Home

Additional User guide/upgrade information.

1. E 74 SR MODA an m 75 bas OUMU ADDICOIIOHS doses quictt ood dericEa uu do coad ores tEcoON INO nee ee eee oe er 76 TA agi I E EPER 76 OMA RPO Ce E 76 A EPUM 76 6 3 AVEVA Administration 1 4 0 0 0 0 cccccccsseeeeeeeeeeeeseeceeeeessssssnseeeeeeeeeeeeseseaooogaasssssssseeeeeeeesessseeaooaoaas 77 6 3 1 New Database FNC NER TETTE 78 ops pam DW 118 6 0 gt ae eo een eee ee ee eee 78 63 3 Dynamic Dadlabase SEIS siosan EEE o e Ra re A E 78 6 3 4 Multi write Dictionary amp Property Databases sesessseseeeeeeennnnenem nee 78 D39 FISK EIO G Le ceeded brian o dodised cmtei dal temet r 78 SMILIES CNRC IE 78 0d AVEVA CGDIS 2 p iar 79 6 5 AVEVA Clash Manager 12 1 nnnnannnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn ennnen ennnen nnmnnn nnne 79 CE E e A E E E E E ON EE E E A E E 81 7 1 Use of PML amp C in AVEVA E3D 2 1 nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn nnmnnn nnmnnn 81 7 2 General Considerations EET 81 7 2 1 EVONA 7216 219 E OT Emm 81 T 242 PNMLELB PMEUl and CAF UIC PATER Path uioiitusuciter ni edite hate eUvERRHawsuc utu R eda uim rat eain 82 Rr 83 La Ponns S MODUS usce eects dose
2. D The data was captured during a project to survey the Eaton Training Centre in Houston utilizing the latest laser scanning technology from Dot Product FARO Leica Riegl Trimble and Z F The various datasets have been prepared for consumption using LFM Software technology the only laser scan data processing solution available that is able to combine such a broad selection of data formats into a single dataset AVEVA and LFM would like to thank Eaton for granting permission to utilize this data with our customers Eaton s training facility focuses on industrial applications with over 5000 products installed on the mock up site and is available for a variety of training applications year round Copyright 2015 19 AVEVA Solutions Limited and its subsidiaries WWW aveva com All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide 2 9 AVEVA Everything3D Documentation 2 1 The AVEVA E8D 2 1 documentation includes the AVEVA Administration Catalogue and Global product user guides Documentation is available online so that it may be continually updated and remain current for any new functionality introduced through the life of the product AVEVA Documentation 2 1 may also be downloaded separately for local installation here The documentation may be accessed via the top of the main product window via the Project tab or via the context sensitive F1 key The Documentation is presented via a Help V
3. The following sections will explain the transformation process in greater detail 5 2 1 Sheets Before a Sheet can be viewed or modified by an E3D Draw user it must be transformed 4 3i REGI Stabilizer General 4 DRWG STABO0001 gt lg SHEE STAB00001 S1 Cte ee Prior to transformation the Sheet is displayed in the Draw 4 Gy DRWG STAB00002 m da NA HEC cL DURO Explorer with a grey icon to indicate that it is an untransformed F3 LiBv srABDODO2 LIBY sheet 4 DRWG STABOO003 gt Ph SHEE STABODOD3 S1 gt LIBY STABOODOSI LIBY A Sheet transformation can be made on the fly or via a bulk transformation through the Draw Administration User Interface or by using a designated command 5 2 1 1 On the fly Transformation On opening an untransformed Sheet in Draw the following message is presented to the user Transform Sheet d This Sheet must be transformed before it can be viewed do you wish to continue PF Note the transformation will only become persistent after a savework the Sheet will then no longer be available in POMS Draft Marine Drafting s On clicking Yes the Sheet is transformed 5 2 1 2 Draw Administration User Interface D a BENE 0005 Sheets may be transformed via the Sheets button in the Transform group of the ra sees ADMIN tab in Draw The action applies to the Current Element and the hierarchy pee below it LH Refresh Overlays The Transformation process is an administration task access to th
4. AVEVA Everything3D 2 1 Migration amp Interoperability Guide d d MUN B AJ N SIR Td N SEN A p n NZD Bg m E E WWwW aveva com AVEVA Everything3D 2 1 Migration amp Interoperability Guide This page is intentionally left blank Copyright 2015 D AVEVA Solutions Limited and its subsidiaries WWW aveva com All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide Revision Log Date Revision Description Author Reviewed Approved 16 10 2015 Issued for Review 27 11 2015 Released with AVEVA E3D 2 1 B E E E mE mmm Updates Change highlighting will be employed for all revisions Where new or changed information is presented section headings will be highlighted Suggestion Problems This manual provides documentation relating to products to which you may not have access or which may not be licensed to you For further information on which products are licensed to you please refer to your licence conditions Visit our website at http www aveva com Disclaimer 1 1 AVEVA does not warrant that the use of the AVEVA software will be uninterrupted error free or free from viruses 1 2 AVEVA shall not be liable for loss of profits loss of business depletion of goodwill and or similar losses loss of anticipated savings loss of goods loss of contract loss of use loss or corruption of data or information any special indirect consequentia
5. Copyright 2015 33 AVEVA Solutions Limited and its subsidiaries WWW aveva com All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide D This reference operation must be done for each installation of the application On opening the Joints or Fitting forms the application will first look within the Company Resources file and if no image is found will proceed to look in the default AVEVA Resource file D If no image is found in a resource file a default image will be displayed blank image 4 1 5 Stairs Ladders amp Handrails It should be noted that there is no utility provided to update SLH Defaults or Assemblies to use the new structural catalogue due to the complex cross referencing of elements Therefore it is recommended that if it is desired to use the new profile catalogue with SLH new Defaults and Assemblies should be created It is possible to manually modify Defaults and Assemblies but this should be approached with caution and contact with AVEVA Support made to go through the process D Specifications associated with the old AVEVA Catalogue have been disabled If the old AVEVA Catalogue is to be used for new SLH elements the relevant Specification will be required to be reactivated by setting the PUHP attribute for the SPEC to STL This will display the identified Profiles in the appropriate SLH forms Copyright 2015 34 AVEVA Solutions Limited and its subsidiaries WWW aveva c
6. MDB ALL id Stamp Fe Copyright 2015 21 AVEVA Solutions Limited and its subsidiaries All rights reserved www aveva com AVEVA Everything3D 2 1 Migration amp Interoperability Guide This page is intentionally left blank Copyright 2015 29 AVEVA Solutions Limited and its subsidiaries www aveva com All rights reserved d AY Y C t 3 MINA VIVE gt r Y Av h a D e yp werd This chapter gives an overview of the process of migrating from AVEVA PDMS and AVEVA Hull amp Outfitting to the new AVEVA ESD 2 1 product The process is slightly different if the two products are used in conjunction on a project in this case it is important that a recent version and Fix release of AVEVA PDMS or Hull amp Outfitting is used AVEVA E3D databases are compatible with PDMS but a number of the enhancements in AVEVA E3D require a minor upgrade to the database schema this means that PDMS must be at version 12 1 SP4 Fix 28 or later D It is recommended that a project backup is created prior to starting any migration process 3 1 Migrating projects from AVEVA PDMS or Hull amp Outfitting 12 0 The following guidance is for those customers who currently utilise PDMS or Hull amp Outfitting 12 0 ona Project this section can be omitted where a Project uses AVEVA PDMS or AVEVA Hull amp Outfitting 12 1 For those customers using AVEVA PDMS 11 6 please refer to the User Bulletin for PDMS 12 0 for full details
7. The following is recommended e In AVEVA PDMS or Hull amp Outfitting 12 1 SP4 Fix 28 or later add a call to the project in the evars bat file D The bat files provided in AVEVA PDMS and Hull amp Outfitting 12 1 SP4 Fix 28 have been set to ensure interoperability with AVEVA E3D 2 1 Any bat files that have been customised need to have a call to set_forward_compatibility bat inserted This bat file contains new environment variables and is stored with the AVEVA E3D 2 1 executables this is located by default at C Program Files x86 AVEVA Everything3D2 10 set_forward_compatibility bat 6 2 2 Model Data Interoperability in regards Model Data may be summarised as the ability to see shared AVEVA ESD 2 1 and AVEVA PDMS or Hull amp Outfitting 12 1 SP4 3D model objects in the Model Explorer add them to the 3D View Clash check against them perform additional spatial map actions such as Add within Volume and produce reports and drawings containing Model data created in the alternative product Where there is no data model change between the products it is feasible to change the 3D model data in either product however there are exceptions to this such as Stairs Ladders amp Handrails SLH and Supports 6 2 2 1 Design Aids AVEVA E8D 2 1 Design Aids such as Reference Grids and Aid Lines are not classified as 3D Model Objects and are therefore not visible in AVEVA PDMS or Hull amp Outfitting 12 1 SP4 The Design Ai
8. In the Transform Configuration file a Visual Style can be referenced to define the Grid Rulers during the transformation process Copyright 2015 67 AVEVA Solutions Limited and its subsidiaries WWW aveva com All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide Please refer to the AVEVA ESD 2 1 User Bulletin for further information on the use of Grid Rulers and associated Visual Style 5 5 3 9 Labels amp Notes Labels created via the AVEVA Marine Drafting menu functions Annotate Labels or Auto tagging are created directly within the PADD database and there is no special consideration given in the Marine drawing transformation operation AVEVA Marine Drafting Notes General Notes Hull Notes and Config Notes are converted to Symbolic Labels SLAB and may be modified thereafter in AVEVA E3D Draw as a Label For each instance of the note a symbolic template SYTM is created and stored in a local library to the Drawing D AVEVA E3D 2 1 Draw does not support multiple leader lines Any General Notes with multiple leader lines are not transformed as intelligent leader lines connected to the Model 5 5 3 10 Invisible Geometry Geometry in AVEVA Marine Drafting may be defined as invisible when e The geometry model geometry or 2D geometry belongs to a layer that is hidden in the Drawing e Drawing elements have the Visibility flag set to False This can be set e g by the Modify gt General
9. Outfitting 12 1 SP4 AVEVA E3D 1 1 will not work with the new catalogue at AVEVA ESD 2 1 In addition Angle profiles have been re orientated to conform to National Standards and to be aligned with the typical orientation used by other software packages The profile specification of GENSEC and FIXING elements must be converted for compatibility with the most recent profile specification catalogue QD It is not necessary to update to the new catalogue as AVEVA E3D2 1 will function correctly with the old catalogue data however images on the joint and fitting selection forms will not be available D SCTN FITT and SJOI elements must be converted to GENSEC and FIXING elements prior to conversion of the profile specification Joints and fittings applied to GENSECs where the SpecHetf is from the previous catalogue will not work with the new catalogue due to the change in profile parameter order and the Dkey attributes ADMIN EB TL 5 A utility Update Profile is provided in the Structures group of the ADMIN TEM RE A 2 i tab The utility updates profiles from the catalogue previously used to the Template Sections Profile Tasks new catalogue Structures D The profile specification conversion of GENSEC and FIXING elements is an administration task access is only available to users with administration rights member of the STRUADMIN team or a free user Copyright 2015 30 AVEVA Solutions Limited and its subsidiaries A
