtual gate s have been loaded 3 Splits Use the Load all button to load a SPL or DSF file containing start finish and split gates Optionally load split points finish line or S F line separately using the separate Load buttons Files loaded via these buttons will have the selected information only loaded from them i e a file containing a start finish gate and 6 splits will only load the start finish gate when loaded via the Start Finish Load button Unit 10 Swan Business Park Osier Way Buckingham Bucks MK18 England Tel 44 0 1280 823 803 Fax 44 0 1280 823 595 Email vbox racelogic co uk www velocitybox co uk Upgrading the VBSS Firmware Firmware refers to the operating software inside the VBSS Speed Sensor The firmware is responsible for all of the function
16. e direction of motion and clear from any obstructions see image below For normal operation place the primary antenna Socket A at the rear of the car and the secondary antenna Socket B at the front All measurements are made from the primary antenna 3 Make sure the antennas are rotated so the wires exit in the same direction as each other 4 Accurately measure separation distance to the nearest 5 millimetres for best accuracy measure from the point at which the cable exits the antenna 5 Power up VBSS100SL 6 Connect VBOX Manager to VBSS100SL CAN connector on RLCABO93 C 7 Through VBOX Manager go into VBOX gt DUAL ANTENNA gt SEPARATION and enter the separation of the antennas 8 Allow the unit time to acquire full satellite lock The number of satellites in view is indicated by the SATS LED the total of green flashes indicates GPS count whilst an orange flash indicates the GLONASS satellite count If the Speed Sensor has not used for a long time or the location where it is being tested has changed drastically a GPS coldstart may be required Note that Racelogic Config software must be used to do this SEE UT ERES UT Unit 10 Swan Business Park Osier Way Buckingham Bucks 8 ITB England Tel 44 0 1280 823 803 Fax 44 0 1280 823 595 Email vbox racelogic co uk www velocitybox co uk VBSS100SL User Guide 100 Hz Speed Sensor For Slip and Roll measurements 1 Follow the same st
17. eps as Slip amp Pitch measurement guide but mount the antennas 90 to the true heading of the vehicle such that the primary antenna Port A is on the left hand side of the roof Minimum recommended separation between the antennas is 0 5m on a level plane but the greater the separation distance the better the accuracy 2 Using the VBOX Manager go into VBOX gt DUAL ANTENNA gt and tick ROLL MODE Go into VBOX gt DUAL ANTENNA gt SEPARATION and enter the separation of the antennas 4 Try to avoid placing the antennas close to the edge of the roof as this may result in poor dual lock This is because reflections from the ground will disturb the signals In order to get a useful slip angle in Roll mode you will need to follow the slip translation guide found on page 13 The slip angle is calculated from the primary antenna position which in roll mode is off centre and will give inconsistent measurements Translating this position back to the centre of the car will make the slip measurement consistent when turning both ways Antenna Placement Whilst installation and use of the VBSS100SL is intended to be fast and simple careful attention must be paid to placement of the antennas It is essential that the separation of Antenna B from Antenna A is exactly the same as the separation value set inside the Speed Sensor via the VBOX Manager or Racelogic config software If the separation is incorrect data may not be given or may be
18. g MN LA f NN 1 Primary Antenna Port A 2 Secondary Antenna Port B C J NEZ SS CN RACELOGIC X Unit 10 Swan Business Park Osier Way Buckingham Bucks MK18 1 England Tel 44 0 1280 823 803 Fax 44 0 1280 823 595 Email vbox racelogic co uk 4 10 www velocitybox co uk VBSS100SL User Guide 100 Hz Speed Sensor Align Antennas To measure the slip angle with the most precision try and get the alignment of the antennas as close as possible to the centreline of the vehicle Any residual errors in this alignment can be removed using the AUTO ALIGN feature available in the VBOX Manager The calibration process requires the driver to drive in a straight line for a short period of time whilst maintaining a constant speed greater than 25km h Note that any camber on the road or a strong side wind will affect this alignment Note You must have dual antenna lock to be able to perform this calibration Selecting the CLEAR option will remove any offset applied to the slip channel Level Antennas The Pitch measurement uses the relative height difference between the antennas to calculate the Pitch Angle relative to the ground If the roof of your vehicle is not perfectly flat in relation to the ground then this will show up as a Pitch offset You can automatically remove any offset by performing the AUTO LEVEL feature available on the VBOX Manager It is recommended that
