Home

Manual - Datatail

image

Contents

1. MP3 WMA 48 kHz FLAC 24 bit 48 kHz 24 bit 192 kHz PCM content from PC or MAC Coaxial 75 ohms AES EBU 110 ohms 32 kHz to 192 kHz 0 5dB ref 20 Hz 96 kHz 192 kHz gt 75dB ref 1 3 rated power 10 kHz 4 ohms 435 x 133 x 383 mm 17 1 8 x 5 1 4 x 15 1 8 inches 14 5 kg 32 0 Ibs Gross dimension include feet front panel and rear panel extensions knobs buttons speaker terminals sub fascia etc Specifications are subject to change without notice For updated documentation and features please check out www NADelectronics com for the latest information about M12 21 www NADelectronics com 2014 NAD ELECTRONICS INTERNATIONAL A DIVISION OF LENBROOK INDUSTRIES LIMITED All rights reserved NAD and the NAD logo are trademarks of NAD Electronics International a division of Lenbrook Industries Limited No part of this publication may be reproduced stored or transmitted in any form without the written permission of NAD Electronics International While every effort has been made to ensure the contents are accurate at the time of publication features and specifications may be subject to change without prior notice M12_ENG_OM_V11 OCT 2014
2. 13 BALANCED e Use the BALANCED analog audio input of the M12 if the external source to be connected has BALANCED audio output Superior audio quality is ensured with the distinctive noise reduction capability of BALANCED connection with XLR jacks 14 AES EBU IN e Digital audio stream from professional audio sources like SACD CD Players or processors can be connected to this XLR connector e For high end sources with higher sampling rates like 176kHz and 192kHz it is highly recommended that such sources be interfaced with the AES EBU IN connector The AES EBU IN is well suited to handle such sources with high sampling rate 15 ANALOG AUDIO OUT BALANCED SINGLE ENDED e The ANALOG AUDIO OUT is the main output port that connects the M12 to the corresponding audio input ports of external amplifiers This makes it possible to use the M12 as a pre amplifier to such devices e The ANALOG AUDIO OUT consists of BALANCED and SINGLE ENDED output ports It is recommended to use M12 s BALANCED analog audio output if the external amplifier has corresponding BALANCED input port Otherwise use the SINGLE ENDED analog audio output to connect the M12 to the corresponding SINGLE ENDED UNBALANCED or analog input port of an amplifier 16 GROUND TERMINAL e Use this terminal to properly ground your M12 to a grounded AC receptacle or a separate earth ground e The M12 can be connected to ground by connecting a ground lead wire or similar to this gr
3. When you have finished entering the desired command sequence press MACRO again to store the macro the Learn LED and MACRO key illumination will turn off NOTE Each macro can store a maximum of 64 command steps If you exceed this number the macro will be stored automatically after the 64th command is added Example Record a Macro to the 0 key to Turn on the M12 Select Input 1 Source 1 and Commence Playback of connected Source 1 device as in BD player e Onthe HTRM 2 simultaneously press and hold MACRO and 0 numeric zero the Learn LED turns steady green e Press AMP press ON press 1 Input or Source 1 press BD press gt Play the Learn LED blinks as each step is added e Press MACRO again to exit the macro record mode To clear a macro perform the above steps without entering any functions EXECUTING MACROS To execute a macro press and release MACRO its key illumination lights for 5 seconds While it remains lit press an HTRM 2 key to which a macro has previously been stored The corresponding macro will run as each step executes its parent Device Selector s key flashes lights briefly when execution is finished the MACRO key illumination goes out Pressing any other HTRM 2 key while a macro is executing will abort the macro Remember that you must hold the HTRM 2 so that its infrared emitter can activate the target components NOTE When a macro executes a 1
4. Back If no external USB mass storage device is connected to USB Front or USB Back input Please Insert Device will be shown in the touch panel display Mode EQ Setup USB Front Please Insert Device v Previous Dir Now Playing With an external USB mass storage device connected to either USB Front or USB Back input MP3 WMA or FLAC files or folders will be shown in the touch panel display Select desired file to playback Mode EQ Setup 3 Complicated Avril Lavigne mp3 4 Give Me A Chance Ric Segreto mp3 5 Family Affair Mary J Blige mp3 6 Beautiful Christina Aguilera mp3 Previous Dir Now Playing Mode EQ Setup Complicated Avril Lavigne wM E OPERATION USING THE M12 If the connected USB mass storage device does not contain any applicable MP3 WMA FLAC files No files will be shown in the touch panel display Refer also to the items about USB MODE and LISTENING TO USB DEVICE at the OTHER FEATURES section of the OPERATION page MODE Main EQ Setup Mode Mono ale Polarity Negative ops The M12 offers distinct listening modes tailored for different types of recording or program material The following listening modes can be selected STEREO e Select Stereo when you wish to listen to a stereo production such as music CD or FM broadcast e Stereo recordings whether in PCM digital or analog form and whether Surround encoded or not encoded are reproduc
5. Setup q Coax 1 20 Qae Scroll through file list Mode EQ Setup 3 Complicated Avril Lavigne mp3 4 Give Me A Chance Ric Segreto mp3 5 Family Affair Mary J Blige mp3 6 Beautiful Christina Aguilera mp3 Previous Dir Now Playing Select file Mode EQ Setup 3 Complicated Avril Lavigne mp3 4 Give Me A Chance Ric Segreto mp3 5 Family Affair Mary J Blige mp3 6 Beautiful Christina Aguilera mp3 4 Previous Dir Now Playing U D 3 zZ m gt a 3 m U z 4 Playback pause file Mode EQ Setup Complicated Avril Lavigne J g Z m m m vV WY e DEVICE SELECTOR must be set to MP Skip to next file Skip back to previous file Mode EQ U po O zZ Q m gt Pa z3 m U 5 H Setup Complicated Avril Lavigne cr zZ m W A A m J g Z m m W DEVICE SELECTOR must be set to MP OPERATION USING THE M12 cy SKIP CH SOURCE V Random playback i i WoT C 0 Cay RANDOM VOL Gee WV ae at co i ON Press repeatedly to toggle random playback of current list all RANDOM DEVICE SELECTOR must be set to MP folders or random off Setup Complicated Avril Lavigne epeal pana i Mode EQ Setu p PROGRAM CLEAR REPEAT Complicated Avril Lavigne TONE L NITE sila i DIMMER NAO ae Press repeatedly to toggle repeat playback current file all folders REPEAT DEVICE SELECTOR must be set
6. e Set Volume Control to Variable e Set to ON the rear panel POWER switch and then press front panel Standby button e Toggle DIMMER button until desired brightness level e Check batteries e Check IR windows and ensure clear line of sight from remote to M12 e Reduce sunlight room lighting OVERALL SPECIFICATIONS Line Level Input Input impedance R and C Input sensitivity Maximum input signal Signal Noise ratio A weighted Channel Separation Frequency response Frequency response subwoofer out Output Maximum output level THD CCIF IMD DIM 100 Balanced Standby mode Tone Controls Treble Bass USB Input Digital USB Front Digital USB Back USB Type A Computer USB Type B Digital Input Coaxial Optical AES EBU Input impedance Sample rate Frequency response Channel separation DIMENSION AND WEIGHT Unit dimensions W x H x D Shipping weight REFERENCE SPECIFICATIONS 56 KQ 220 pF 40 mV ref 500 mV out gt 8 Vrms gt 90 dB ref 500 mV in 500 mV out volume set to unity gain gt 80 dB ref 2 V out Volume maximum gt 70 dB ref 1 kHz 10 kHz 0 3 dB ref 20 Hz 20 kHz Tone Controls On 0 3 dB ref 20 Hz 20 kHz Tone Controls Off 10 200Hz ref 3 dB gt 8 Vrms into 600 0 lt 0 005 ref 20 Hz 20 kHz 2 V out gt 2 Vrms lt 0 5 W 10 dB at 10 kHz ref 2V in 2V out 10 dB at 100 Hz ref 2V in 2V out