10. o e o o o o o o e WWW aveva com AVEVA Everything3D 2 1 Migration amp Interoperability Guide AVEVAE3D AVEVA E3D 1 1 1 1 0 7 2 1 2 1 0 0 Origin Ref Project Change Description SI 76519 TFS Oglaend RZE Specs d 158969 AVEVA Steelwork Template DESI DB AVEVA Oglaend FTE Specs AVEVA Steel Profile Pline Mods for Supports AVEVA ABSI UDAs AVEVA Bocad Steel Interface AVEVA Add Pvifilter to Plines of PFC PFI amp PLTG Gtypes d AVEVA Oglaend FOE FTE Specs hd AVEVA Steel Profile PLINE mod additions d AVEVA Commenting UDAs with set REFNO and UKEY AVEVA Angle PLINE Additions AVEVA Empty and unnamed UWRL deleted AVEVA Miscellaneous E3D2 Steel Catalogue changes AVEVA Remove rogue SPWL in DB MASTER STL_JOINTS_FITTS AVEVA Steelwork Profile Joints amp Fittings Catalogue TFS 164182 Delete empty Status definition AVEVA Structural Catalogue TFI Profile Model Changes S1 37182 TFS Material TXT name changes in MASTER PIPECATA d 69334 DB AVEVA Un hide UDA MDS Uda MDSPipeMat TFS 177908 Include MDU CATA in MDB ALL from APS as Foreign TFS 154991 Elliptical holes catalogue data d TFS 178243 Wall Spec MATREF Correction AVEVA Corrections to OGLAEND SPB RF SPEC d TFS 146586 Unset P2 for FLAN elements amp PTREF additions AVEVA Structural Catalogue Update hd AVEVA Finalise Supports Data major upgrade Started with MC 1461 TFS 164644 Re order TMPLs DPSE DDSE in SLH Templat
11. slick Delete APPLDW and FMWLD in DB ADMIN REFDATA AVEVA oe amp Teams Update to Project Document PDF files AVEVA Re Instate 2 MDS UDAs PPROJECT MACHINE data moved to UE ra E TFS 164920 Change all local DICT DBs to Multiwrite Access AVEVA Re apply status control values AVEVA Area02 Workshop CWAY BPANEL Hole TFS 173613 TE US DRAFTADMIN removed DRAWADMIN added AVEVA Reset Support MDSConn MDSAttaRef Area 03 AVEVA Add Trap Weights Reset GPART Steam Trap Weights AVEVA Supports Sample Design Data AVEVA Unset Invalid Refs AVEVA Remove Spurious SYLB from DB MDS DRAFT AVEVA Structural Joint and Fitting Design update AVEVA PLINTH_PUMP_KIOSK_01 Addition TFS 170771 Isometric ADP MDS Supports Drawing Update AVEVA Rework for Area02 AHU to remove Zone within Zone AVEVA New format Project Description document TFS 183047 Correction to spelling error in APPLDATA Function AVEVA Rework Area 02 B01 HVAC Bran AVEVA Reinstate DB STRUC TEMPLATE in APS MDBs AVEVA HVAC AISC Support Specials Template Modification AVEVA Support Template Sample Data Updates AVEVA Project Library AVEVA Plant Rulers TFS 170773 95 DRAW DRWG Update and Associated LIBYs 96 80 Copyright O 2015 105 AVEVA Solutions Limited and its subsidiaries All rights reserved www aveva com Origin Ref AVEVA AVEVA AVEVA AVEVA TFS 80631 AVEVA TFS 81139 AVEVA AVEVA AVEVA TFS 142894 AVEVA TFS 168041 SI 151262 TFS 158073 TFS 164854 AVEVA TFS 180161 TFS 181499
12. 2 1 already includes the MDS template databases etc listed below then it is unlikely that further steps are required in the administration before moving on to the next update step The following steps are therefore included for reference For new projects Support template databases are normally copied to a user project to enable editing The sample versions of these databases are supplied in the APS project In the case below we consider the situation where customer versions of these databases already exist in PDMS or E3D1 1 and need to be included within the working project that is being converted for use in E3D2 1 In the example below we assume that customer template database data is stored within a corporate reference project named COR and the required data will be included in the working project by a foreign reference Databases required by the Supports Application MDS WELDS MDS DRAFT MDU CATA MDS APPDEFAULTS Framework Template Data one or more databases are required from the following list MDS DESITMPL AISC MDS DESITMPL BS MDS DESITMPL DIN MDS DESITMPL OGLAEND Note Additionally if defined the following databases can also be included but only if the non ori version is also included MDS DESITMPL AISC ORI MDS DESITMPL BS ORI MDS DESITMPL DIN ORI opecial Template Data one or more databases are required from the following list MDS DESI SPECIAL AISC MDS DESI SPECIAL BS MDS DESI SPECIAL DIN Hanger Template Dat
13. 4 User Defined Attributes By default User Defined Attributes UDA that are being used to store supports data i e Supports application specific UDAs are no longer visible To query an application specific UDA a direct line command must be used For example q MDSSuppRef It is possible to query which UDAs exist on an element by use of the q udaLis line command The UDA MDSPipeMat CS is an exception and is visible within AVEVA E3D 2 1 4 3 4 Model Data Upgrade Model data conversion utilities to upgrade existing model data i e ATTA based support elements will be provided via an AVEVA ESD 2 1 Fix Release 4 3 5 Support Designer Access G Modify User ASSUPPORTMAN el xXx Name ASUPPORTMAN Description ASUPPORTMAN Security General X User Membership User Access Control Rights ACR Project Teams Name The hierarchy structure and creation workflows of the Supports application at AVEVA E3D 2 1 allows the potential to alter the access permission for a Support designer to remove access to Pipes Steelwork Tray and HVAC if appropriate This is pepe completed via the Modify User forms in AVEVA Administration Team Membership Name a PIPING DEPARTMENT STRUCTURAL STRUCTURAL DEPARTMENT SUPPORTS SUPPORTS DEPARTMENT Total Items 14 Copyright 2015 47 AVEVA Solutions Limited and its subsidiaries WWW aveva com All rights reserved AVEVA Everything3D 2 1 Migration amp
14. AVEVA Catalogue 2 1 Paragon module Copyright 2015 48 AVEVA Solutions Limited and its subsidiaries WWW aveva com All rights reserved atalogue Explorer TAXIS 3 of PTSET AATA200 P3 4 Attributes PTAAIS 3 of PTSET AATA200 P3 4 g scyL1 sc 2 Z UNE1 Z UNE2 Em SSPH 1 Em SSPH 2 Im SSPH 3 4 bg PTSE AATA200 P3 4 g PTAX1 g PTAX2 g PTAX3 oto SCOM AATA200DD oto SCOM AATA200DC ota SCOM AATA200DB ota SCOM AATA200EE ota SCOM AATA200ED oto SCOM AATA200EC ofa SCOM AATA200FF oto SCOM AATA200FE ota SCOM AATA200FD oto SCOM AATA200GG ota SCOM AATA200GF oto SCOM AATA200GE oto SCOM AATA200GD oto SCOM AATA200HH oto SCOM AATA200HG oto SCOM AATA200HF oto SCOM AATA200HE oto SCOM AATA200HD ota SCOM AATA200JJ oto SCOM AATA200JH ota SCOM AATA200JG oto SCOM AATA200JF oto SCOM AATA200JE ota SCOM AATA200KK oto SCOM AATA200KJ oto SCOM AATA200KH oto SCOM AATA200KG oto SCOM AATA200KF oto SCOM AATA200LL oto SCOM AATA200LK oto SCOM AATA200LJ ofa SCOM AATA200LH ofa SCOM AATA200LG oto SCOM AATA200MM oto SCOM AATA200ML Track CE Model View AATA200 gt AATA200DD AVEVA Everything3D 2 1 Migration amp Interoperability Guide Track Axes P Points P Lines Representation NOM RUN SIZE NOM BRANCH SIZE RUN CONN TYPE BRANCH CONN TYPE CENTRE TO END RUN CENTRE TO END BRANCH RUN OUTSIDE DIAM BRANCH OUTSIDE DIAM v x Re PTAXIS 3 of PTSET AATA200
15. Alternate Repr Level 7 Application Tolerances Transport Text 2 TRANSPORTATION SUPPORT Pipe Clearance Max Pipe Slope Hangers Max Pivot Angle 3 0degree User Warning Angle 5degree Steelwork Overlap Max Packing Dist Min Rod Length 150mm Max Packing Overlap l Hanger Interface in Use Standard MDS v Max Trunnion Length 600mm Steelwork Connection Details ID Settings us amp Normal OQ Lined Joint Offset 150mm Automatic Pads On Ancilary Selection Settings Aways Display Ancillary Selection The Supports Admin Data form in AVEVA Catalogue 2 1 accessed via the Application Defaults button in the Configuration group of the SUPPORTS tab modifies values in the file Copyright 2015 45 AVEVA Solutions Limited and its subsidiaries WWW aveva com All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide MDS OPTION DEFAULTS the basis of the defaults set in the Supports Application Defaults form in the Model module Support Creation Zone and Templates Support Zone Supports Frameworks SUPPORT FRAMES AISC The default Support Creation Zone and Templates to be used Specials ISUPPORT FRAMES SPECIALS AISC in the Support creation workflows are referenced in the identified Hangers ISUPPORT HANGERS PSL area of the form and may be modified via the Select button The prompted Creation Zone and Framework Templates form allows the selection of framework templates spe
16. Data UDA with ALLP can refer to TUBI Legrand Salamandre Cable Trunking Range HVAC TUBI to use LBOR of PREV Integration Status addition UDA modification to resolve compile warnings Hole Management for cable tray and floor fittings Globe Valve AAVHBCR correction Pipe Tapping SPEC additions to SP DRO7C Lexicon update for PBS Correction to MDS CATA DATA DEFAULTS Conflict MDS New cata data in MDS APPDEFAULTS Standalone fixings to support Create Fixings form CATA Data for Pipe Fabrication 98 AVEVA Solutions Limited and its subsidiaries All rights reserved WWW aveva com AVEVA Everything3D 2 1 Migration amp Interoperability Guide AVEVA E3D 1 1 1 1 0 7 Origin Ref Project Change Description AVEVA TFS 97389 TFS 97414 TFS 95636 AVEVA TFS 97378 TFS 97389 AVEVA AVEVA AVEVA TFS 99271 TFS 100838 TFS 99496 TFS 105913 TFS 102550 TFS 105021 TFS 104741 TFS 105089 SI 60012 AVEVA TFS 110887 TFS 111785 AVEVA TFS 117910 TFS 121260 TFS 121587 AVEVA TFS 101960 AVEVA TFS 118828 TFS 129724 TFS 139227 AVEVA AVEVA AVEVA TFS 129316 TFS 146365 TFS 135915 AVEVA AVEVA Copyright O 2015 MDS Compensation Plate SPREF reset MDS CP 01 Rename UDA Type to PumpType Update SP DRO7C SHOP Flag TAGS Datasheet UDA modification UDA modifications to remove validation errors COUP Additions to SPWL plus Weights Rename UDNAME TYPE to PUMPTYPE Loff Selector added to spec SP DR
17. Draw utilises a system of Visual Layers to group objects in the Sheet to aid the management and editing of a Drawing Acting as a series of overlays to the Drawing content each Visual Layer may be employed in an organisational capacity to group drawing elements by purpose or type i e construction lines or annotation In addition with each Visual Layer having an associated Colour and Line Type a Visual Layer may be used to define the collective properties of a series of elements Visual Layers Presented layers 1 1 of 1 total layers QD In regards to the Draw Hierarchy a Sheet SHEE owns a Visual Layer Set VLYSET which contains the individual Visual Layers VLAYER D Visual Layers should not be confused with LAYE elements From the perspective of a Draw User the LAYE element is owned by a Sheet in the Draw hierarchy and is an administrative element for the storage of Draw annotation A series of LAYE elements through naming and setting of purpose remain integral to the Automatic Drawing Production process and the population of the Drawing Sheet Visual Layers may be considered during the migration of Drawing Templates to AVEVA E3D Draw 2 1 Drawing Templates are utilised by the Draw user to create drawings and sheets to a pre defined standard and orientation it may therefore be advisable to also include a series of Visual Layers in the Template with a pre defined representation to be selectable from the Active Prop
18. Element and the hierarchy below it B All LE Refresh Overlays The Transformation process is an administration task access to the ADMIN tab is only available to users with administration rights or as a free user D The Transformation result can be viewed in the Command Window where open 5 2 2 2 Command Syntax Bulk transformation is implemented separately for Sheets and other Library items Draw commands TRANSFORMSHEETS and TRANSFORMLIBS respectively These commands operate on the current element and the hierarchy below it e g it could be utilised at the Sheet Drawing Registry Department or World levels One can transform library items using the command Copyright 2015 55 AVEVA Solutions Limited and its subsidiaries WWW aveva com All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide IRANSFORMLIBRARIES ALL OVERLAYS BACKINGSHEETS SYMBOLTEMPLATES ISOTEMPLATES SHEETTEMPLATES THUMBNAILS NOTHUMBNAILS NOPROMPT The default command is THUMBNAILS as although it slows the conversion process there are not expected to be very large numbers of library elements D wornonPT is automatic in TTY mode in graphical mode the default is to prompt the user to confirm transformation When the transformation process is complete a log file is created and stored in the directory 9eAVEVA DESIGN USER e The file name is of the format DraftTransform 20141114 144807 log The log file details the trans