19. gives the user the option to select whether the Speed Sensor uses differential GPS None Differential GPS is off SBAS SBAS differential corrections are received from the nearest Geo stationary GPS SBAS satellite RTCM RTCM corrections are received by the VBSS via a Racelogic telemetry module and a locally placed Base station Contact Racelogic or your local agent for more details 2 GPS Optimisation This option allows the user to change the sensitivity of the GPS engine For high dynamic applications such as brake stop testing this should be set to High For less dynamic applications such as steady state speed measurement or coast down testing this can be set to Low 3 Slip Angle Settings Here the user is able to enable or disable twin antenna mode set roll mode and configure slip translation channel offsets 4 GPSSettings Change the update rate of the GPS engine and set a minimum speed output value and elevation mask if required For more information on elevation masking see page 9 Unit 10 Swan Business Park Osier Way Buckingham Bucks 8 ITB England Tel 44 0 1280 823 803 Fax 44 0 1280 823 595 Email vbox racelogic co uk www velocitybox co uk VBSS100SL User Guide 100 Hz Speed Sensor Serial The serial output screen allows the user to configure the format content and data rate of the serial stream transmitted by the Speed Sensor Serial 1 Mode NMEA messages Racelogic Baud rate
20. gue Output e User Configurable Digital Output 666 e Virtual Lap Beacon Output e Compatible with DGPS Basestation e Rugged Deutsch ASDD Autosport connector e High quality aluminium enclosure e 1 66 rated water and dustproof e Wide 6 5V 30V operating range Low current consumption Standard Inventory Description Qty Racelogic Part RLVBSS100 SL Speed Sensor 1 VBSS100 SL GPS GLONASS Magnetic Antenna 2 RLVBACS156 VBOX Tape Measure 1 RLACSO91 VBOX File Manager Unit Only 1 VBFMAN Carry Case 1 RLACS106 VBSS Speed Sensor User manual 1 VBSSMAN CD ROM containing Racelogic Config 1 CDVBSS Supplied separately VBSS Speed Sensor Interface Cable 1 9 Analogue Digital CAN Serial Power RACELOGIC X Unit 10 Swan Business Park Osier Way Buckingham Bucks MK18 1 England Tel 44 0 1280 823 803 Fax 44 0 1280 823 595 Email vbox racelogic co uk VBOX www velocitybox co uk VBSS100SL User Guide 100 Hz Speed Sensor Quick start Guide For Slip and Pitch measurements Required equipment All supplied as standard unless specified VBSS100SL Connecting Loom RLCABO93 C VBOX File Manager RLCABOO5 C 2 X GPS amp GLONASS antenna RLACS156 Tape measure 1 The Speed Sensor unit needs to be mounted flat inside the test vehicle Failing to do so will have an impact on the accuracy of the calculated slip channels 2 Mount the GPS GLONASS antennas on the vehicle roof in line with th
21. ham Bucks MK18 1 England 4 10 www velocitybox co uk VBSS100SL User Guide 100 Hz Speed Sensor Hardware amp Software Support Support One Year Support Contract Software Lifetime Support Contract Valid for a minimum of 5 years from the date of purchase and limited to the original purchaser Contract includes telephone email technical support provided by local VBOX Distributor and firmware software upgrades where applicable Connection Data ANTENNAS Main Connector Deutsch Autosport Pin I O Function 1 5232 2 8V to 30V Power Ignition switched feed 3 I O CAN Low 4 I O CAN High 5 O Analogue Output 6 Lap Marker Input Brake Trigger Input 7 O Speed Pulse Lap Beacon 8 5232 9 Ground Contact Information Racelogic Ltd Unit 10 Swan Business Centre Osier Way Buckingham MK18 1TB England Tel 44 0 1280 823803 Email support racelogic co uk Fax 44 0 1280 823595 Web www racelogic co uk Unit 10 Swan Business Park Osier Way Buckingham Bucks 8 ITB England Tel 44 0 1280 823 803 Fax 44 0 1280 823 595 Email vbox racelogic co uk www velocitybox co uk