7. learn control codes from virtually any infrared remote controller allowing you to teach the codes of your equipment regardless of brand to the HTRM 2 However the HTRM 2 is already preprogrammed to operate the M12 All of the function keys on the AMP Device Selector page perform M12 functions The HTRM 2 can also command many other NAD components from its CD BD DAC and CUSTOM pages It is important to note that certain HTRM 2 keys perform different functions depending on the selected Device Selector page 15 OPERATION USING THE HTRM 2 REMOTE CONTROL LEARNING CODES FROM OTHER REMOTES Begin by positioning the HTRM 2 nose to nose with the source remote so the two devices infrared windows are about 2 inches apart e Enter Learning Mode On the HTRM 2 simultaneously press and hold for 3 seconds both a Device Selector key and the RES key until the Learn LED located between HTRM 2 s ON and OFF buttons turns steady green e Press the HTRM 2 s function key you wish to teach a command the Learn LED will turn amber e Press and hold the function key on the source remote The HTRM 2 s Learn LED will flicker amber for a second or two then turn solid green The command is learned e Press the HTRM 2 s Device Selector key again to exit the learning mode If the Learn LED does not flicker amber you may need to vary the distance between the remotes If the Learn LED turns red rather than gree
8. of the currently selected device The SURR CENT and SUB Channel Volume controls similarly are pre programmed as punched through To set a punch through after entering the Learning Mode and pressing the desired key to be punched through simply press the device key twice of the device to punch through to The status LED will turn green press the Device Selector key again to exit Learning Mode Example Punch through AMP SURR MODE key to the BD page e Onthe HTRM 2 simultaneously press and hold BD and RES the Learn LED turns steady green e Press SURR MODE the Learn LED turns amber e Press AMP twice the Learn LED turns green e Press BD again to exit the learning mode 16 COPY A COMMAND FROM ANOTHER KEY You may copy a command from any HTRM 2 key to any other To copy a key function after entering the Learning Mode and pressing the desired key to be copied to simply press the device key from which you wish to copy having first pressed its Device Selector key if it resides on another page The status LED will turn green press the Device Selector key again to exit Learning Mode Example Copy the Pause command from the CD page to the AMP II button e Onthe HTRM 2 simultaneously press and hold AMP and RES the Learn LED turns steady green e Press Pause II the Learn LED turns amber e Press CD press Pause II the Learn LED turns green e Press AMP again to exit the learnin
9. 2 can be switched ON remotely from standby mode by compatible devices such as amplifiers preamplifiers receivers etc If the 12V DC supply is cut off the M12 will return to standby mode 10 IRIN e This input is connected to the output of an IR infrared repeater Xantech or similar or the IR output of another component to allow control of the M12 from a remote location 11 RS 232 NAD is a certified partner of AMX and Crestron and fully supports these external devices Check out the NAD website for information about AMX and Crestron compatibility with NAD See your NAD audio specialist for more information e Connect this interface using RS 232 serial cable not supplied to any Windows compatible PC to allow remote control of the M12 via compatible external controllers e Refer to the NAD website for information about RS232 Protocol documents and PC interface program 12 POWER e Supply the AC mains power to the M12 e When the POWER switch is set to ON position the M12 goes to standby mode as shown by the amber status condition of the front panel Power indicator Press the front panel Standby button or HTRM 2 remote control s ON button to switch ON the M12 from standby mode e f you intend not to use the M12 for long periods of time such as when on vacation switch off the POWER switch With POWER switched off neither the front panel Standby button nor HTRM 2 remote control s ON button can activate the M12
10. AL CODES SEE NEC SECTION 810 21 f 15 Lightning For added protection for this product during a lightning storm or when it is left unattended and unused for long periods of time unplug it from the wall outlet and disconnect the antenna or cable system This will prevent damage to the product due to lightning and power line surges 16 Power Lines An outside antenna system should not be located in the vicinity of overhead power lines or other electric light or power circuits or where it can fall into such power lines or circuits When installing an outside antenna system extreme care should be taken to keep from touching such power lines or circuits as contact with them might be fatal 17 Overloading Do not overload wall outlets extension cords or integral convenience receptacles as this can result in a risk of fire or electric shock 18 Flame Sources No naked flame sources such as lighted candles should be placed on the product 19 Object and Liquid Entry Never push objects of any kind into this product through openings as they may touch dangerous voltage points or short out parts that could result in a fire or electric shock Never spill liquid of any kind on the product 20 Headphones Excessive sound pressure form earphones and headphones can cause hearing loss 21 Damage Requiring Service Unplug this product from the wall outlet and refer servicing to qualified service personnel under the following conditions
11. BRART NUMBER vcasseensecasaunnseeaseneadoccks 18 SUMMARY OF THEIR 2 MODES casadkaenperedisaegesedewnedes 18 PATTER FINSTALLA NON ae aes tech rae ara wid toa a ard zona tne wan decane ek 19 REFERENCE TROUBLESHOOTING scccswccdssadste ts na raer Era S 20 SPECIFICATIONS 203 scarscspacnwetewntedaveqcsmiasercsrdesaaseoes 21 digital signal processing and superbly accurate digital audio circuitry However we have also been careful to ensure that the M12 is as musically transparent faithful to every detail and spatially accurate as possible incorporating much of what we ve learned from more than a quarter century s experience designing audio video and home theater components We encourage you to take a few minutes now to read right through this manual Investing a little time here at the outset might save you a good deal of time later and is by far the best way to ensure that you make the most of your investment in the M12 For warranty information contact your local distributor NAD SHALL NOT BE HELD LIABLE FOR ANY TECHNICAL OR USER INTERFACE DISCREPANCIES IN THIS MANUAL THE M12 OWNER S MANUAL MAY BE SUBJECT TO CHANGE WITHOUT PRIOR NOTICE CHECK OUT THE NAD WEBSITE FOR THE LATEST VERSION OF THE M12 OWNER S MANUAL WHAT S IN THE BOX Packed with your M12 you will find Adetachable mains power cord e HTRM 2 remote control with 4 AA batteries e Four pieces of magnetic feet e Cleaning cloth e USB flash drive e Quick Setu