19. Interoperability Guide 4 4 Piping AVEVA ESD 1 1 introduced an enhanced graphical user interface and functional workflow for Pipe modelling and modification Dj Piping Component Editor x Branch 100 E 1 B1 Spec A356 ae Bore 100mm Branch Slope unset Select From Spec z ulation B Tracing A3B v None v None v Standard Components Additional Components ke Hh Oo ho A The PIPING tab includes all the tools required to create ae zc WE modify and check piping elements The creation and 4 A Hk mua q5 es y piping uie c BE modification of piping elements is further supported by a series of intuitive forms such as the Piping Component Editor that combine a number of modelling tasks into one logical user interface To ensure compatibility with AVEVA PDMS and Hull amp Outfitting 12 1 SP4 the piping application has been extended at AVEVA E3D 2 1 to account for functionality introduced in 12 1 SP4 e g Non Standard Branch Connections 4 4 1 Sloping Pipes The Piping application sloping pipe capability has been extended at AVEVA E3D 2 1 to allow for multiple sloping pipes at a piping component plus the representation thereof in IsoDraft and Draw Paragon In regards to the migration process to AVEVA E3D 2 1 an update is required to the Oo Piping Catalogue s to utilise the multiple sloping pipe to component functionality The update is completed using the
20. NEW environment variable is set Datal files written from earlier versions will not be UTF 8 but will be read according to the CADC LANG environment variable or Latin 1 if unset If this is incorrect this could cause encoding problems causing the file to be misread For further information please see the PDMS 12 1 User Bulletin New databases created at PDMS 12 1 will by default use the Unicode character set for textual attributes and names However no upgrade is required for older databases they will be handled according to the project character set as defined in Admin PROJECT CHARSET or PROJECT MBCHARSET commands They will also be converted according to this setting if they are reconfigured so it is important that it is set correctly In cases where an extended range of characters is needed Reconfigure may be used to convert a legacy database to a Unicode encoded database In the following example legacy DICT databases used to hold UDA and UDET names are reconfigured to be Unicode encoded using Admin 12 1 FROM DB MASTER DICT TO FILE cADICT1 cADICT2 RCFCOPY ALL RECONFIG SESSIONS Copyright O 2015 94 AVEVA Solutions Limited and its subsidiaries WWW aveva com All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide FROM FILE cADICT1 cADICT2 TO DB MASTER DICT RECONFIG Doing it this way means that no deletion and recreation or copy is required for the DB and therefore neither is
21. Outfitting model data to AVEVA E3D 2 1 For further information regarding the use of AVEVA Catalogue 2 1 in supporting model data migration please refer to Chapter 4 Model Data 3 5 Customer PML amp NET Applications Before considering the migration of any customisations to AVEVA ESD 2 1 it is important to assess the extensive functionality and redefined workflows found therein After consideration it may be found that previous customisations have been rendered redundant or require adapting to ensure the most efficient workflow is promoted The majority of customisations should operate as expected in AVEVA ES3D 2 1 but may require adjustment where the customisation is called from or accessed via a menu bar or toolbar as these do not exist in the Model or Draw modules Further aspects of AVEVA E3D Draw that differ somewhat from PDMS Draft and Marine Drafting will necessitate changes to customisations For more details please see Chapter 7 Customisations As Draw is a new module at AVEVA ESD any changes made to the module definition for PDMS Draft may also be required for Draw D It should be noted that Users can no longer define new modules in AVEVA Administration As module switching between AVEVA Administration or Catalogue modules and AVEVA E3D modules is no longer possible any macro doing this will need to be re structured In addition some forms may need adjustment to their layout for best presentation Copyright O 2015 2
22. TFS 146462 Set STRUCLASS on structural elements TFS 146534 Area01 100 B 1A Branch Href reset AVEVA Addition of SCHEMATIC and ENGINEERING mdbs TFS 150749 Add SAMPLE LINKDOCS DB to MDBs AVEVA Multi sloping Pipe for Area 03 AVEVA Single SCSTEN removal AVEVA Name unnamed REFGLN elements TFS 157458 IDLN setting removal for DRWG and SHEE TFS 156290 Major Sample Drawings Update to reflect REFGRD AVEVA Add PLANT GRID REFGRDS to GPSET Groups Copyright 2015 104 AVEVA Solutions Limited and its subsidiaries All rights reserved WWW aveva com AVEVA Everything3D 2 1 Migration amp Interoperability Guide AVEVA E3D 1 1 1 1 0 7 AVEVA E3D 2 1 2 1 0 0 Origin Ref Project Change Description AVEVA Visual Style Addition AVEVA BLACK amp AVEVA DIM TFS 159606 Reorder Pipe 150 B 6 in Hierarchy TFS 101075 Break In Tie In Assemblies for Laser Data AVEVA Report Template for Pipe Spool List TFS 164256 Change STEPID on INFO1 of GRIDWL TFS 164886 ISO Default option files are missing in E3D2 1 Test12 TFS 164920 PPROJECT DICT Access change to be Multiwrite TFS 164257 Grid Elevation Modifications AVEVA Library Automatic Grid Annotation Modify SYTM AVEVA Set CDLIMITS on View APS 1000 1 V2 AVEVA Re clad Area02 Workshop with BPANEL TFS 168312 Remove SUPPORTMAN from the Design TEAMs TFS 143575 Pipe Fabrication Templates and Backing Sheets AVEVA DB ADMIN NSEQ addition to MDB ALL d god Sample Project Update to Users and Teams
23. Visual Style click the Dimension Label Text Ruler or Dimension Label XE View button as required from the Visual Styles group of the ADMIN tab Visual Styles The Visual Styles form is displayed with the appropriate tab selected The Visual Style is defined via the incorporated Properties Grid and illustrated by the preview window Any number of Visual Styles can be defined for a variety of purposes the required default Visual Style is indicated by an adjacent checkbox tick which thereby populates the Draw System Defaults form with the identified default Text Dimension Label Available Styles AVEVA BLACK AVEVA DIM 1 8 AVEVA WHITE es T Dimension definition Dimension line Dimension mode Radius First terminators LJ Crosshair colour Colour of the crosshair Crosshair colour E Colour 4 3 Crosshair line type 00f Crosshair overshoot 5mm Dim line colour P Colour 6 Dim line rotation angle Odeg Dim line spacing Omm Dim line text colour B Colour 5 Dim line text font Ti 05 Arial Unicode MS Dim line text height 3 5mm Dim line text location X Omm Y Omm Dim line text location moc Centre Dim line text radius 5mm Dim line text underline Off Dim line type 8001 Solid Dim text angles DIMTEXT Copyright 2015 59 AVEVA Solutions Limited and its subsidiaries WWW aveva com All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide 5 3 4 Visual Layers
24. and User for Structures UI ACP Supports PR SCOM parameter reorder ACP CATE F1 SQR PFI 8H Joint 6 holes not 8 ACP Joint TMPL and Joint SPCO TMPR efs change Project Change Description AVEVA OpenSteel Interface MDB for Sample Project MDS DESP Correction in DESISTDS and DESITMPL PIHASA Transform on DRAFT data to enable DRAW Sheet and reference updates Add GPWL GROUPs Additional Sheet and Ref updates Relief Valve Correction VALV is now INST Fabrication Machine Additions SCTN Tidy Nodes Joints Chk Conn Refs Assign MATREF Design Checker Rules Piping Update AREAO1 2D Data for E3D 1 1 Add db PPROJECT SYSTEMS Add ASSOC ASSOC and new db PPROJECT HMLINKS Fix to DRAW SHEET DRWG PIPING AREAO01 S1 Modifications to workshop portal frame 2 x SECT elements in MDS MDSAPPDEFAULTS db Add SLHADMIN Team Model update for MDS UDA TREF Correct Name too long error in CWAY definitions group Layout Spec Update Add Valve Numbers Copyright 2015 101 AVEVA Solutions Limited and its subsidiaries All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide AVEVA E3D 1 1 1 1 0 7 AVEVA E3D 1 1 1 1 0 7 www aveva com AVEVA E3D 2 1 2 1 0 0 AVEVA E3D 2 1 2 1 0 0 AVEVA Everything3D 2 1 Migration amp Interoperability Guide AVEVAE3D AVEVA E3D 1 1 1 1 0 7 2 1 2 1 0 0 Origin Ref Project Change Description AVEVA Set SCM COCO for SPRINKHEAD 15 e e AVEVA a
25. another style object was used this is overwritten Copyright O 2015 65 AVEVA Solutions Limited and its subsidiaries WWW aveva com All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide In addition to alterations to the View Representation there may also be some line types that cannot be resolved in AVEVA E3D Draw This can be mitigated by using line style mapping please refer to Section 5 5 3 12 Line Types for further details e Special Hull Model Views AVEVA E3D 2 1 is unable to entirely transform and perform an Update Design operation on the following special Marine model views e Body Plan View e Shell Expansion View e Developed Plate View e Curve Panel View e Shell Stiffener View On transformation of the above Views into AVEVA E3D Draw the geometry representing the Model data is converted to 2D contours and the link to the Model is broken In addition to alterations to the View Representation there may also be some line types that cannot be resolved in AVEVA E3D Draw This can be mitigated by using line style mapping please refer to Section 5 5 3 12 Line Types for further details 5 5 3 3 2D Contours On transformation all 2D geometry within the AVEVA Marine Drafting Drawing e g lines arcs and clouds are stored in the PADD database if not already present and represented in the Drawing Sheet D 2D Geometry that does not have an equivalent Draw element in the PADD databas
26. database types are for future use by AVEVA products no data will be created in them by AVEVA ESD 2 1 6 3 2 Draw Module Prior to the use of an AVEVA PDMS or AVEVA Hull amp Outfitting 12 1 SP4 project in AVEVA E3D 2 1 the Administrator must define the Draw module This definition is achieved by opening the Project in AVEVA Administration 1 4 and performing a Savework The Draw module is automatically defined at this point Please refer to Section 5 1 Module Definition for further information 6 3 3 Dynamic Database Sets AVEVA Administration 1 4 introduces the ability for Database Sets DBSETs to contain selection criteria to enable dynamic updating The dynamic DBSETs can be used within AVEVA E3D 2 1 but they should not be included in MDBs to be used in AVEVA PDMS or Hull amp Outfitting 12 1 SP4 to avoid an error being presented on login 6 3 4 Multi write Dictionary amp Property Databases Dictionary DICT and Property PROP Databases are multi write in AVEVA Administration 1 4 and Catalogue 2 1 The latest with latest rules means nobody should be using these with Admin Lexicon or Paragon from 12 1 SP4 The Design Draft and Isodraft Modules will open them read only 6 3 5 Flexible Explorer A Flexible Explorer can be created with AVEVA Administration 1 4 but cannot be viewed in AVEVA PDMS or Hull amp Outfitting 12 1 SP4 Such Explorers can be viewed in AVEVA Engineering 14 1 1 and AVEVA Diagrams 14 1 0 Please refe