22. he Lap Input pin 6 This pin should be connected to one side of a momentary switch and the other side of the switch connected to the Ground pin of the VBSS so that when the switch is pressed the Lap Input pin will be shorted to Ground Brake trigger Set a Start finish line Press and immediately release the Lap input switch as you cross the start finish line You must be moving gt 5km h to do this and following the normal line along the track The VBSS notes the point and direction of travel then creates a virtual line perpendicular to your line of travel 25m wide Set a separate Finish line press hold the switch for gt 1 5 seconds before releasing After you have set a Start Finish or Finish line you can view the Latitude and longitude of this line position in the Tests page of the setup software If the software was already connected then press Connect again to refresh the settings Set a Split line Press the button twice for a very short period when this has been marked the 2 LED flashes quickly 5 times The output from the split line should be identical in all respects as the first To clear all Virtual lines Press the button shortly once followed by a longer button press longer than 1 5 seconds In each case the VBSS will recognise the lead edge of the first pulse as the activation in order to set the associated virtual line at the exact point that the user first presses the switch Digital input Brake Trigger
23. he Racelogic standard VBOX output ie Starting at 0x301 Update Data Bytes 1 Sats in 0x301 100ms AN 2 Time since midnight UTC 3 Position Latitude MMMM MMMMM 0x302 100ms 4 Position Longitude MMMMM MMMMM 5 Speed Knots 6 Heading Degrees 1 o3 100ms 7 Altitude WGS 84 Metres 8 Vertical velocity M S 9 Status n _0 304 100ms 11 Distance from Brake trigger Meters 12 Longitudinal Accel G 13 Lateral Accel G _0 305 100ms 14 Distance travelled since VBOX reset Metres 15 TrigeerTime S 16 Trigger Speed _0 306 100ms Unused 17 Lean Angle degrees 18 RediusofTurn meters 100ms 23 Speed at start of test 24 Speed at end of test Ej Deceltesttimet kmh kmh 0 100 26 Lap time s 27 Split time s 28 Status 2 L Veloci Ox30B 29 True Heading Degrees 30 Slip Angle degrees 31 Pitch Angle Degrees Ox30C 33 Yaw Rate Degrees S 34 Roll Angle Degrees 36 Center of Gravity 0 300 100ms _ 37 Front Left 38 Front Right 39 Rear Left 40 Rear Right 20 VBSS100SL User Guide 100 Hz Speed Sensor CAN output continued 1 If Satellites in view 3 then only Identifier 0 301 transmitted and bytes 2 to 8 are set to OxOO 2 Time since midnight This is a count of 10ms intervals since midnight UTC 5383690 53836 9
24. ht Vertical velocity Status i 3 rigger distance Longitudinal acceleration Lateral acceleration lt 3 otal distance Trigger event time TriggerSpeed lt 1 Send switch a CAN message on off tick un tick the box for the corresponding message 2 Default Actual ID This allows the user to modify the CAN IDs transmitted by the Speed Sensor Default values are the Racelogic standard ID s of 0x301 0x302 0x307 3 Standard Extended To change the identifier format from standard 11bit to extended 29bit tick the Extended box in the corresponding column 4 Parameters shows which parameters will be sent out in each message Unit 10 Swan Business Park Osier Way Buckingham Bucks MK18 ITB England Tel 44 0 1280 823 803 Fax 44 0 1280 823 595 Email vbox racelogic co uk www velocitybox co uk VBSS100SL User Guide 100 Hz Speed Sensor GPS 1 GPS settings Update rate 2 GPS optimisation Minimum speed Low dynamics 4 i Elevation mask Medium dynamics High dynamics Slip angle 3 Dual antenna mode _ Roll mode Antenna separation 1 000 Centre of gravity offset Long 0 000 Front left offset Long 0 000 Front right offset Long 0 000 Rear left offset Long 0 000 lt I gt lt l gt lt l gt lt gt gt lt I gt lt I gt lt l gt gt lt gt Rear right offset Long 0 000 1 DGPS Mode This
25. inal offset 1 Primary Antenna Port A 2 Secondary Antenna Port B Unit 10 Swan Business Park Osier Way Buckingham Bucks 8 ITB England Tel 44 0 1280 823 803 Fax 44 0 1280 823 595 Email vbox racelogic co uk www Vvelocitybox co uk VBSS100SL User Guide 100 Hz Speed Sensor Antenna Offsets In section 1 on the diagram below there is a lateral offset between the primary antenna and the target area for slip measurement Same again for section 2 there is a longitudinal offset These offsets will need to be applied to the VBOX Manager ensure you apply the correct sign when entering the offsets 5 EJ91 A X Longitudinal offset 1 Lateral offset Y example 0 45m 2 Longitudinal offset X example 3 50m 3 FL Front Left translated slip position Each calculated slip point will require two offsets LAT amp LNG or lateral amp longitudinal for the VBOX to calculate the channels correctly Note if the primary antenna moves the offsets will need to be measured again for example swapping between a pitch and roll setup yasyo E1338 A X Longitudinal offset t Translated slip points 1 RL Rear Left 2 RR Rear Right 3 FL Front Left 4 FR Front Right 5 COG Centre of gravity Unit 10 Swan Business Park Osier Way Buckingham Bucks 8 ITB England Tel 44 0 1280 823 803 Fax 44 0 1280 823 595 Email vbox racelogic co uk www ve