12. FF If the component turns off press ENTER to accept that code library number and exit the Library Mode If the component does not turn off enter the next three digit code library number from the table When you enter the correct number the component will turn off press ENTER to accept that code library number and exit the Library Mode LIBRARY NAD PRODUCT LIBRARY NAD PRODUCT CODE DESCRIPTION CODE DESCRIPTION 100 Receiver ned Discrete 300 Tuner ae oe ee Toggle 301 L75 L76 Tuner 102 S170 302 L70 Tuner 103 L75 303 L53 Tuner TEn ee 173 Tuner 3112 Zone 3 305 425 4112 Zone 4 306 445 105 L70 307 Txx5 Series Tuner 106 L76 400 Tape Deck B 107 118 401 TAPE Deck A 108 L53 500 TV 280 109 L73 501 MR13 110 Stereo Receiver Amplifier 502 MR20 111 Stereo Second Zone 503 PMR45 112 Txx5 Series 600 T535 1562 1585 M55 200 CD Player 601 T550 L55 201 CD Player old 602 1512 1531 1532 1571 1572 202 5170 5240 5340 603 L70 L73 BD 203 5325 604 L56 m m as PARED 205 M5 606 L53 BD 18 SEARCH MODE If none of the codes from the table when entered turns on the component and if you are quite sure you have followed the above procedure completely and carefully you may want to try the search method as follows Enter Library Mode by simultaneously pressing and holding for 3 seconds both the desired Device Selector key and the A V PSET key until the Learn LED turns green Now press and hold the HTRM 2 s A or V key th
13. ICAL 1 COAX 2 DIGITAL AUDIO INPUT DD SPDIF Reserved for Optional MDC Upgrade Module Reserved for Optional MDC Upgrade Module Reserved for Optional MDC Upgrade Module POWER ON A ATTENTION Please make sure that the M12 is powered off or unplugged from the mains power source before making any connections It is also advisable to power down or unplug all associated components while making or breaking any signal or AC power connections SE IN SINGLE ENDED e Use single ended analog audio input for sources CD Player tuner preamplifier processor or other applicable devices that are not equipped with BALANCED analog audio output PHONO e Input for either a Moving Coil or Moving Magnet phono cartridge Connect the twin RCA lead from your turntable to this input PHONO GROUND CONNECTOR e Turntables normally include a single wire earth lead Use the M12 phono ground connector to connect this lead e Unscrew the terminal to expose the hole that will accept the lead After insertion tighten the terminal to secure the lead COAXIAL IN 1 2 OPTICAL IN 1 2 e Connect to the corresponding optical or coaxial digital output of sources such as CD or BD DVD players digital cable box digital tuners and other applic
14. M12 Digital Preamp DAC MP NAD M12 Digital Preamp DAC Owner s Manual IMPORTANT SAFETY INSTRUCTIONS 1 Read instructions All the safety and operating instructions should be read before the product is operated 2 Retain instructions The safety and operating instructions should be retained for future reference 3 Heed Warnings All warnings on the product and in the operating instructions should be adhered to 4 Follow Instructions All operating and use instructions should be followed 5 Cleaning Unplug this product from the wall outlet before cleaning Do not use liquid cleaners or aerosol cleaners Use a damp cloth for cleaning 6 Attachments Do not use attachments not recommended by the product manufacturer as they may cause hazards 7 Water and Moisture Do not use this product near water for example near a bath tub wash bowl kitchen sink or laundry tub in a wet basement or near a swimming pool and the like 8 Accessories Do not place this product on an unstable cart stand tripod bracket or table The product may fall causing serious injury to achild or adult and serious damage to the product Use only with a cart stand tripod bracket or table recommended by the manufacturer or sold with the product Any mounting of the product should follow the manufacturer s instructions and should use a mounting accessory recommended by the manufacturer 9 Cart A product a
15. P Display contents of available source card modules as slotted in the rear panel Below is a description of the Source Setup display contents Main Cole lt E i Slot 1 Coax 1 07 10 C AY Slot 1 Coax 2 Coax 2 Slot 1 Optical 1 Optical 1 Slot 1 Optical 1 Optical 2 Back Main Cole a i Slot 2 Phono Phono Slot 2 Single Ended Single Ended Slot 2 Balanced Balanced Slot 2 Computer Computer Back Slot 1 Location slot of the Source module in the rear panel Coax 1 Coaxial 1 input Cable TV Source name for Coaxial 1 input Source name can be changed in the Name section shown below When a Slot line item is selected the following menu options will manifest Main Enabled n Name Cable TV Volume Control VEELE Enabled Source input can be enabled ON or disabled OFF Main Mode EQ Warning Changing these settings can cause unexpected loud ouput levels Volume Control Fixed f Fixed Level 0 0aB Save Cancel VOLUME CONTROL The M12 VOLUME control function is dependent upon the Volume Control menu setting Volume control can either be set to Fixed or Variable Select Save to store selected Volume Control and Fixed Level or Variable settings Fixed If Volume Control is set to Fixed audio output level is fixed and the M12 s volume control is bypassed e Set Fixed Level to desired preset dB level Audio output is fixed to the selecte
16. Treble Bass Balance The M12 has the following Tone Control levels Treble Bass and Balance Bass and Treble controls only affect the low bass and high treble leaving the critical midrange frequencies free of coloration The Balance control adjusts the relative levels of the left and right speakers Slide to adjust treble bass or balance level Gy Slide to turn ON or OFF Tone Controls At OFF setting tone controls Treble and Bass are disabled or defeated Balance option remains available Main Tone Controls Balance SETUP The Setup menu contains the menu options for Speaker Setup Source Setup Digital Output and Control Setup Main Speaker Setup Source Setup Digital Output Control Setup 12 SPEAKER SETUP Main Sub Output E Sub Mode Stereo abe Main Frequency Full f Main Trim 0 0aB ate 4 Back Main Main Frequency Main Trim Sub Frequency Sub Trim Back Main Sub Output Sub Output At ON Setting all subwoofer settings are in effect At OFF setting all subwoofer settings are disabled Sub Mode Mono or Stereo Main Frequency 40Hz to 200Hz and Full Main Trim 12 0 cB to 0 0 dB Sub Frequency 40Hz to 200Hz and Full Selected subwoofer crossover frequency and below will be directed to subwoofer output Sub Trim 12 0 dB to 0 0 dB Subwoofer trim allows exact volume matching of the subwoofer level to the main speaker level SOURCE SETU
17. a When the power supply cord or plug is damaged b If liquid has been spilled or objects have fallen into the product c lf the product has been exposed to rain or water d Ifthe product does not operate normally by following the operating instructions Adjust only those controls that are covered by the operating instructions as an improper adjustment of other controls may result in damage and will often require extensive work by a qualified technician to restore the product to its normal operation e Ifthe product has been dropped or damaged in any way f When the product exhibits a distinct change in performance this indicates a need for service 22 Replacement Parts When replacement parts are required be sure the service technician has used replacement parts specified by the manufacturer or have the same characteristics as the original part Unauthorized substitutions may result in fire electric shock or other hazards IMPORTANT SAFETY INSTRUCTIONS 23 Battery Disposal When disposing of used batteries please comply with governmental regulations or environmental public instruction s rules that apply in your country or area 24 Safety Check Upon completion of any service or repairs to this product ask the service technician to perform safety checks to determine that the product is in proper operating condition 25 Wall or Ceiling Mounting The product should be mounted to a wall or ceiling only as recommended by the