27. different colour than its owner 112 www aveva com AVEVA Everything3D 2 1 Migration amp Interoperability Guide Three Auto Colour Rules need to be set for e FIXING e GENSEC with Structural Class PRIMARY e GENSEC with Structural Class SECONDARY Edit the 2 files des col pmidat and des element rules pmldat which can be found in C Users Public Documents AVEVA Everything3D Data2 10 DFLTS and save these in user data folder C Users Public Documents AVEVA USERDATA The content of des col pmldat should contain gphAutoColourRul Secondary gphAutoColTnslVal 35 gphAutoColEdgeOn TRUE gphAutoColourCol object COLOUR 52 gphAutoColour object GPHAUTOCOLOUR gphAutoColourRul gphAutoColourCol gphAutoColTnslVal gpghAutoColEdgeOn ItempArray 1 gphAutoColour gphAutoColourRul Primary gphAutoColTnslVal 35 gphAutoColEdgeOn TRUE gphAutoColourCol object COLOUR 51 IgpghAutoColour object GPHAUTOCOLOUR gphAutoColourRul gphAutoColourCol gphAutoColTnslVal gpghAutoColEdgeOn tempArray 2 gphAutoColour gphAutoColourRul FIXING gphAutoColTnslVal 1 IgpghAutoColEdgeOn FALSE gphAutoColourCol object COLOUR 50 gphAutoColour object GPHAUTOCOLOUR gphAutoColourRul gphAutoColourCol gphAutoColTnslVal gpghAutoColEdgeOn tempArray 3 gphAutoColour The content of des element rules pmldat should contain rule object RULE rule name FIXING
28. different product families they will not work Switching between modules in the same product family e g between Model and Draw within a macro will continue to work D Please note that the Monitor Module cannot be switched to from the AVEVA E3D 2 1 Login screen but may be switched to via the PROJECT tab when in AVEVA ESD 2 1 Inter database macros may be run from the Modify group of the MANAGE tab in Model 7 8 Writing PML code to work in both PDMS amp AVEVA E3D Most PML code written for AVEVA PDMS and Hull amp Outfitting will work in AVEVA E3D without change Code that cannot be shared between the two environments can be implemented behind a common interface that decouples the application from product specific functions The main areas where differences can occur between AVEVA E3D and AVEVA PDMS and Hull amp Outfitting are e The interface to main bar menu and tool bar functions e Changes to environment variables e g PDMSUSER replaced by AVEVA DESIGN USER e Use of Lists which have been replaced by Collections in AVEVA E3D e Changes to form layout including docked forms e Use of resource files for Icons e PML code setting AVEVA ESD view properties 7 8 1 The interface to main bar menu and tool bar functions This is the area where most differences will be found between AVEVA E3D and AVEVA PDMS and Hull amp Outfitting PML code The method of introducing new functions to ribbon menus in AVEVA E3D is very different to the me
29. elements are converted to Fitting FIXING and Joint FIXING elements e Primary Node PNODE and Primary Joint PJOI elements are converted to End Datum ENDATU elements that own a Joint FIXING with the referenced joint x A utility Convert Sections is provided in the Structures group of the Hierarchy Convert Update SLH ADMIN tab in AVEVA ESD 2 1 Template Sections Profile Tasks Structures D The conversion of SCTN elements to GENSEC elements is an administration task access is only available to users with administration rights member of the STRUADMIN team or a free user Convert SCTN GENSEC x Add Elements Curent Ene Named Element unset Selected Elements Type 4 Mame Initial GCTMs Finali3EMSECSs s sresmucumewem E The Convert SCTN GENSEC form allows the z Administrator to select and convert SCTN elements to the required GENSEC elements Be t Convert Sections to Gensecs Date 17 25 54 10 October 2015 Project APS Description AVEVA Supplied Sample Plant Data Number AFS 2 1 0 Beta4 Log File SN_USERSt LogConvertedSections bat Ni When the SCTN to GENSEC conversion is complete the GENSEC elements are updated and displayed in the Model Explorer Copyright O 2015 28 AVEVA Solutions Limited and its subsidiaries WWW aveva com All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide 4 ff ZONE ZONE STRUCTURAL AREA01 4 EE STR
30. function e The LVIS attribute is set to False for a drawing element e g VNOT or LAYE in the PADD database In Marine Drafting you can only set this attribute explicitly in command window or in the attributes dialog Acknowledging that AVEVA Marine Drafting and AVEVA ESD Draw do not have the same functionality to handle visibility the transformation operation processes the invisible geometry with the following guidelines e Model Geometry Where model geometry has been made invisible the Drawing will look as per AVEVA Marine Drafting on transforming and opening in AVEVA E3D Draw However on Update Design the invisible geometry will become visible e Other Geometry For 2D geometry and annotations there is a difference whether the data is already stored in the PADD database or not When invisible geometry is already stored in the PADD database the data will normally become visible in Draw after the transformation An exception is if the LVIS attribute has been set to False in this case the geometry will still be invisible Geometry that is stored in PADD includes Label Invisible geometry that is not in the PADD database prior to the Drawing transformation such data is stored in SDB file only will be ignored i e this data will not exist in the drawing after the transform is complete This includes Symbols Dimensions other than Linear Radial Angle and Annotations other than Labels Some types of geometry elements are sometime
31. further information on PML considerations to Form Layout See section 1 3 3 for further information on PML considerations on docked forms 7 3 2 Sliding Forms Sliding forms have been introduced at AVEVA E3D 2 1 in the Model and Draw modules to ensure that the graphical canvas does not change as forms are docked and undocked from the sides of the application Any use of the CreateDockedWindow method C will continue to work but the system will only dock the window to the right or the left in the Model amp Draw modules The Forms amp Menus PML syntax to define a docked form is unchanged D Forms docked to the left and right of the display will appear as Sliding Forms and these forms have a minimum form width Ideally all forms docked to the left or right will be designed to be the same width as other docked forms The current AVEVA E3D default width is 368 pixels In AVEVA ESD there are no bottom or top docked forms The syntax will not fail but any forms defined to be docked to the top or bottom will appear as standard floating resizable forms 7 3 3 Form Title amp Icon In regards to the Sliding Form tab it is now possible to customise the form title icon and tooltip These can be set in the FormsMetaData section of UIC files D Fora specific example of this customisation ability please refer to the Design uic for example use 7 3 4 3D View Form Borders The option to add borders rulers and scroll bars to a 3D View u
32. in the Object declaration is used to define the main menu and toolbars This is not required in AVEVA E3D because ribbon menus are not defined using PML code The module startup and application switch callbacks work as they do in AVEVA PDMS and Hull amp Outfitting A new optional Control declaration has been added to PML add in files This allows an object to be defined as the controller for an application or set of utility functions This can be used to handle module and application Copyright 2015 85 AVEVA Solutions Limited and its subsidiaries All rights reserved WWW aveva com AVEVA Everything3D 2 1 Migration amp Interoperability Guide switch callbacks and to maintain state information about the add in functions It may be used to load and register new PML Command objects associated with the add in functions PML Add ins are described in the Software Customisation Guide 7 4 3 Other Considerations Ribbon tooltips cannot be modified by PML code at run time It is possible in AVEVA E8D to use Icons from resource files on ribbon menus and on forms The addPixmap function has been extended to load Icons from resource files This does not replace use of png files 7 5 Applications Customisation of a number of AVEVA PDMS 12 1 SP4 applications can be migrated to AVEVA ESD with minor modifications Some deprecated AVEVA PDMS and Hull amp Outfitting applications see list below will not be found in AVEVA E3D and some
33. issues reported by our customers As a consequence of the enhancements it is required that when migrating to AVEVA Licensing 2 0 a new format license file is installed It is an important consideration that the new license is requested and received prior to updating the license server D AVEVA Everything3D 2 1 does NOT operate with AVEVA Flexman if upgrading from AVEVA Licensing System 1 1 1 please install Fix release 1 1 1 3 in order to correct an uninstall defect in that release Once this has been done version 1 1 1 3 can be uninstalled and replaced with later versions 2 4 2 AVEVA Client Cache Service 1 0 5 The AVEVA Client Cache Service is designed for use on a LAN or WLAN network with full connectivity to the Database files and can make a considerable improvement to Dabacon database performance The use of the Service is strongly recommended for all multi user projects The AVEVA Client Cache Service has been developed to produce an improved performance when reading data over high latency networks by minimizing traffic The AVEVA Client Cache Service stores a copy of the read project data on the local disk which improves performance where there is repeated reading of project data across a computer network The service operates by a data request being sent to the local Cache folder to retrieve the required Data Database Page If the data is not within the Cache folder a Data Request is sent across the network to the central
34. manually D For Hull users please note that Hull Grid Elements GENTAB are not visible in the Model Hierarchy having been converted to GRIDSYS elements in AVEVA Hull amp Outfitting 12 1 SP4 The following naming rules apply to the conversion of GRIDSY elements e If the original GRIDSY element is named the suffix REF is added to the name of the new REFGRD element e lf the GRIDSY element is not named and the Purpose property is SHIP the new REFGRD element is named SHIP GRID REF e Ifthe GRIDSY element is not named and the Purpose property is set to be other than SHIP the REFGRD element is not named Copyright O 2015 36 AVEVA Solutions Limited and its subsidiaries WWW aveva com All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide The following naming rules apply to the conversion of GRIDAX elements e If the GRIDAX element is named the suffix FA or EL is added to name of the new GRIDFA and GRIDEL elements respectively e lf the GRIDAX element is not named and the Purpose property of the owning GRIDSY element is SHIP the new GHIDFA and GRIDEL elements are named SHIP X FA SHIP Y FA and SHIP Z EL respectively e lf the GRIDAX element is not named and the Purpose property of the owning GRIDSY element is set to be other than SHIP the new GRIDFA and GRIDEL elements are not named D Auto naming rules can be applied to Grid Planes An auto naming file providi
35. number is used to verify that the versions of the database and the software that accesses them are compatible During application start up databases are checked against the software access may be restricted according to the following table Database Upgrade Version Pre 12 1 12 1 1 Future e g 12 2 Software Version Max Open Mode Pre 12 1 meni fw fe 00000 x 0000 Fe 0 mM 0o This control ensures that AVEVA software that opens a database is compatible with the contents of that database and thereby prevents accidental data corruption It also ensures that data intended for use with one software version is not modified by a newer incompatible software version Future e g 12 2 X indicates no access however versions earlier than 12 1 do not make this check so cannot detect a database upgraded to 12 1 or later Global It is recommended that the whole project excluding Foreign databases should be upgraded at once However it is recognised that this needs to be achieved in stages and different locations and databases can be upgraded independently of each other It is not necessary to disable automatic update events Global can continue to work as normal during the upgrade procedure Databases can only be upgraded at their primary location Project upgrade will ignore secondary databases including databases which are undergoing re location as well as extract hierarchies which contain secondary extracts All extracts of a