26. lay 1 2 3 4 Sequence showing 0 Satellites Delay Approximately 1 second Delay Approximately 1 second Unit 10 Swan Business Park Osier Way Buckingham Bucks MK18 ITB England Tel 44 0 1280 823 803 Fax 44 0 1280 823 595 Email vboxGracelogic co uk www velocitybox co uk oo lt a ce wOo VBSS100SL User Guide oC 100 Hz Speed Sensor LED Indicators Continued EVENT Flashes in time with the digital pulse output e Digital Output set to Speed If the digital output is set to speed then the GREEN LED will flash in time with speed at a rate of 1 10th of the digital output e Digital Output set to Pulse If the digital output is configured for the Lap Pulse the EVENT LED shows green for 1s when the start line is triggered The EVENT LED and SATS LED both show green for 1s if the finish line is triggered NB The EVENT LED and the GPS LED will be constantly lit RED for the duration of a coldstart Antennas The GPS GLONASS antennas supplied with a RLVBSS100SL are 5V active antennas For the best possible signal quality it is important to maintain a clean connection between the antenna and a RLVBSS100SL Before fixing the antenna to a RLVBSS100SL ensure that there are no dust particles in either connector Replacement antennae are available by contacting your VBOX distributor The antenna is a magnetic mounting type for quick and simple mounting to the vehicle roof For optimum
27. locitybox co uk VBSS100SL User Guide 100 Hz Speed Sensor Configuring the Speed Sensor Hardware Connection Configuration of the VBSS is performed using Racelogic Config software Using the supplied RLCABO93 loom connect the serial plug to the computers serial port this can be done via a serial USB convertor if required Software Connection Connect Use the drop down list to select the correct COM port that the speed sensor is connected to Click the connect button to enter the VBSS setup screen Note An auto detect message may appear if the baud rate has been changed from the default value select Yes to allow the different baud rates to be scanned Setup Options General 3 anguage Connected Units 4 Distance ME Spee Serial number 28203 Firmware version 1 1 11 Diagnostics Satellites 0 UTC time 23 27 47 00 5 Latitude 0 0 000000 N Longitude 0 0 000000 GPS information SEINE Speed 0 000 km h SEDET b2 Analogue output Lap pulse Digital output Lap pulse Digital input Lap pulse GPS coldstart GPS engine update rate 100 Hz 1 Connection Selected com port refresh and disconnect buttons 2 Load Save Load Save settings from into an sscfg file This allows setups to be kept for future use 3 Language Select an operating language 4 Units Select Distance units m ft km mi nmi and Speed units kmh mph kts m s fts 5 Diagnostics Displays live GPS data and
28. may be required RACELOGIC X Unit 10 Swan Business Park Osier Way Buckingham Bucks MK18 1 England Tel 44 0 1280 823 803 Fax 44 0 1280 823 595 Email vbox racelogic co uk VBOX www velocitybox co uk VBSS100SL User Guide 100 Hz Speed Sensor Mounting The RLVBSS100SL should be mounted as close as possible to the centre of the vehicle It is also important to mount the sensor so that it is level with the ground Satellite Elevation Mask This feature can be used to improve GPS signal quality when nearby obstructions like trees and building are reflecting or temporarily obscuring the signal from satellites at low elevation Raising the mask will cause the GPS engine to ignore satellites below the mask angle so must be used carefully as it also reduces the total number of received satellites The elevation mask angle can be changed in the GPS section within VBOX Tools Setup Satellite above Unwanted Intermittent Satellite at 8 reflection from obstruction from isignored trees buildings Unit 10 Swan Business Park Osier Way Buckingham Bucks MK18 ITB England Tel 44 0 1280 823 803 Fax 44 0 1280 823 595 Email vbox racelogic co uk www velocitybox co uk VBSS100SL User Guide 100 Hz Speed Sensor How to setup Dual Antenna using VBOX Manager The VBOX Manager has been developed to control the operating functions of a VBSS100SL Within the Dual Antenna menu selec