18. able devices COMPUTER e Asynchronous USB 24 bit 192 kHz input assures lowest jitter for best musical performance e Using Type A to Type B cable connector not supplied interface computer audio to this asynchronous Type B USB input to directly stream 24 192 PCM content from your PC or MAC e Ensure that the Sound or Audio device setting of your computer is set to NAD USB Audio MINIMUM PC SYSTEM REQUIREMENT Microsoft Windows XP Service Pack 2 or higher Microsoft Windows 7 FOR MAC USERS Minimum Mac OS X Snow Leopard version 10 6 and later versions NOTE Download and install to your PC the NAD USB Audio driver from the Manuals Downloads tab of the NAD web address http nadelectronics com products masters series M 12 Digital Preamp DAC NAD M12 6 DIGITAL USB BACK e Connect a USB mass storage device to this input Typical USB mass storage devices compatible with M12 include portable flash memory devices and external hard drives FAT32 formatted e Refer also to the item about LISTENING TO USB DEVICE at the OTHER FEATURES section of the OPERATION page ANALOG PRE OUT SUB e These output terminals have dual function They are used either as ANALOG PRE OUT or SUBWOOFER terminals e Always turn OFF the M12 and associated external devices before connecting or disconnecting anything to the ANALOG PRE OUT SUB sockets ANALOG PRE OUT e The ANALOG PRE OUT sockets can be used to drive an additiona
19. amplifiers and active loudspeakers Overall 24 bit accuracy is guaranteed by the 35 bit data path with 24 bit coefficients and 62 bit accumulation which is dithered back to 35 bits after DSP functions And because of the super high resolution even 24 bit files are processed without truncation or loss of information As with all our products NAD s Music First design philosophy guided the M12 s design The M12 delivers a range of genuinely useful options using powerful OTHER FEATURES 6 2002 cucu dese eeduredeeeatieieecnsawisasesewn 14 SBN ODE rE E eaadh bare aeRe s pen vsaas EES 14 LIS FE NING IOUSE DEVICE orri i errero s eves sees FITE LE AREON ti 14 Ae Cael ee eile eran eee tee eer in E rrr 14 USING THE HTRM 2 REMOTE CONTROL eeeeeeeeeeee 15 CONTROLLING THEW vecteiseycaveresseindepeswuexereseera xen 15 LEARNING CODES FROM OTHER REMOTE ois cevinay anne cheer aiei 16 PUNCH THROUGH ccnsacesseenseeetavetioesssersnerdsdeeaseesacer 16 COPY A COMMAND FROM ANOTHER KEY 1 0avsosariami ena eines 16 MACRO COMMANDS 2 2c shacanteteiersnteetiacabdeutacebdese acs 16 REY ILLUMINATION TIMEOUT cveccksceiieeen versiones septsenrsaeens 17 CONFIGURING IRE FILLUMINATION cscessmuesvecksaueasneksemexoaeas 17 Pe UCI NG el e r a ete suites bane ices 17 DELETE MO OE r er ane eer ner reece oper eer ers Ree re rer nee ee ere 17 ADNOT ODE LIBRARIE Ss ceehvenstendstes E E EE ewer 18 E AO E a E E rer Teer tere reer ree 18 CHECKING CODE LI
20. d level after saving the setting Audio output level through ANALOG AUDIO OUTPUT will not change when using the Volume control or HTRM 2 s VOL A V e At Fixed Level setting the volume control or HTRM 2 s VOL A V will have no effect and effectively disabled Variable e When set to Variable audio output level through ANALOG AUDIO OUTPUT is directly adjustable using the volume control or HTRM 2 s VOL A V li Name Source input name Selecting this line item will lead to the menu keyboard where one can type the preferred name for the current source Shift z Backspace Cancel Save If the BALANCED input is selected additional menu options are included as below Main Enabled ON amp Name Balanced Volume Control Variable Analog Gain 6 0dB Back OPERATION USING THE M12 Analog Gain 12dB to 12dB Gain adjustment allows all sources to play back at the same volume level so you don t need to adjust the volume every time a new source is selected It is generally preferable to reduce the level of the loudest source rather than making louder the softer sources DIGITAL OUTPUT Main Cole an i Sample Rate SAMPLE RATE 48 kHz 96 kHz 192 kHz Select the user s preference for sample rate of the A D Converter Higher sampling rates allow for anti aliasing filters to take effect further outside the audible frequency range and are generally considered to sound better especially in the high freq
21. de to operating mode This wait time can be bypassed by turning OFF ON the rear panel power switch and then press Standby button IDENTIFICATION OF CONTROLS FRONT PANEL 1 STANDBY e Press Standby button for the M12 to be switched ON from standby mode The Power indicator will turn from amber to bright white color e Pressing Standby button again switches back M12 to standby mode The Power indicator will illuminate to amber color at standby mode e The Standby button cannot activate the M12 with the rear panel POWER switched off IMPORTANT NOTES e Refer also to 12V TRIGGER IN OUT in IDENTIFICATION OF CONTROLS REAR PANEL e Forthe Standby button to activate two conditions must be completed a Plug in the supplied mains power cord to a mains power source Connect corresponding end of the mains power cord to the AC mains input of M12 and the plug connected to a mains power source b The rear panel POWER switch must be set to ON position 2 POWER INDICATOR e This indicator will light up amber when the M12 is at standby mode e When the M12 is powered up from standby mode this indicator will turn from amber to bright white color 3 REMOTE SENSOR t IOs a E e Point the HTRM 2 remote control at the remote sensor and press the buttons e Do not expose the remote sensor of the M12 to a strong light source such as direct sunlight or il
22. e remote will step through all the available codes at a rate of approximately 1 per second When the component turns off immediately release the cursor key press ENTER to accept that code library and exit the Library Mode Try a few commands should you prove to have stepped past the needed code library re enter the Library Mode and use the cursor key to step back to it NOTE It is possible that search mode will find code libraries that operate at least partially some other brand non NAD components You may certainly exploit such capabilities as you find them However since we can only ensure the completeness or accuracy of NAD code libraries we cannot support the HTRM 2 s operation with other brand components CHECKING CODE LIBRARY NUMBER You can check the current code library on any Device Selector key as follows Enter Library Mode by simultaneously pressing and holding for 3 seconds both the desired component s Device Selector key and the A V PSET key until the Learn LED turns green Press the DISP key the HTRM 2 indicates the current code library by flashing its DAC CUSTOM and MACRO keys For example to indicate code library 501 the HTRM 2 will flash DAC 5 times pause and then flash MACRO once You might wish to make a note of your components code library numbers SUMMARY OF THE HTRM 2 MODES Mode Keys To Press for 3 seconds Learn Copy Punch Through Device Key RES Key Delete Mode Device K
23. ed as recorded e Multi channel digital recordings Dolby Digital and DTS are reproduced in Stereo Downmix mode via the left and right speakers only MONO e Use Mono listening mode when the audio source format is mono The mono information is replicated on both left and right channels e Mono listening mode is recommended when watching old movies with mono soundtrack listening to recorded monaural sound sources such as AM radio broadcasts or with the foreign language soundtracks recorded in the left and right channels of some movies e Mono is also very helpful when setting up a stereo system to check that both speakers are connected with correct polarity Correctly connected speakers will have a solid center image and strong bass response If one speaker has the input connections and reversed the image will be indistinct and the bass will be reduced and uneven sounding REVERSED e Sends the right channel to the left speaker and the left channel to the right speaker This can easily correct a reversed input connection or incorrectly recorded music source POLARITY Allow compensation for recordings that have reversed polarity e Positive A positive sine wave at the input remains positive at the output Polarity is defaulted to Positive setting e Negative A positive sine wave at the input is negative inverted or reversed at the output 11 OPERATION USING THE M12 EQ Main Tone Controls