36. on the migration process to AVEVA PDMS 12 0 Both AVEVA PDMS 12 0 and 12 1 brought significant changes to the database which need to be applied prior to the migration to AVEVA E8D 2 1 The procedure for Global projects is more complex please refer to the PDMS and Global User Bulletins It may be advisable to consider consolidating a project at the hub and redistributing it when the upgrade is complete 3 1 1 AVEVA PDMS 12 0 gt AVEVA PDMS 12 1 Key developments at AVEVA PDMS 12 1 include Unicode handling revised UKEYs and Draft Line Widths The upgrade process is summarised by e Install PDMS 12 1 SP4 Fix Release 28 and use the command syntax DBupgrade project to latest D Is should be noted that once upgraded the Project data cannot be accessed via earlier versions of AVEVA PDMS Please refer to the User Bulletin for PDMS 12 1 SP4 for full details and is further described in this guide in Appendix A Migration from PDMS 12 0 to 12 1 Customers own PML applications may need adjustment for changes in AVEVA PDMS and Hull amp Outfitting 12 1 Please refer to the relevant User Bulletins for further details 3 1 2 AVEVA Hull amp Outfitting 12 0 gt AVEVA Hull amp Outfitting 12 1 Further to above there was an optional database upgrade no 12010301 between AVEVA Hull amp Outfitting 12 1 SP2 and 12 1 SP3 This should be considered as the upgrade item 2931 Storing of coordinate system entities under a GENPRI element is relev
37. product and their adaption to the functionality provided in order to realise an efficient design workflow This adoption is aided by an intuitive AVEVA ESD 2 1 user interface and workflows designed with the user and the graphical model at the centre of the process In addition AVEVA Experience http www aveva com experience provides an effective and easily accessible way to gain hands on experience of AVEVA E3D wherever the user is located For employers it makes it easier to train and upskill engineers and designers Once registered the user will have the opportunity to go through an extensive set of training modules on core aspects of AVEVA ESD including training exercises and how to videos These modules will highlight the key differences between AVEVA PDMS and AVEVA ESD The user will also be able to work with a Cloud hosted deployment of AVEVA ESD including a sample set of project data u Social networks gea Sa AVEVA Experience Log in ai AVEVA Everything3D V V Exploits latest technology in laser IEEE scanning mobile and cloud computing ZVZRYTHINC3D Copyright O 2015 11 AVEVA Solutions Limited and its subsidiaries WWW aveva com All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide This page is left intentionally blank Copyright 2015 12 AVEVA Solutions Limited and its subsidiaries www aveva com All rights reserved CHAPTER 2 The A
38. server to retrieve the required data Likewise data that is unchanged since it was previously read is retrieved from the local Cache whereas Data that has changed in the Database must be read again from the central Database file oimilarly data that must be written to a Database file must still be written to that identified file Copyright O 2015 16 AVEVA Solutions Limited and its subsidiaries www aveva com All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide Cache Service Configuration Cache Service Control Cache Path Fublic Documents s amp vVEVA DataCache Stop caching threshold Curent cache disk usage EE Purge unused caches after 10 days Cache Storage control The AVEVA Client Cache Service is installed with AVEVA E3D 2 1 and may be configured or disabled using the AVEVA Cache Service Configuration application The prompted form seen above enables an Administrator to configure the caching threshold level to avoid the local hard drive being filled D The Default is to stop caching on the Hard Drive on becoming 80 full When full data is continued to be delivered where already cached but no further data is cached until more space is made available The Cache persists data locally between sessions thereby very often the start up will be quicker To ensure the performance benefits of the service are realised Microsoft Message Queuing MSMQ must be enabled This is ac
39. the Spref name has been changed will not be updated by this utility unless the mapping file is updated manually The example below is an extract of a mapping file that indicates the old and new profile specifications File to define profile translation to new AVEVA structural catalogue old spco new spco gt HRAISCICISXD ZHUSSClSx50 AISC C15x40 US C15x40 nbso Clbx59 9 JUSCCIDX25 9 IAISOAOGI2X30 ZUS CI2x30 AISOACI2X25 JUSe0123x25 ATSCICI2X204 7 JU 01252057 Warning Fixings using Attached Owner On clicking Apply to convert the profile specifications a Confirm Parameters or old PLINE refs will need message IS displayed a new SPREF This will be done automatically if you have already translated the Catalogue The message Specs Continue informs the Administrator that the catalogue specifications must be translated before the conversion of the profile specifications It should be noted that Angle profiles are automatically re orientated to the new catalogue orientation during the process Copyright 2015 AVEVA Solutions Limited and its subsidiaries All rights reserved 31 WWW aveva com AVEVA Everything3D 2 1 Migration amp Interoperability Guide The utility presents a conversion summary and maintains a log file to which any errors in the conversion process are written 4 1 4 Adding Joint amp Fitting Images The use of the AVEVA ES3D 2 1 structural application and wo
40. validate this in their domain as AVEVA is unable to replicate the wide variety of customer data configurations 3 2 1 Marine Projects Hull data in AVEVA E3D 2 1 When using AVEVA ESD 2 1 in a marine context there are two alternatives for the project environment AVEVA ESD 2 1 can be started with either e Aproject marked as Plant with Hull 12 1 SP4 databases included as foreign databases The Hull databases are read only in this alternative providing a visual Hull context for the modelling of Outfitting elements In this scenario hull settings must be made available to AVEVA ES3D 2 1 This is achieved via a function in the Inithull utility found in AVEVA Hull amp Outfitting 12 1 SP4 Fix 23 onwards The function transfers the Hull System Defaults to the Hull database Drawing databases should not be included as foreign databases Drawings stored in a 12 1 format will be transformed when opened in AVEVA E3D 2 1 Draw and this requires write access to the PADD database e A project marked as Marine This is a full marine environment including the project setup d065 file and a number of default files controlling settings for Hull modelling and drafting A marine project environment including these settings is required for the marine specific AVEVA E3D 2 1 Draw functionality such as the creation and modification of Hull Symbolic Views D Please note that spaces in their pathnames should be avoided for AVEVA Marine Hull 12
41. 1 DIOP ING M xd 0 1 RETE ETT A i 48 442 PipihdgesUlpDOrISusaciesinutcietentie ierit niii Hbri unie ten aiai lettore atii anisi edet tini e aiaiai 50 Ao EISE m E 50 4 5 1 Preparing for the HyperBubble cccccseeeeccecceesseeeeeeeeeeeeeeeeeeeeeeeesaeeeeeeessaeeeeeessaageeeeeesaaeees 51 46 Compare Update scissioni enea ied pU E d ic pa dum ee ee ee eee ee 51 Ass Ree cp c n M ns 53 5 1 Module Definition 1 111LLee ec leeeee crue ieee eene nnne nnn nnn n nanus aaa s usan saa a ausa saa a assa esas sana rra a aa 53 5 2 Draw Transformation eeee eee eeeseeeee nene een n nhau nnus e asas nasa aan osea asas asas aa seas assa asas n seas annuus 53 DAL INC OTS Em m 54 PU MEE VIR ERE 55 Copyright 2015 WWW aveva com AVEVA Solutions Limited and its subsidiaries All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide bad TUNDIS saumerrosnta N POE IERI eee eee eee 56 Du hetreshing overlay sseundextac ee ne ONERE MD ee PEE 57 5 3 Modification of Library elements ccccceccssessseeeeeeeecceenseeeeeeeeeeceeasaseeeseeeeoenasnseeeeseneoeenneeees 58 9 3 Representati n Rules amp Styles oae riecdegunatutes tiet penc te Matin utes Uindesuneniti ie Mit dccrsidtutertiedunines 58 So bSbebS OV MIDOIS uas
42. 1 SP4 projects 3 3 Preparing an AVEVA Everything3D 1 1 project An AVEVA E3D 1 1 project may be used with AVEVA ESD 2 1 without any project migration or restriction It should be noted that the use of AVEVA E3D 1 1 and AVEVA ESD 2 1 on the same project is not a supported setup Please refer to Chapter 4 Model Data for further information on the migration of Model data to support the new Model functionality found in AVEVA E3D 2 1 Copyright O 2015 24 AVEVA Solutions Limited and its subsidiaries WWW aveva com All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide 3 4 AVEVA Catalogue and AVEVA Administration AVEVA E3D 2 1 is released alongside and supported by AVEVA Catalogue 2 1 and AVEVA Administration 1 4 In a project scenario where AVEVA ES3D 2 1 is used in conjunction with AVEVA PDMS 12 1 SP4 for example it is strongly recommended and is mandatory for some operations that the latest AVEVA Administration and AVEVA Catalogue products are used rather than the PDMS versions of those modules In regards to the migration process the use of AVEVA Administration 1 4 0 on an AVEVA PDMS or Hull amp Outfitting 12 1 SP4 project will automatically define the necessary Module Definition for the ES3D Draw module A user will be unable to access the Draw module until this administrative action has been completed The use of AVEVA Catalogue 2 1 is essential in supporting the migration process of PDMS and
43. 12 1 SP4 and it uses the same database and data management technology enabling the two to be used in conjunction on operational projects 1 2 The Migration amp Interoperability Guide The aim of the Migration amp Interoperability Guide is to provide an overview of the main differences between AVEVA E3D 2 1 and AVEVA PDMS and Hull amp Outfitting 12 1 SP4 It includes the project data migration process between the two products and highlight the interoperability of the two products on a project This guide should be useful to administrators who wish to migrate an AVEVA PDMS or Hull amp Outfitting project including those who wish to operate on projects in a mode where both products are in use Customers who are still using earlier releases of AVEVA PDMS and Hull amp Outfitting should also read the latest editions of the 12 0 amp 12 1 User Bulletins as supplied with those releases to migrate project data to 12 1 SP4 prior to AVEVA E3D 2 1 1 2 1 Using this Guide Certain text styles are used to indicate special situations throughout this document Button clicks are indicated by bold turquoise text Additional information notes and references to other documentation will be indicated in the styles below Additional information Refer to other documentation Example files or inputs will be inthe courier new font In addition to the migration of a project and the data to AVEVA ESD 2 1 it is also important to consider the users of the
44. 15 95 AVEVA Solutions Limited and its subsidiaries WWW aveva com All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide The data will need some reconfiguring e Integrator links world CYMWRL has been moved to Reference database e Shape upgrades in Diagrams automatic when opening a diagram in write mode e Systems moved to Reference Design database Copyright O 2015 96 AVEVA Solutions Limited and its subsidiaries WWW aveva com All rights reserved ruv APPENDIX B SMV 4 VIE Tni IA The following tables highlight the significant changes made to sample projects between AVEVA PDMS and Hull amp Outfitting 12 1 SP4 and AVEVA ESD 2 1 Please note that further improvements will be made to the sample projects in subsequent releases Details of these changes will be given in the accompanying release letters Major project differences at AVEVA ESD 2 1 include The main catalogue sample project formerly MAS is now called ACP AVEVA Catalogue Project The main sample data projects formerly SAM and MAR are now called APS AVEVA Plant Sample and AMS AVEVA Marine Sample Reference numbers have been preserved in the forming of the ACP project from the MAS project This will ensure that any Project references are maintained on migration to use the ACP project Sample drawings are in the new Draw format and Draw project libraries have been extended to support new Draw capab