29. nalogue and Digital lines The VBSS100SL can be used for non contact sensing of velocity providing signal output data on CAN analogue and digital allowing easy integration with data loggers and testing applications The analogue output can be assigned to vehicle speed lateral acceleration longitudinal acceleration or lap beacon marker with user selectable scaling The digital output can be configured as either a digital soeed pulse output or a lap beacon marker The unit has a hardware footprint of only 13cm long making mounting and transportation easy making the Speed Sensor perfect for automotive testing motorsport marine telematics and data logging applications and the IP66 rating means that each unit is water and dustproof allowing them to be used in a variety of conditions The VBSS100SL package includes a VBOX Manager which enables the user to setup the dual antenna separation change the dynamic modes level and align the antennas The speed sensor can be used straight from the box and will output digital and analogue signals according to the default settings These settings can be changed using the Racelogic Config Software Features Outputs e High Performance GPS GLONASS Receiver 100Hz e CAN Bus Output includes Speed Heading True Heading Slip Angle Pitch or Roll Angle Slip Translations Brake Stop Distance Radius of Turn Gyro Yaw Rate 5232 Serial Output of NMEA position velocity and time e User Configurable Analo
30. p pulse Lateral acceleration Longitudinal acceleration Unit 10 Swan Business Park Osier Way Buckingham Bucks MK18 ITB England Tel 44 0 1280 823 803 Fax 44 0 1280 823 595 Email vbox racelogic co uk www velocitybox co uk ceo e VBSS100SL User Guide 1 6022 100 Hz Speed Sensor Digital Output Digital output Speed The speed output is configured by changing the number of pulses per metre Default 90 pulse per metre gt 25 Hz per km h GPS sync Lap pulse Pulses per metre 90 2 Digital output GPS Sync Selecting this option outputs a pulse every second which is synchronised to the GPS clock Note this feature is an optional extra which is not available by default A GPS engine update is required to allow this to work correctly Contact support racelogic co uk for more information Lap pulse Digital output Lap Pulse When this option is enabled the VBSS will output a 5Vpulse for 300ms Speed when a Start Finish line is crossed The duration of the pulse in milliseconds can be adjusted by entering a different value The polarity of the pulse can be changed to either a rising or falling pulse by selecting the marker next to the desired image GPS sync Pulse duration 300 ms Polarity el Digital Input Lap Pulse input To program the position of a virtual line in the Speed Sensor you Digital input must first ensure that you have a connection to t
31. pting to Technical Progress Council directive 72 245 EEC relating to the radio interference Electromagnetic Compatibility of vehicles and amending directive 70 156 EEC on the approximation of the laws of the member states relating to the type approval of motor vehicles and their trailers And has also been assessed via Technical Construction File by an independent DTI Competent Body and found to be in conformance with the essential requirements of EC Directive 89 336 EEC and amending directives Council Directive of 03 May 1989 on the approximation of the laws of the member states relating to electromagnetic compatibility DTI Competent Body responsible for issuing certificate of compliance 3C Test Ltd Silverstone Technology Park Silverstone Northants NN12 8GX Hardware Overview KRACELOGIC GPS Speed Sensor 3 CAN Low 4 High Unit 10 Swan Business Park Osier Way Buckingham Bucks 8 ITB England Tel 44 0 1280 823 803 Fax 44 0 1280 823 595 Email vbox racelogic co uk www Vvelocitybox co uk oo lt a ce wOo VBSS100SL User Guide 0002F HET 100 Hz Speed Sensor Introduction VBOX Speed Sensor dual antenna VBSS100SL is a high accuracy 100Hz GPS GLONASS system VBSS100SL combines high level accuracy and test repeatability with the ability to measure slip and pitch roll angles at 100Hz Data is present on multiple outputs such as CAN RS232 A