24. esult to a return to the factory default IR Channel 0 setting 14 USB MODE The M12 is equipped with three USB input terminals USB Front USB Back and Computer Using either USB Front or USB Back the M12 can play back MP3 WMA FLAC files stored in external USB Universal Serial Bus mass storage devices Use Computer to interface computer audio and directly stream 24 192 PCM content from your PC or MAC DIGITAL USB FRONT DIGITAL USB BACK USB TYPE A e Supports playback of MP3 WMA and FLAC files MP3 WMA 48 kHz FLAC 24 bit 48 kHz e FAT12 16 root directory up to 256 files short names e FAT12 16 32 up to 65535 files short names per directory e FAT file system limited to 2TB e File and directory names limited to 64 characters e Upto 16 maximum level of directories e Compatible with USB version 1 1 and later COMPUTER USB TYPE B e Supports 24 bit 192 kHz PCM content from PC or MAC NOTE Typical USB mass storage devices compatible with M12 include portable flash memory devices and external hard drives FAT32 formatted LISTENING TO USB DEVICE 1 Toggle A SKIP CH SOURCE V button to select USB Front or USB Back source mode If no external USB mass storage device is connected to USB Front or USB Back input Please Insert Device will be shown in the touch panel display If the connected USB mass storage device does not contain any applicable MP3 WMA FLAC files No files will be show
25. ey RTN Key Macro Record Macro Key Function Key Library Mode Device Key A V PSET Key Back Light Timeout DISP Key Digit Key Factory Reset See Factory Reset above BATTERY INSTALLATION 1 Use the flat or rounded end of a pointed tool to push open the pin of the battery cover P P 2 Open the battery hatch 5 Restore the battery cover OPERATION USING THE HTRM 2 REMOTE CONTROL 19 REFERENCE TROUBLESHOOTING CONDITION No USB audio Remote control s VOL A V no function Remote control s MUTE no function Cannot power ON the M12 Touch panel display is dim M12 does not respond to remote control commands 20 POSSIBLE CAUSES e NAD USB Audio is not installed in your PC Sound or Audio device setting of your PC or Mac is not set to NAD USB Audio e No music files being played back from your PC or Mac gt Volume Control is set to Fixed e Rear panel POWER switched off e Low brightness level of display is selected Batteries are flat or incorrectly inserted Infrared receiver IR window of M12 or IR transmitter of the remote control is obstructed e M12 front panel is in very bright sunlight or ambient light POSSIBLE SOLUTIONS Download NAD USB Audio driver from NAD website and install to your PC e Set your PC or Mac Audio or Sound device setting to NAD USB Audio e Playback a music file from your computer
26. g mode NOTE The copy and punch through functions are similar However if you copy acommand and then subsequently delete or over write the original source key command the copied to key s command remains unchanged If you punch through to a command and then delete or over write the original key the punched through functions also change accordingly MACRO COMMANDS A macro command is a series of two or more remote codes issued automatically from a single keypress You might use a macro to automate a simple command sequence such as Turn on the BD player and then press PLAY Or you might compose an elaborate macro to power up an entire system select a source choose a Listening Mode and begin playback again all from a single keypress Each DEVICE SELECTOR and function keys of the HTRM 2 can be stored one macro NOTE Macros are independent of the currently selected device RECORDING MACROS To record a macro simultaneously press and hold for 3 seconds both the MACRO key and the HTRM 2 function key to which you wish to assign the macro until the status LED turns green The macro button will also light up Press the sequence of function keys to be recorded into the macro being sure to first press the requisite Device Selector key for each function you may switch devices while recording the macro as many times as necessary allowing you to create macro containing commands from more than one Device Selector page
27. ins plug should be disconnected from the mains socket outlet completely Battery shall not be exposed to excessive heat such as sunshine fire or the like CAUTION Danger of explosion if battery is incorrectly replaced Replace only with the same or equivalent type An appliance with a protective earth terminal should be connected to a mains outlet with a protective earth connection IF INDOUBT CONSULT A COMPETENT ELECTRICIAN C This product is manufactured to comply with the radio interference requirements of EEC DIRECTIVE 2004 108 EC NOTES ON ENVIRONMENTAL PROTECTION At the end of its useful life this product must not be disposed of with regular household waste but must be returned to a collection point for the recycling of electrical and electronic ME equipment The symbol on the product user s manual and packaging point this out The materials can be reused in accordance with their markings Through re use recycling of raw materials or other forms of recycling of old products you are making an important contribution to the protection of our environment Your local administrative office can advise you of the responsible waste disposal point RECORD YOUR MODEL NUMBER NOW WHILE YOU CAN SEE IT The model and serial number of your new M12 are located on the back of the cabinet For your future convenience we suggest that you record these numbers here NAD is a trademark of NAD Electronics International a div
28. ision of Lenbrook Industries Limited Copyright 2014 NAD Electronics International a division of Lenbrook Industries Limited INTRODUCTION TABLE OF CONTENTS IMPORTANT SAFETY INSTRUCTIONS ccccccccccccccceed INTRODUCTION GETTING STARTED wcicecicdteavdvctneeinneks nssanseeee es eas edien s 5 Wa UN IUFIE E E EE erence E 5 CHOOSING A LOCATION sscitevcsuentdevatvanstevaserentggaseres dares gt RESTORING M12 TO ITS FACTORY DEFAULT SETTINGS 0 5 IDENTIFICATION OF CONTROLS FRONE PANEL cs cscoastneiesnseesedene tare taewacesesseetecesseaaes 6 REAR PANEL scssusssocssseeus teabweew Venere sseauatansaseseusnd eas 7 OPERATION USING THE WZ icctcweoesandedsusdawsdaseeeacadbesiteciedet tdasas 9 NAVIGATING THE M12 FEATURES AND MAKING CHANGES 9 DISPLACE OP N rri iaei 11 DIP h E E EE EET EE ETE 11 ee OTTE TT ETSE ET SETT TET 11 WO EE E E ET 11 a Eea EE A E EE news E E ace EENET 12 TTU E crea teks E ANERE AAE E E AEE eee 12 ERRER Srl tac oneeene AE E 12 SOURCE SEU i sedisospsbedsseecsbedsteeurtelacesontedaceesseede cee 12 Ee OS 5 ac oiexainw arses eeu ex EEE ESS 13 ee E E E 13 THANK YOU FOR CHOOSING NAD The M12 Digital Preamp DAC is a technologically advanced and highly capable product yet we have invested great effort in making it simple and easy to use The M12 is an ultra high resolution digital audio hub that interfaces to musical sources and renders the digital or analog source perfectly to power