45. 456984 aspx File System Gigabit Ethernet GbE LAN 64 bit capable network adapter The network should provide at least 1 Gb sec for each workstation Two or more network cards are recommended for increased performance and redundancy AVEVA E3D 2 1 has been tested with Microsoft NET Framework 4 0 with the following fix http www microsoft com en us download details aspx id 3556 This fix is mandatory for the use of the Design in Context Feature Microsoft NET Framework 4 5 Fix 2 has been tested with AVEVA E3D 2 1 The fix release is required to ensure the correct visualisation of AVEVA E3D Draw 2 1 print dialog 2 4 Prerequisite for this Release Products The following products are required for the use of AVEVA ESD 2 1 2 4 1 AVEVA Licensing 2 0 0 AVEVA Licensing 2 0 or later and an appropriate License File is required for the operation of AVEVA E3D 2 1 AVEVA Licensing 2 0 provides the following improvements e Support for Windows 8 1 and Windows Server 2012 thereby allowing customers to move their Licensing Server to these later versions of the Microsoft operating systems e Improved support facilities to help customers when reporting licensing issues This support bundle will enable the customer to gather all relevant files and information in a zip file so that AVEVA can investigate problems and provide an improved support response e Error messaging has been improved to aid AVEVA Support to investigate and respond to
46. 5 AVEVA Solutions Limited and its subsidiaries WWW aveva com All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide This page is intentionally left blank Copyright O 2015 26 AVEVA Solutions Limited and its subsidiaries WWW aveva com All rights reserved AUN Vie A Tesis apter X The following chapter outlines the key migration considerations where model data from an AVEVA PDMS or AVEVA Marine 12 1 SP4 project is to be used with AVEVA ESD 2 1 4 1 Structural A key feature of the AVEVA ESD 2 1 product the structural application places the model at the centre of design workflows Highlights of the structural application include the following e Less reliance on forms and menus with direct graphic input and interaction supported by a gesture based PowerWheel and powerful Properties Grid e Automated storage of elements and a grid allied structural model reduces the reliance on the Model Explorer e Preservation of user input to ensure data persists and is easily retrieved e Automatic connection between elements at creation and a connectivity model that is dynamically maintained e New and more comprehensive Structural Catalogues based on the latest National Standards SECTIONS f PLATES WALLSANDFLOORS STAIRS LADDERS AND HANDRAILS EJ amp Fitting Fillet E Merge a f Automatic i EndDatum Class PRIMARY American Standard Profiles J amp Ej Grid Storage
47. 5 5 3 4 Texts and Section 5 5 3 12 Line Types 5 5 3 2 Model Views e General Model Views Insert Model Views General Model Views created via the menu option Insert Model in AVEVA Marine Drafting 12 1 SP4 are maintained during the transformation process to AVEVA ESD 2 1 Draw The transformed Views will look as per the AVEVA Marine Drafting on the opening of Sheet in respect to colour and line styles However without supporting Representation and Style libraries an Update Design Copyright O 2015 64 AVEVA Solutions Limited and its subsidiaries WWW aveva com All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide action may result in a change to the representation of the data This is due to the Hull models being drawn with the colours and line styles set up by the current Representation Rule set for the View General Model View after an Update Design in AVEVA E3D 2 1 Draw without supporting Representation Rules and Styles General Model View in AVEVA Marine Drafting 12 1 SP4 a LIEY TT DRA PRJ REPR P RPLB TT DRA PRJ REPR GEN N ERRST TT DRA PRJ REPRIGEN MD A OETA The View can be corrected by altering the Representation Style RRST TT DRA PRJ REPR GEN BASIC g RAST TT DRA PRJ REPRIGEN BASIC PF for the View E RRST TT DRA PRJ REPR GEN HULL 8 RRST TTIDRAPRJ REPRIGEN PIPE In the AVEVA Marine Sample AMS project there are example S RRST TT DRAPPRJ REPRIGEN EQUIP Represe
48. AVEVA ESD 2 1 environment the Administrator must ensure that all product updates have been performed to align it with the update Copyright 2015 37 AVEVA Solutions Limited and its subsidiaries WWW aveva com All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide requirements for AVEVA ESD 2 1 The conversion process requires that the customer project utilises either AVEVA PDMS or Hull amp Outfitting12 1 S P4 Fix 28 earliest compatible fix with AVEVA E3D 2 1 or AVEVA E3D 1 1 4 3 1 Database Updates In using the Supports application at AVEVA E3D 2 1 it is important to consider that many of the default AVEVA maintained database libraries used previously have been updated for AVEVA E3D 2 1 and will need to be included or replaced within customer projects The databases used by the MDS application are split into two classes e AVEVA controlled reference libraries i e those databases that are maintained by AVEVA and generally regarded as being non user definable e User definable template and configuration databases i e those databases that contain client project specific customised supports data e AVEVA controlled reference library updates The following library databases are required by the new Supports application and the existing user references to these items must be reset to the AVEVA ACP project versions e MDS CATA DB 7320 e MASTER MDSDICT DB 7325 e User definable template amp configurat
49. AVEVA Everything3D 2 1 Migration amp Interoperability Guide Copyright 2015 80 AVEVA Solutions Limited and its subsidiaries www aveva com All rights reserved CHAPTER 7 There are two types of Graphical User Interface GUI in AVEVA E3D 2 1 The Model and Draw modules have adopted a tabbed Microsoft Fluent UI interface without a main menu bar or associated toolbars The other modules Spool and IsoDraft continue to have PML menus and toolbars The following sections will describe changes to PML and C code that may be necessary to migrate a customer s new and modified functions from AVEVA PDMS and Hull amp Outfitting to AVEVA E3D 2 1 Some of the advice given in this section applies to all code and some applies only to modules with ribbon menus As a general rule it is recommended that customers add their own applications by adding new tabs to the AVEVA E3D 2 1 ribbon This should avoid interference with the standard AVEVA functions and should enable their users to distinguish the company specific functions 7 1 Use of PML amp C in AVEVA E3D 2 1 The AVEVA E3D PML language has extensions not available in AVEVA PDMS and Hull amp Outfitting but the language is upwards compatible with PDMS PML Therefore most PML code written for AVEVA PDMS and Hull amp Outfitting can simply be copied into an AVEVA ESD environment and it will work as expected In most cases it would be possible to share PML forms and functions
50. Applications The following AVEVA Hull amp Outfitting 12 1 SP4 utilities are not available in AVEVA ESD 2 1 Model e Assembly Planning e Room Design e AVEVA Outfitting Supports e Equipment Seat Application 6 2 4 Hull Data Hull design data is made available in AVEVA E3D 2 1 to support outfitting design users working in marine or mixed projects The access to hull objects is not complete and the following hull objects are not visualized in the current version e Initial Design compartments e Hull seam e Hull blocks e Hull plane e Hull Marks e Hull point e Welds e Hull cylinder e Spaces and space arrangements e Pin Jigs e Hull curve e FE Images 6 2 5 Reports The following should be noted in regards to the use of Report Designer Templates in a mixed project environment e Report Designer Templates created in AVEVA PDMS 12 1 SP4 can be used with either AVEVA PDMS 12 1 SP4 or AVEVA ESD 2 1 e Report Designer Templates created via AVEVA Administration 1 4 or AVEVA E3D 2 1 cannot be used with AVEVA PDMS 12 1 SP4 Please note that where updating AVEVA PDMS 12 SP4 Report Templates in AVEVA E3D 2 1 it is prudent to copy the Template first as the Tempalte will no longer be available for use in AVEVA PDMS 12 1 SP4 6 2 6 Draw Data It is possible for user to utilise AVEVA E3D 2 1 Draw and AVEVA PDMS or Marine Drafting 12 1 SP4 on the same project but there are important considerations Copyright O 2015 76 AVEVA Solut
51. Base item 5702 for details Copyright 2015 Is WWW aveva com AVEVA Solutions Limited and its subsidiaries All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide 2 AVEVA E3D 2 1 has been tested with Microsoft NET Framework 4 0 with the following fix http Avww microsoft com en us download details aspx id 3556 This fix is mandatory for the use of the Design in Context Feature Microsoft NET Framework 4 5 Fix 2 has been tested with AVEVA E3D 2 1 The fix release is required to ensure the correct visualisation of AVEVA ESD Draw 2 1 print dialog For further information regarding IT Configuration please contact the local AVEVA Support Office Recommended supported hardware and software configurations are constantly subject to review please consult the AVEVA support web pages for the latest recommendations 2 2 Graphics Cards AVEVA ES3D 2 1 requires 3D graphics hardware capable of running DirectX 11 to ensure optimum performance for both design and drafting DirectX 11 is included as an integral part of the Windows 7 amp 8 1 operating systems AVEVA strongly recommends that appropriate hardware is used for AVEVA ESD 2 1 If appropriate graphics hardware is not detected on entry AVEVA ESD 2 1 may still be used but a warning will be given and certain graphical effects including use of laser data limited Please be aware that your system does not meet the specified hardware requirements and
52. C The joint needs to be setup in Model using appropriately sized profiles i e smaller rather than larger to get as clear an image as possible in the restricted pixel size 85 x 85 pixels The length of the owning and attached members should be as short as possible to give a good proportion to the joint Kark 7 C In the examples above the owning member is 250mm long with an owning profile size around 200mm deep although these may be adjusted to suit D The owning member attached member and joint geometry should be the only elements in the 3D View in order to eliminate any possibility of shadows from elements not involved in the joint Setting up a Section Fitting in Model Setting up Section Fittings in Model is similar to setting up joints i e appropriate size profiles should be used to get the clearest image in the restricted pixel size 85 x 85 pixels Consideration should also be given to the relative size of the profile compared to the fitting i e a large padeye on a small beam would not be correct AVEVA Solutions Limited and its subsidiaries www aveva com All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide Setting up the 3D View Remove all elements from the 3D View and add back the owing attached members to be used for the required joint fitting and apply the joint fitting Spref if not already done so About Eye With Walkthrough v Shaded 7 Outlines 7 Shadow
53. Data Removal Rename sample mdb to e AVEVA APP Grid Systems d AVEVA DRAW Library Data d AVEVA Area02 Steelwork Plinths L10 and L11 e SI 51337 AREAO1 Piping Sample Data eo e SI 51340 APP Updates E3D Schematic Data SI 51337 Drawing repairs e e AVEVA Remove Training Refs from Example Sheets d S151337 AREAO1 Piping Sample Data Correct COCOs a s Connections AVEVA Add Functions to DRAW elements AVEVA Area02 Connection Modifications AVEVA Area02 Workshop Cref recon on FITT elements AVEVA Addition of DESIGN Pipe MTO report e e AVEVA Design Data changes and reports TFS 85472 Valve V150 Leave Tube TFS 85183 Diagram SVG files e e TFS84727 Tagrule IDLN reset AVEVA LIBYs Drawings and additional PSPOOL data e TFS 85981 Change desc of the APPLDW DesignChecker Rules e AVEVA GTYP additions for Schematic Elements d TFS 85980 Reset HVAC Href Connections AVEVA Add Imperial MDB ALLIMP e e AVEVA Isodraft option files to display pdf plotfile AVEVA Drawing Libys Set Mstyid to O for all liby MRKP e e AVEVA Multiple Piping mods Areas 02 and 03 AVEVA Update to the SLH catalogue AVEVA Re modeled SLH in Area 1 AVEVA Cable Corrections AVEVA Add new termination to SLH assembly AVEVA SLH re modeled SLH in Area 2 d AVEVA Structural Joints update All Areas e AVEVA Extend status control data model AVEVA Apply status control values to Model e