32. s Circle of Error Probable 95 of the time the position readings will fall within a circle of the stated radius Based on 50m brake stop distance Unit 10 Swan Business Park Osier Way Buckingham Bucks 8 ITB England Tel 44 0 1280 823 803 Fax 44 0 1280 823 595 Email vbox racelogic co uk www velocitybox co uk VBSS100SL User Guide 100 Hz Speed Sensor Outputs Data available Position vehicle speed heading lateral acceleration longitudinal acceleration satellite count time radius of turn altitude Distance from Trigger Trigger Time Trigger Velocity True Heading Slip angle Yaw rate Pitch Roll angle Longitudinal and Lateral Velocity Output Data Rate Up to 100Hz Data Available NMEA or RL Serial Output Data Rate 5v DC Data Available Either Speed Lateral Acceleration Longitudinal Acceleration or Lap Beacon Output Data Rate Low Ov High 5v Max frequency 4 4Khz Data Available Speed or Lap Beacon Inputs Input Voltage range 15 Gen 6 5v 30v DC 2 Gen 7v 30v DC GPS Antenna 5V Active Antenna inc Digital Input Cold Start Activate Set Lap beacon Position LED Power Satellite Count Event Out Environmental and physical Approx 250g Operating temperature 30 C to 70 C Connectors fala ASDD Autosport Rated IP66 Tel 44 0 1280 823 803 Fax 44 0 1280 823 595 Email vbox racelogic co uk RACELOGIC Unit 10 Swan Business Park Osier Way Bucking
33. s within the VBSS and from time to time firmware updates will be released by Racelogic to improve or enhance the way that the VBSS works The latest firmware will always be available on the Racelogic website www firmware racelogic co uk It is recommended to check the web site periodically for updates The VBSS upgrade files have a ruf file extension To upgrade the VBSS firmware download the latest firmware file from the Racelogic web site and copy this file onto your PC If you have done a full VBSS CD installation then you will have the upgrade programme automatically installed in the Utilities folder of VBSS folder If not then this can also downloaded from the website Connect you pc to the VBSS via the VBSS serial lead and apply power to the VBSS Either double click on the upgrade file which auto runs the Upgrader software or run the Upgrader software and load in the firmware upgrade file Then follow the onscreen instructions and the VBSS firmware will be upgraded At the end of the process power down the VBSS when prompted before further use During the upgrade process an upgrade log file will have been created This log file can be emailed to the support address below should any problems arise If you have any questions regarding the upgrade of the VBSS please do not hesitate to contact support racelogic co uk CAN output The following details the default CAN output from a RLVBSS100SL Note this is t
34. t the enable option in order to see the full dual antenna system menu with a tick shown next to enable DUAL ANTENNA DUAL ANTENNA BITES BACK SEPARATION ROLL MODE ALIGN ANTENNAS fy Antenna Separation The most important factor for dual antenna testing is the correct configuration of the separation distance between the two antenna centre points This allows the VBSS100SL to acquire and maintain dual antenna lock The physical separation distance between the two antennas should be measured as accurately as possible and entered in to the Separation option of the Dual Antenna menu Distances can be incremented in millimetre steps DUAL ANTENNA SEPARATION INFORMATION V ENABLE 500 PLEASE WAIT PM SES vatis APPLY m ALIGN ANTENNAS Q Note Whenever the physical antenna separation is altered this should be changed accordingly within the VBOX Manager Roll Mode optional The VBSS100SL allows the user to separately test roll and pitch measurements during their testing By default the VBSS100SL will be setup for pitch determination If the user wishes to setup their antennas across the width of the car to measure roll angle then the Roll Mode option must be toggled in the Dual Antenna menu Click this option to toggle between Pitch Mode no tick and Roll Mode tick DUAL ANTENNA INFORMATION DUAL ANTENNA V ENABLE PLEASE WAIT y ENABLE SEPARATION m OK SEPARATION ROLL MODE Se MODE ALIGN ANTENNAS 6 ALIGN ANTENNAS E
35. t wat QUU EF ten MEX CEN vEF NEAN EE RFRIAVEFESE ON YE RRMEECYNERVERERVRFSVENEMEFNVEFRFEFIFEEEFKPECRERVED VERE VEU 5 FOR SLIP AND ROLL MEASUREMENTS crea ture ere pase suis 6 ANTENNA PLACEMENT 6 OPERATION 7 oe rene secon coats EE 7 POWER e 7 NBN s epe ccm O 7 ANTENNAS NERONE E NE PEEES 8 MOUNTING Uu n 091 ASRENEUPEST IE ARUPRPUSANEASRE QR EAT UR PL RAI AR AR ARES RAE NEAR RIA ATARI PER ATUS TNR ATUS AR AT AR ATO TIS AR 9 SATELLITE ELEVATION MASK 9 HOW TO SETUP DUAL ANTENNA USING VBOX MANAGER ccccccccccccccccccccccccccccccccecccccccccceccccccccccscccceccecccccccecccccecccccccccccccsccccccccccccecccccecs 10 P un sip Fete Tl rA RR 10 e ago VB MR 10 POTS PBS NING

VBSS100SL User Guide

Contents

Download Pdf Manuals

Related Search

Related Contents