29. l amplifier Use a dual RCA cable to connect ANALOG PRE OUT to the corresponding analog audio input of compatible devices such as amplifiers receivers or other applicable devices e ANALOG PRE OUT will be affected by the M12 s volume control settings Rotate the VOLUME control to adjust the output level of the ANALOG PRE OUT sockets SUBWOOFER e Use a dual RCA cable to connect SUB to the low level input of a powered subwoofer e Low frequency information up to 200HZ is sent to the connected subwoofer via SUBW1 or SUBW2 DIGITAL OUT COAXIAL OPTICAL e Connect DIGITAL OUT optical or coaxial to the corresponding digital audio input of compatible devices such as receivers computer soundcard or other digital processors IDENTIFICATION OF CONTROLS REAR PANEL 9 12V TRIGGER OUT e The 12V TRIGGER OUT is used for controlling external equipment that is equipped with a 12V trigger input e Connect this 12V TRIGGER OUT to the other equipment s corresponding 12V DC input jack using a mono cable with 3 5mm male plug e This output will be 12V when the M12 is at operating mode and OV when the unit is either OFF or in standby mode 12V TRIGGER IN Connect this 12V Trigger input to the remote device s corresponding 12V DC output jack using a mono cable with 3 5mm male plug The controlling device must be equipped with a 12V trigger output to use this feature e With this input triggered by a 12V DC supply the M1
30. lumination If you do so you may not be able to operate the M12 with the remote control Distance About 23ft 7m from the front of the remote sensor Angle About 30 in each direction of the front of the remote sensor NAD M12 4 DISPLAY TOUCH PANEL DISPLAY Show visual and menu information according to the display settings selected The following display options are accessible via the touch panel display Main Media Mode EQ and Setup Use your finger to press and select any of these display options to show their corresponding menu options or settings 5 VOLUME The VOLUME control adjusts the overall loudness of the signal being fed to the loudspeakers Volume control is characterized by perfect signal tracking and channel balance It gives a highly linear and low noise operation Turn clockwise to increase the volume level counter clockwise to lower it The default volume level is 20dB 6 DIGITAL USB FRONT Connect a USB mass storage device to this input Typical USB mass storage devices compatible with M12 include portable flash memory devices and external hard drives FAT32 formatted Refer also to the item about LISTENING TO USB DEVICE at the OTHER FEATURES section of the OPERATION page IDENTIFICATION OF CONTROLS REAR PANEL vA COMPUTER COAX 1 r OPTICAL2 OPT
31. manufacturer WARNING The lightning flash with arrowhead symbol within an equilateral triangle is intended to alert the user to the presence of uninsulated dangerous voltage within the product s enclosure that may be of sufficient magnitude to constitute a risk of electric shock to persons The exclamation point within an equilateral triangle is intended to alert the user to the presence of important operating and maintenance servicing instructions in the literature accompanying the appliance CAUTION RISK OF ELECTRIC SHOCK DO NOT OPEN CAUTION TO REDUCE THE RISK OF ELECTRIC SHOCK DO NOT REMOVE COVER OR BACK NO USER SERVICEABLE PARTS INSIDE REFER SERVICING TO QUALIFIED SERVICE PERSONNEL THE EQUIPMENT MUST BE CONNECTED TO AN EARTHED MAINS SOCKET OUTLET CAUTION REGARDING PLACEMENT To maintain proper ventilation be sure to leave a space around the unit from the largest outer dimensions including projections than is equal to or greater than shown below Left and Right Panels 10 cm Rear Panel 10 cm Top Panel 10 cm FCC STATEMENT This equipment has been tested and found to comply with the limits for Class B digital device pursuant to Part 15 of the FCC Rules These limits are designed to provide reasonable protection against harmful interference in a residential installation This equipment generates uses and can radiate radio frequency energy and if not installed and used in accordance with the i
32. mple setup of two NAD products on the same Zone M12 and T 787 are both defaulted to IR Channel 0 If OFF button is pressed on the HTRM 2 remote control or HTR 8 remote control for the T 787 both products will go to standby mode Press ON and both products will power up from standby mode To prevent both products from simultaneously going in and out of standby mode along with other common commands set each one to a different IR channel In this setup we will keep T 787 and HTR 8 remote control defaulted to IR Channel 0 As for M12 we will assign it to IR Channel 1 the same applies to HTRM 2 Set M12 and HTRM 2 to IR Channel 1 via the following procedure M12 e Select 1 as the IR Channel setting of the M12 HTRM 2 Begin by ensuring that the M12 is powered up on not merely in standby 1 Press and hold together the AMP and A V PSET buttons until the Learn LED located between HTRM 2 s ON and OFF buttons turns steady green Release both buttons 2 While keeping the HTRM 2 pointed towards M12 press 1 1 0 and 0 using HTRM 2 s numeric buttons 3 Press OFF If the M12 goes to standby mode this indicates that the library input is successful 4 Press ENTER to accept the library code input and exit the Library mode With both M12 and HTRM 2 set to IR Channel 1 the M12 can now be remotely controlled independent of the T 787 NOTE Performing a Factory Reset for HTRM 2 will r
33. n that particular command of that source remote command could not be learned Example Learning BD Pause Position the HTRM 2 and your BD player s remote as described above e Onthe HTRM 2 simultaneously press and hold BD and RES the Learn LED turns steady green e Press the HTRM 2 s Pause II key the Learn LED turns amber e Press and hold the corresponding Pause key of your BD player s remote control the HTRM 2 s Learn LED flickers amber and then turns solid green The command is learned e Press BD again to exit the learning mode NOTES e The DEVICE SELECTOR keys can themselves be configured to learn a command e Press and hold a configured DEVICE SELECTOR for at least 2 seconds to execute a function assigned to the particular DEVICE SELECTOR key e Short press of a configured DEVICE SELECTOR will just switch the active device CANCEL OPERATION You can cancel configuring a key by pressing the active Device Selector key before the learn process is complete the Learn LED will turn red PUNCH THROUGH The HTRM 2 s ounch through function allows you to retain a function key from one Device Select page to another so that for example the AMP SURR MODE function might still control the M12 when the BD Device Selector page is active NOTE The HTRM 2 s VOL A V keys are pre programmed as punched through for all Device Selector pages VOL A V will operate the M12 s master volume regardless
34. n in the touch panel display 2 Plug in the external USB mass storage device to the USB input MP3 WMA or FLAC files or folders will be shown in the touch panel display 3 Use lt gt A V to select through the files or folder Press ENTER to start playback of selected file Ensure that HTRM 2 s Device Selector is set to MP when using the following USB playback buttons II lt gt gt RANDOM REPEAT DISP W button is not applicable for USB playback IMPORTANT NOTICE Do not disconnect the USB mass storage device during playback as it may damage the M12 LISTENING TO COMPUTER Use Type A to Type B cable connector to directly stream 24 192 PCM content from your PC or MAC to the M12 Ensure that the Sound or Audio device setting of your computer is set to NAD USB Audio MINIMUM PC SYSTEM REQUIREMENT Microsoft Windows XP Service Pack 2 or higher Microsoft Windows 7 FOR MAC USERS Minimum Mac OS X Snow Leopard version 10 6 and later versions OPERATION USING THE HTRM 2 REMOTE CONTROL The NAD HTRM 2 is ready to operate the M12 right out of the box but it is really eight remotes in one Each of the 8 Device Selector keys at the top of the handset can call up a new page of remote control codes to be transmitted by the remaining keys You may teach codes from any infrared remote controlled component regardless of brand to any or all of these Obviously the most logical system is that you teach the c