54. EN 95 BS VST 1S TUNC ONS PRRRIR 95 Appendix B Details of Sample Project Changes eere eere 97 ACP gel le RETE IE E omm 97 juge 101 AMS PIOJO Eene 106 Appendix C Forming Structural Joint amp Fitting Images 109 OI em 109 S lung UD a JOINN MOGE 110 Setting up a Section Fitting in Model snnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn CN veu ca iac 110 icis d po Up ME 3D VIEW oipe E aa 111 Setting the Auto Colours rules and Translucencies ccccccssssseeeeeeeeeseceenseseeeeeseeeeesneseeeeeeeeoonnees 112 Taking the Screenshot eiii E stank scnveueeuvexusacttdensuueee dees 115 Namnen 115 dur C 7 WWW aveva com AVEVA Solutions Limited and its subsidiaries All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide This page is intentionally left blank Copyright 2015 8 AVEVA Solutions Limited and its subsidiaries www aveva com All rights reserved B9 vv Vias viv This document is intended to provide an overview of the migration process to AVEVA Everything3D 2 1 and will highlight project con
55. Error Details Item A Rule definition A b 23714 2253 HEIG Dynamic Rule ATTRIB DDESP 1 OF MDSSref OF STRUCTURE 200 mm Total Items 1 Upon selection of an Error the details of the error display in the Error Details section of the form and the appropriate elements from the new Application Data World are added to the 3D View Drawlist In the example below a Rule that cannot be evaluated is elaborated upon by the provision of the Rule definition Erter Details itemm 4 Rule definition p 237142253 HEH Dynamit Rule ATTRIR DOESP OF MOSSrel OF STRUCTURE 200 mm When the site conversion is complete the new Application Data World is available for use The naming of the APPLDW is taken from the Database name For example MDS TEMPLATES in the Database MDS DESITMPL BS is converted to APPLDW SUPPORT FRAMES BS If no suffix is found the APPLDW uses a number as the suffix For example SUPPORT FRAMES 1 D The database session must be saved to ensure that the converted Application Data World is stored It is recommended that the converted data is reviewed following conversion If conversion errors are not encountered the original MDS TEMPLATES site can be deleted from the database D It is recommended that the user creates a database listing of each MDS TEMPLATES site before deletion to allow for ease of restoration Copyright 2015 44 AVEVA Solutions Limit
56. Everything3D 2 1 Migration amp Interoperability Guide AVEVA E3D 2 1 is based upon a proven platform of technologies used to support a wider family of products supporting common capabilities such as multi user distributed and concurrent access to the design model and the comparison and update of information This allows global teams to collaborate in building fully detailed models from which construction ready drawings and BOMs can be automatically generated AVEVA ESD 2 1 contains the following principal modules e Model An interactive 3D design environment e Draw Facilitates the production of scaled annotated drawings from the 3D Model e soDraft Used in the production of piping isometrics As part of an integrated product solution AVEVA E3D 2 1 may integrate with AVEVA Engineering and Schematics products The Piping Integrator feature has been redesigned to bring the 3D Design P amp ID checking task to the daily workflow of a Piping designer Further AVEVA E3D 2 1 may be integrated with AVEVA NET epitomised by the Design in Context feature that allows the direct interrogation of the AVEVA NET Dashboard in the Model and Draw environment The Model module provides enhanced access to project Design database and functions The 3D graphics introduced at AVEVA E3D 1 1 are based on Microsoft DirectX delivering a faster and clear graphic AVEVA E3D 2 1 introduces a redesigned structural application that places the model at the centr
57. FC 001 would be J1S1 WEL PFC PFC 001 Copyright 2015 115 AVEVA Solutions Limited and its subsidiaries WWW aveva com All rights reserved
58. Geometry New colour RGB 222 176 63 These three colours do not correspond to the standard AVEVA 255 colour palette and therefore must be defined in the file pdms colours located in a standard E3D 2 1 installation at the following location C Users Public Documents AVEVA Everything3D Data2 10 DFLTS Copyright 2015 109 AVEVA Solutions Limited and its subsidiaries All rights reserved WWW aveva com AVEVA Everything3D 2 1 Migration amp Interoperability Guide The colours may be defined in the file as follows Colour Control File be 3 If the 50 standard PDMS colours are not required uncomment the following line HIDE STANDARD COLOURS n5 7 User defined colours are entered as Colour name gt Colour number gt 3 Where Colour name gt is a valid system colour and 5 lt Colour number gt is in the range 1 128 11 Edit the list below or cut amp paste example colours from AVEVA DESIGN DFLTS des colours 12 Note you can use RGB mix such as 13 RGB60 40 20 100 15 Uncomment and edit as required t png image colours 17 Joint Fitting Geometry New 18 RGB222 176 63 50 19 Owning Master z0 RGB84 130 171 51 21 Attached Slave 22 RGBO 173 131 52 The three colours have been designated as colours 50 51 and 52 Setting up a Joint in Model An image is required of every joint variation in the catalogue as well as a generic image for selecting the joint type 3 level SELE in the SPE
59. ICTU1 4 V1 4 fy JLDATU SUPPORTICTO1 A V1 S1 GENSEC 4 Eg PLDATU SUPPORTICTOT A VI ST PLDAT JLDATU En FIXING SUPPORT CTOT A VI STAJOINT1 gt PLDATU 5 Ba SPINE 1 gt FIXING Joint conversion attempts to re establish connectivity with the original template members including the appropriate joint references on the new GENSEC members and all rules currently associated with the support All SUBS and TMPL elements are copied directly into the new hierarchy 4 3 3 1 Convert Existing MDS TEMPLATES Sites To aid the conversion of Template Data a conversion tool is available in AVEVA E3D 2 1 Model to convert multiple instances of MDS TEMPLATES in one MDB into multiple Application Data Worlds The conversion process is undertaken at site level where either one or many sites can be converted per session Template conversion can be staggered across sessions ADMIN ur A conversion tool Convert Templates is provided in the Supports group Convert of the ADMIN tab Templates IL Supports D The Template conversion task is an administration task access is only available to users with administration rights or as a free user UDA updates may be required before template conversion can proceed please refer to Section 4 3 3 3 Missing UDA Definitions It is recommended that where the conversion of MDS Template data is required SCTN to GENSEC conversion should be undertaken using the Support Convert Template utility and not the Struct
60. Irule rule rule types FIXING rule description Rule for fixing I tmpRuleArray append rule Copyright O 2015 113 AVEVA Solutions Limited and its subsidiaries WWW aveva com All rights reserved rule object RULE Irule name Primary rule rule Irule types GENSEC Struclass EQ PRIMARY rule description Rule for primary I tmpRuleArray append rule rule object RULE rule name Secondary rule rule Irule types GENSEC Struclass EQ SECONDARY rule description Rule for secondary tmpRuleArray append rule Autocolour rules should be defined as follows in the application Data Display Rules Secondary Primary Structural Hull All Sections All Equipment All Hanaera 4 n Data Display Rules Secondary FIXING Structural Hull Zones All Sections All Equipment Al Hanaera 4 j E Data Display Rules Primary FIXING Structural Hull Zones All Sections Al Equipment Al Hanaera 4 Tm gt a NANGO Colour For Selected Rule Specific N so Expression Unset Translucency 196 Edges Off Colour For Selected Rule Specific ag 5 Expression Unset Translucency 3596 Edges On a NEEESERNI Colour For Selected Rule Specific ga Expression Unset Translucency 3596 Edges On AVEVA Everything3D 2 1 Migration amp Interoperab
61. LineType drafting drafting drafting drafting drafting drafting drafting drafting drafting drafting drafting drafting drafting drafting Solid draw 8001 gt solidwide draw 8036 gt solidxwide draw 8041 gt Dashed draw 8035 gt Dashedwide draw 8037 gt DashedXwide draw 8042 gt DashedDotted draw 8033 gt DashedDottedwide draw 8038 gt DashedDottedXwide draw 8043 gt DashedDoubleDotted draw 8034 gt DashedDoubleDottedwide draw 8039 gt DashedDoubleDottedxwide draw 8044 gt ShortDashed draw 8035 gt ShortDashedwide draw 8040 gt Example line type mapping xml xml is held in the Marine mar def folder LineType drafting ShortDashedxwide draw 8045 LineType drafting DashedAndsolid draw 8035 gt LineType drafting Track draw MyTrack lt LineType drafting System5 draw MySystemS gt LineType drafting System6 draw MySystem6 gt LineType drafting System7 draw MySystem7 gt The line type mapping file contains an entry for each AVEVA Marine Drafting line type required to be mapped to an AVEVA ESD Draw line type The Draw line types can be identified as the font name or font number Where the Draw line type is user defined the name of the line type equates to the description i e the text assigned to the FUNCTION attribute of the LINEST element Any non supported
62. MESIBSIDATA Eg APPLDA SUPPORTIF RAMESIBS DATAICT The application data world hierarchy separates the template Em APPLDA SUPPORTIFRAMESIES DATAIDT data from the 3D model in the sense that it no longer belongs Bg APPLDA SUPPORT F RAMES BSIDATA FT to a Site En APPLDA SLIPPORT F RAMESIBS DATAFB Pn APPLDA SLIPPORT F RAMESIBS DATAGT En APPLDA SLIPPORTIF RAMESIBSIDATAVT D By default application data world elements are not visible to the user in the Model Explorer as they are considered to be administrative elements Copyright O 2015 41 AVEVA Solutions Limited and its subsidiaries WWW aveva com All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide a En APPLOA SUPPORTIF RAME SB SDA TAFT ZONE SUPPORTIFRAMES BSIFTUS HORI b nil ZONE SUPPORTIFRAMESI BSIF TO3 VERT E ZONE SUPPORT FRAMES BSIFTOUd HORI b EB STRU SUPPORT FRAMES BS F TDAH I Template data is categorised by type gt BR STRU SUPPORT FRAMES BS F TD4HI2 4 RA STRU SUPPORT F RAMES BS F TOHA Template data is contained within a STRU FRMW rir rt SO Ane san Rees E tt irs I hierarchy All SCTN elements and associated sub pn a members are converted to the GENSEC format Bg POINS 1 Pn POINSP 2 b GENSEC SUPPORTIF RAMES BSIF TO4H 3 V1 4 Ff STRU SUPPORTICTO14 Existing template joints for example SNOD SJOI FITT SIE ERN ED EE and CMFI are all converted to the single format of p GENSEC SUPPORT CTUT A BAR 1 E GENSEC SUPPORT
63. NGA SUBS1 cannot be evaluated CYLINDER 3 of SUBSTRUCTURE SUPPORT SPECIAL CYLI RULE DEFINITION Rule for attribute POS of CYLINDER 3 of SUBSTRUCTURE SUPPORT SPECIALS BS LIGHTING 1 SUBS1 cannot be evaluated CYLINDER 4 of SUBSTRUCTURE SUPPORT SPECIAL CYLI RULE DEFINITION Rule for attribute POS of CYLINDER 4 of SUBSTRUCTURE SUPPORT SPECIALS BS LIGHTING 1 SUBS1 cannot be evaluated CYLINDER 5 of SUBSTRUCTURE SUPPORT SPECIAL CYLI RULE DEFINITION Rule for attribute POS of CYLINDER 5 of SUBSTRUCTURE SUPPORT SPECIALS BS LIGHTING 1 SUBS1 cannot be evaluated BOX 2 of SUBSTRUCTURE SUPPORT SPECIALS BS BOX RULE DEFINITION Rule for attribute POS of BOX 2 of SUBSTRUCTURE SUPPORT SPECIALS BS LIGHTING 1 SUBS1 cannot be evaluated CYLINDER 1 of SUBSTRUCTURE SUPPORT SPECIAL CYLI RULE DEFINITION Rule for attribute HEIG of CYLINDER 1 of SUBSTRUCTURE SUPPORT SPECIALS BS LIGHTING 2 SUBS1 cannot be evaluated BOX 1 of SUBSTRUCTURE SUPPORT SPECIALS BS BOX RULE DEFINITION Rule for attribute POS of BOX 1 of SUBSTRUCTURE SUPPORT SPECIALS BS LIGHTING 2 SUBS1 cannot be evaluated z CYLINDER 2 of SUBSTRUCTURE SUPPORT SPECIAL CYLI RULE DEFINITION Rule for attribute POS of CYLINDER 2 of SUBSTRUCTURE SUPPORT SPECIALS BS LIGHTING 2 SUBS1 cannot be evaluated x CYLINDER 3 of SUBSTRUCTURE SUPPORT SPECIAL CYLI RULE DEFINITION Rule for attribute POS of CYLINDER 3 of SUBSTRUCTURE SUPPORT SPECIALS BS LIGHTING 2 SUBS1 cannot be evaluated y Total Items 18