35. nd cart combination should be moved N with care Quick stops excessive force and uneven surfaces ela may cause the product and cart combination to overturn 10 Ventilation Slots and openings in the cabinet are provided for ventilation to ensure reliable operation of the product and to protect it from overheating These openings must not be blocked or covered The openings should never be blocked by placing the product on a bed sofa rug or other similar surface This product should not be placed in a built in installation such as a bookcase or rack unless proper ventilation is provided or the manufacturer s instructions have been adhered to 11 Power Sources This product should be operated only from the type of power source indicated on the marking label and connected to a MAINS socket outlet with a protective earthing connection If you are not sure of the type of power supply to your home consult your product dealer or local power company 12 Power Cord Protection Power supply cords should be routed so that they are not likely to be walked on or pinched by items placed upon or against them paying particular attention to cords at plugs convenience receptacles and the point where they exit from the product 13 Mains Plug Where the mains plug or an appliance coupler is used as the disconnect device the disconnect device shall remain readily operable 14 Outdoor Antenna Grounding f an outside antenna or cable system is c
36. nstructions may cause harmful interference to radio communications However there is no guarantee that interference will not occur in a particular installation If this equipment does cause harmful interference to radio or television reception which can be determined by turning the equipment off and on the user is encouraged to try to correct the interference by one or more of the following measures e Reorient or relocate the receiving antenna e Increase the separation between the equipment and receiver e Connect the equipment into an outlet on a circuit different from that to which the receiver is connected e Consult the dealer or an experienced radio TV technician for help CAUTION Changes or modifications to this equipment not expressly approved by NAD Electronics for compliance could void the user s authority to operate this equipment CAUTION To prevent electric shock match wide blade of plug to wide slot fully insert CAUTION Marking and rating plate can be found at the rear panel of the apparatus WARNING To reduce the risk of fire or electric shock do not expose this apparatus to rain or moisture The apparatus shall not be exposed to dripping or splashing and that no objects filled with liquids such as vases shall be placed on apparatus Mains plug is used as disconnect device and it should remain readily operable during intended use In order to disconnect the apparatus from the mains completely the ma
37. odes from your BD player to the BD Device o Selector page your television s codes to the TV page and so on but there is no required scheme You may load any commands to any key on any page see Learning Codes From Other Remotes caine aia below The HTRM 2 is already preprogrammed with a full complement of commands for the M12 on its AMP Device Selector page and as well as with library commands to operate most NAD brand CD BD or DAC components on the corresponding Device Selector pages These default commands are permanent Even if you teach the HTRM 2 new commands to take their place the underlying library commands remain in place and can easily be recalled should you add an NAD component to your system later see Delete Mode below Note For use with the M12 it should not be necessary to re program any keys on the HTRM 2 AMP page However in order for the HTRM 2 to control your specific NAD brand components you may need to load one or more different code libraries see Loading Code Libraries below CONTROLLING THE M12 The HTRM 2 is divided into two main sections Eight Device Selector keys at the top AMP MP TV and so on set the handset s remaining keys to a page of commands to control a particular component A Device Select key determines only what component the HTRM 2 will commana it does not perform any function on the M12 All of the remaining keys are function keys that can
38. on with any key press DISP ON Enable light sensor DISP ENTER Set the light sensor threshold to the current light level DISP RTN Restore all key illumination settings to the defaults OPERATION USING THE HTRM 2 REMOTE CONTROL FACTORY RESET The HTRM 2 can be reset to its factory state deleting all learned commands copied and punched through keys macros and other setup information reverting all keys to their pre programmed library commands To perform a factory reset simultaneously press and hold for 10 seconds the HTRM 2 s ON and RTN keys the Learn LED will start to flash green Release ON and RTN before the second flash is complete the Learn LED will turn red indicating the remote has been reset NOTE You must release ON and RTN before the second flash goes out otherwise the unit will not reset should this occur repeat the full procedure DELETE MODE The HTRM 2 can store learned copied and default library commands on any single key The default library commands are the pre programmed NAD codes such as the native M12 commands on the AMP page You can delete commands by layers back down to the default library command on any key removing learned commands punched through functions and copied keys NOTE The default library commands cannot be deleted so you need not worry that using Delete Mode might cause irreparable changes To enter Delete Mode simultaneously pres
39. onnected to the product be sure the antenna or cable system is grounded so as to provide some protection against voltage surges and built up static charges Article 810 of the National Electrical Code ANSI NFPA 70 provides information with regard to proper grounding of the mast and supporting structure grounding of the lead in wire to an antenna discharge unit size of grounding conductors location of antenna discharge unit connection to grounding electrodes and requirements for the grounding electrode NOTE TO CATV SYSTEM INSTALLER This reminder is provided to call the CATV system installers attention to Section 82040 of the NEC which provides guidelines for proper grounding and in particular specifies that the cable ground shall be connected to the grounding system of the building as close to the point of cable entry as practical bt p GROUND CLAMP N SI A a tle A POWER LINES KF SERVICE 7 ENTRANCE CONDUCTORS STAND OFF INSULATORS P ye a MAST ANTENNA D LEAD IN WIRE gt SERVICE ENTRANCE ip EQUIPMENT GROUND CLAMPS GROUND WIRE gt y ie ANTENNA DISCHARGE SI UNIT C GROUND 7 POWER SERVICE GROUNDING Ba WIRE amp b Ta EXTERNAL ELECTRODE SYSTEM a P e g Interior metal water pipe BONDING JUMPER NTENNA GROUND TERMINALS CLAMPS OF PRODUCT OPTIONAL ANTENNA GROUND ING ELECTRODE DRIVEN 8 FEET 2 44M INTO THE EARTH IF REQUIRED BY LOC
40. ound terminal After insertion tighten the terminal to secure the lead NOTES The above illustration shows the M12 being connected to ground via a metal water pipe There maybe other grounding conductor points in your home Consult with a licensed electrician to properly locate or correctly install a grounding conductor in your home NAD is not responsible for any malfunction damage or costs associated with the installation connection or grounding of your M12 The grounding wire is not supplied with your M12 17 FUSE HOLDER e Only qualified NAD service technicians can have access to this fuse holder Opening this fuse holder may cause damage thus voiding the warranty of your M12 18 AC MAINS INPUT e TheM12 comes supplied with two types of detachable mains power cord Connect corresponding end of the mains power cord to the AC mains input of M12 and the plug connected to a mains power source e Always disconnect the mains power plug from the mains power source first before disconnecting the cable from the M12 s AC Mains input socket OPERATION USING THE M12 NAVIGATING THE M12 FEATURES AND MAKING CHANGES Use the HTRM 2 or applicable touch panel display items to select Sources navigate through the M12 features and access to other functions The following are some of the key functions FEATURE FUNCTION ITEM TOUCH PANEL DISPLAY HTRM 2 Selecting Sources SKIP CH SOURCE Access menu options Main Mode EQ
41. p Guide SAVE THE PACKAGING Please save the box and all of the packaging in which your M12 arrived Should you move or otherwise need to transport your M12 this is by far the safest container in which to do so We ve seen too many otherwise perfect components damaged in transit for lack of a proper shipping carton so please Save that box CHOOSING A LOCATION Choose a location that is well ventilated with at least several inches to both sides and behind and that will provide a clear line of sight within 25 feet 8 meters between the M12 s front panel and your primary listening viewing position this will ensure reliable infrared remote control communications The M12 generates a modest amount of heat but nothing that should trouble adjacent components It is perfectly possible to stack the M12 on top of other components but the reverse usually should be avoided INTRODUCTION GETTING STARTED RESTORING M12 TO ITS FACTORY DEFAULT SETTINGS AL 1 Press and hold front panel s Main display Mode EQ Setup 2 Select Factory Reset display option Info USB Factory Reset Q 3 Select Yes to reset your M12 to factory default settings or No if you decide not to reset your M12 Info Mode EQ Setup Factory Reset Yes No 4 Factory reset is complete when the M12 goes to standby mode IMPORTANT NOTE After factory reset wait out for at least one minute to switch back the M12 from standby mo
42. s and hold for 3 seconds both the desired key s Device Selector key and the RTN key until the Learn LED turns green Press the function key whose command you wish to delete the Learn LED flashes the number of times indicates which type of function has become active see the table below Press the active Device Selector key again to exit Delete Mode NOTE You may delete multiple function key commands on the same Device Selector page but to delete from more than one Device Selector page you must exit Delete Mode and then re enter it on the required page Flashes Command Type 1 Default Library Command 2 Copied Library Command 3 Learned Command 17 OPERATION USING THE HTRM 2 REMOTE CONTROL LOADING CODE LIBRARIES The HTRM 2 can store a different library of default NAD codes for each of its Device Selector pages If the original default library does not control your NAD CD player tape deck BD player or other component follow the procedure below to change the code library Begin by ensuring that the component you wish the HTRM 2 to control is plugged in and powered up on not merely in standby To enter the HTRM 2s Library Mode simultaneously press and hold for 3 seconds both the desired Device Selector key and the A V PSET key until the Learn LED turns green While keeping the HTRM 2 pointed toward the component enter the first appropriate three digit code library number from the table below Press O
43. second delay is automatically inserted between its commands If you need more than a 1 second delay between particular commands for example to permit a component to power up completely you can record empty steps into the macro by changing Device Selector pages without entering actual command functions KEY ILLUMINATION TIMEOUT The HTRM 2 s key illumination can be set to remain lit for 0 9 seconds The default value is 2 seconds To set the illumination timeout simultaneously press and hold for 3 seconds both the HTRM 2 s DISP and the 0 9 key with the digit corresponding to the desired timeout duration the Learn LED will flash twice to confirm the new setting When set to zero the illumination will not turn on at all NOTES e Key illumination is activated when one presses any HTRM 2 key IfHTRM 2 senses movement key illumination is activated without having to press a key If HTRM 2 is shaken key illumination is also activated e Key illumination is the biggest drain on the HTRM 2 s batteries A short key illumination timeout will extend battery life appreciably turning it off altogether set it to 0 seconds will lengthen it still further CONFIGURING KEY ILLUMINATION Keys to Press for 3 seconds Mode DISP Digit Key 0 9 Set key illumination timeout to number of seconds corresponding to digit key Zero turns off the key illumination entirely DISP OFF Disable light sensor Key illumination will turn
44. to MP or repeat off Return to previous menu or display Main Mode EQ ee Ce ee Sample Rate Next previous level function option etc Main EQ Setup Mode Mono Polarity Negative While at current menu display use A V to highlight option Main EQ Setup Mode Mono Polarity Negative ote Use lt 1 to select or toggle through applicable options levels functions etc Cycle through Power indicator brightness we Se we levels O DIMMER DEVICE SELECTOR must be set to AMP Temporarily mute audio output or restore VUE audio from mute mode AR SKIP CH _ RANDOM MUTE Any DEVICE SELECTOR setting VOL 10 DISPLAY MENU OPTIONS The following display options are accessible via the touch panel display Main Media Mode EQ and Setup Below are sample screenshots of these options along with descriptions of applicable functions or features MAIN Main Mode EQ Setup Coax 1 gt ACM Or Coax 1 48k Mono Negative Tone Balance Sub Stereo LPF 200Hz HPF 200Hz Coax 1 Current Source 20 0 dB Volume level Go to previous or next Source 48k Sample rate Mono Listening mode Negative Polarity setting Tone Tone control settings enabled Balance Balance settings enabled Sub Stereo Subwoofer mode setting LPF 200Hz HPF 200Hz Subwoofer frequency setting MEDIA Media becomes accessible only when the selected Source is USB Front or USB
45. uencies CONTROL SETUP Main Auto Standby IR Channel AUTO STANDBY Allows the option of the M12 going to standby mode after 30 minutes of inactivity or remain at operating mode regardless of any source activities ON M12 will automatically go to standby mode if there are no user interface interaction and no active source within 30 minutes OFF M12 remains at operating mode even if there is no user interface interaction and no active source within 30 minutes This is the default setting 13 OPERATION OTHER FEATURES IR CHANNEL The M12 has the capability to operate via Alternate IR channel This is practically useful if you have two NAD products that can be operated by similar remote control commands With alternate IR Channel two different NAD products can be controlled independently in the same zone by setting each one to a different IR channel IR Channel Assignment The M12 and the HTRM 2 remote control must be set to the same channel To change the IR Channel on the HTRM 2 remote control e Include a channel number before the library code For HTRM 2 library code 100 is the default library table for AMP device To select this AMP library table for IR Channel 0 retain the library code 100 e lf you want to load the AMP library table on IR Channel 1 prefix the library code with 1 to indicate association with IR Channel 1 Load then the AMP library table using the code 1100 Sa

Download Pdf Manuals

image

Related Search

Related Contents

Intel SE7501BR2 - Boxed Server Board "BRYSON"    PRO 48 - Multyflex  Eclipse Service Manual  JACUZZI MANUAL DE USO E INSTALACIÓN  US3-4PEX 取扱説明書  INSTALLATION MANUAL  表紙 - ビーイズム  SLM-3701_Booklet Manual Spanish - Superex  

Copyright © All rights reserved.
Failed to retrieve file