64. O7C Reset Spref on Standalone LUG fixings UDA modifications to resolve Integrator issue Remove obst value from flange bolt holes Restore Session 2 to db MASTER DICT Fix to SP DRO7C SHOP Question Major OGLAEND and CABL Update with Part Worlds MDS Unique Naming turned off after install A3B Spec Update with Spectacle Plates Correct MDS templates for FT30 standards BS and AISC Sample data for Cable Enhancements E3D 1 1 Pipe Tapping Spec for E3D Remove DB MDU CATA7360 OLD from ALL mdb Hole Management Description Correction E3D2 Struc CATA dbs top level elements Integrator UDAs Change HVAC UDA value from Bore to Length Flat Oval PZ axis settings SKEY Data for Legrand Salamandre Cable Trunking Mod to PTCDIR for MDS PTSE ATO9 P13 amp P14 Add DB Descriptions to supplied dbs Add FLTH prop to DIN valves AATA200 P3 4 amp DATA200 P3 4 OFTOL addition Spec Update to A3B Spectacle Plates PCOM5O CATR and DETR Fix to Support Data MDS Initiate Supports Data major upgrade Add MET Marine Backing Sheets Master Extend VVALs for STRUCL on GENSECs and PANELs DESPAR correction to Channel Profiles Rename Pipesketch UDA world Plot Style Data in PSTYTB Oglaend FOE Specs 99 AVEVA Solutions Limited and its subsidiaries All rights reserved AVEVA E3D 2 1 2 1 0 0 o o o e e o o o e o o e e e o o e o o e o o o e o o e o o o e e o o e e o o e e o o o o e o e o o e o o o e o e o
65. P3 4 Copyright 2015 AVEVA Solutions Limited and its subsidiaries All rights reserved 49 3 Purpose PURP Pwisibiity PVIF NULL v The update involves setting the P Point offset tolerance OFFTOL on all the P Points of the element required to be sloped from to In the example here the OFFTOL is set to 12 degrees to allow for a maximum possible slope of 1 in 5 11 7 degrees WWW aveva com AVEVA Everything3D 2 1 Migration amp Interoperability Guide soupy Setting the OFFTOL allows the piping user to directly slope away from the identified P Point using the Piping user interface ga Component Orientation Point Direction W 1 4321 D WRT 4in75 Branch v Slopes Arrive 1in40 Leave 1in40 Branch None v Multi Slope Current Point P1 Arrive vi 4 4 2 Piping amp Supports Although not detrimental to the use of the data in AVEVA ESD 2 1 where migrating supports data from AVEVA PDMS or Hull amp Outfitting 12 1 SP4 an Administrator may consider removing the MDS updates from piping elements Reducers Tees and Elbows This can be considered as the Supports application no longer requires such modifications for the creation of Trunnions 4 5 Laser A key facet of the AVEVA E3D 2 1 product is the use of and interaction with laser data in the Model and Draw environments Key laser features improved upon and intr
66. Please refer to the supplied PML function for details 5 5 Using a Marine Project with Draw In addition to the advice given thus far this Section describes the specific actions and considerations recommended to prepare an AVEVA Marine Drafting 12 1 SP4 project for use in AVEVA ESD 2 1 Draw 5 5 1 Draw System Defaults For a Marine project it is advised to create a project specific version of the Draw System Default file DRA GEN SYSTEM pointing to the marine default libraries and styles The project specific version should be stored in the project defaults folder Y lt project gt DFLTS 5 5 2 Drawing Database Storage As previously described Drawings opened and saved in AVEVA E3D 2 1 Draw cannot be opened in AVEVA Marine Drafting 12 1 SP4 D When considering the saving of a Drawing in AVEVA E3D Draw the AVEVA Marine Drafting user should note that unlike AVEVA Marine Drafting the closing of the Drawing and Draw Canvas does not invalidate the opening of the Sheet or any changes that have been made the Sheet will be saved and transformed on a Savework Copyright O 2015 63 AVEVA Solutions Limited and its subsidiaries WWW aveva com All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide If there is a project requirement not to mix transformed and un transformed drawings in the same PADD database it is recommended to create a new PADD database for AVEVA E3D drawings A new MDB for AVEVA ESD D
67. TFS 162761 TFS 182706 TFS 184896 AMS Project Origin Ref AVEVA AVEVA AVEVA TFS 163736 TFS 164870 AVEVA AVEVA AVEVA AVEVA AVEVA AVEVA Project Change Description Add MDS and related projects into Standard Sample Data Version Number format changed to suit product Major Sample Data Overhaul for E3D 1 1 Create APS ACP Create DRAW Module Definition Piping Catalogue and Piping Design Sample Data updates Project Description PDF files E3D Bolt Weight Update including STD ISO opt file Relocate MDS dbs Move MDU CATA db from ACP to APS Apply Optional Upgrade to project dbs Status data for subset of pipes Removal of xxxMAR Folder BS JOIST PLINES need CCON ANY Linkdoc XPRD dbs VSI View Section Indicator DRAW Libraries Set Isometric preview to PDF Support Reports in DFLTS DATA Supports Symbol File added to ISO OPT Files Commenting Report Templates Admin Team and User for Structures UI APS Support Template Sample Data Updates Rev2 APS Rebuild HVAC DRAW sheets Project Change Description AVEVA Marine Sample Create AMS project Path correction in dO65 file Add AMSDRG evar to evarsAvevaMarineSample bat Change MPROJECT LINKDOCS db to Acc Multiwrite Multiple Updates to Project SBD E3D DRAW TRANSFORM SETTINGS Addition APPLDW re reference to AMS not MTP dra gen system file addition to AMSDFLTS Add Steelwork CATA DBs to all MDBs SUPPORTS MDBs modification ALL ADMIN MDB modification to fix s
68. U EQUIP SUPPORT FF FRMW ROW 3 BRACING FF FRMW ROW 5 BRACING The Model Explorer highlights the result of the conversion process P FRMW EL 100000 ee The utility converts SCTN elements to straight GENSECs i e the 4 F FRMW EL 104880_TOS l SEFR EL 4 104880 TOS PLATE GENSEC s SPINE only owns two POINSP elements GENSEC 1 GENSEC 2 Any connections i e SNOD SJOI elements are converted to the wane equivalent GENSEC elements of JLDATU PLDATU FIXING and all i rs unn connectivity remains as are all joints and fitting Specification References 4 Ey JLDATU 1 a jg PLDATU 1 PNOD PJOI elements say for baseplate joints on the bottom of columns c bae are converted to the new ENDATU element and the SpecRef maintained 4 bm JLDATU2 4 bg PLDATU 1 le FIXING 1 Conversion Summary Project APS The utility presents a conversion summary and Description AVEVA Supplied Sample Plant Data maintains a log file to which any errors in the Number AFS 2 1 0 Betad ID ProjAPS p conversion process are written Log File 3N_USER LogConvertedSections trt 4 1 2 Catalogue Joints amp Fittings A new profile catalogue based on the latest National standards has been developed for AVEVA Catalogue 2 1 Translation of Joints and Fittings is required to ensure compatibility with the P line and Profile parameter of the new profile catalogue Where joint and fitting catalogues are to be translated this should be done prior to updatin
69. Unset PURP on Pipe Fabrication Data 95599 TFS 95617 DDATA Setting for Pipe Fabrication TFS 96617 Data for Pipe Fabrication fix to 94898 TFS 95636 Replacement Datasheet Templates TFS 96919 Pipe Fabrication fix to 96856 Iso Sketch types TFS 95482 BEND End Connection Correction TFS 97455 Replacement Datasheet Settings XML file TFS 95482 BEND End Connection Correction BWD should be TUB AVEVA Equipment associations update TFS 101110 Add Tube on drain for 80 B 14 AVEVA Add sample MEI Data TFS 64297 Styles amp Representation Rulesets for Piping Insulation TFS 110330 NSBC and sloping pipes Additional HVAC Sketch backing sheet column TFS 89552 ROTATE He i Add DESC to Area 03 Skids for GPSET use TFS 113588 Equipment C1101 Nozzle Elevation Change TFS 112167 Structural PBS Examples Hs aaa Comment Database TFS 110168 Sample Sheet SLABs set to LVIS True TFS 111478 Spectacle blind corrections for schematic data Copyright 2015 103 AVEVA Solutions Limited and its subsidiaries All rights reserved AVEVA E3D 2 1 2 1 0 0 o e o o o o o o e o o o e o o o o o o o e o o o e o o o o e o e o o o o o o o o o o o o o o o e e o o o o o o o e o o o e o o o o o o e o o o e WWW aveva com AVEVA Everything3D 2 1 Migration amp Interoperability Guide AVEVA E3D 1 1 1 1 0 7 AVEVA E3D Origin Ref 2 1 2 1 0 0 Project Change Description AVEVA Add ENGI dbs to ALL mdb AVEVA E
70. VA ESD it is possible to load icons from resource files and from png files Icons cannot be loaded from resource files in PDMS so all icons should be loaded as png files in code shared by PDMS and AVEVA ESD 7 8 6 PML code setting view properties AVEVA E8D view properties are upwards compatible with AVEVA PDMS and Hull amp Outfitting 3D views but AVEVA ESD has view properties that are not available on PDMS views e g shadows gradient and anti alias When writing shared PML code that modifies view properties care must be taken to avoid setting properties that are not available in AVEVA PDMS and Hull amp Outfitting 7 8 7 Changes to PML TABSET gadgets The PML syntax for visible for a tab on a tabset has been changed so that it is in line with all of the other gadgets so visible false will hide a tab The syntax selected true will now select a tab Therefore on a tabset the visible syntax should be changed to selected Copyright O 2015 89 AVEVA Solutions Limited and its subsidiaries WWW aveva com All rights reserved 4 E TNNT lt Ts Appendix A For full details please refer to the PDMS 12 1 User Bulletin Upgrade overview A number of the enhancements made at PDMS 12 1 require an upgrade to the database Each of these individual changes is referred to as a Part Upgrade In normal use the whole project will be upgraded to the latest version though each part upgrade is in general designed to b
71. VA Global Server 3 2 1 Note Includes separately licensed products AVEVA Global Hub and AVEVA Global Satellite AVEVA Hull amp Outfitting 12 1 4 amp associated products Fix Release 28 AVEVA Instrumentation 12 1 3 Fix Release 6 AVEVA Integration Service 1 2 0 1 Note This is the primary route for compatibility with AVEVA P amp ID 12 1 2 Fix Release 9 The service also supports compatibility with AVEVA Electrical 12 1 3 and AVEVA Instrumentation 12 1 3 AVEVA NET Workhub amp Dashboard 5 0 1 AVEVA PDMS 12 1 4 amp associated products Fix Release 28 AVEVA PDMS VPRM Gateway 5 6 0 AVEVA Plot Utilities 12 1 5 Copyright 2015 i WWW aveva com AVEVA Solutions Limited and its subsidiaries All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide e AVEVA Pipe Stress Interface 2 1 0 e AVEVA PML Publisher 2 2 0 e AVEVA Review 12 2 0 Fix Release 10 e AVEVA Shared Services 3 3 0 The following LFM products are compatible with AVEVA Everything3D 2 1 0 e LFM Server 4 4 0 6 2 Interoperability AVEVA PDMS or Hull amp Outfitting 12 1 SP4 Where required AVEVA E3D 2 1 and AVEVA PDMS or Hull amp Outfitting 12 1 SP4 Fix Release 28 products may operate on the same project With such a project setup it is strongly recommended and is mandatory for some operations that the latest version of AVEVA Administration is used for all on going admini
72. VEVA Everything3D 2 1 AVEVA E3D 2 1 release usually supplied by download from a secure website self installs using standard Microsoft installation procedures Please contact your local AVEVA office if a DVD installation is required As found with other AVEVA products the release is typically installed to individual PCs with a Microsoft Windows operating system with the license server and file installed to a networked Microsoft Windows server In addition the project data is typically located on a separate server AVEVA E3D 2 1 is a full release that may be run alongside and in conjunction with AVEVA PDMS and Hull amp Outfitting 12 1 SP4 Fix Release 28 onwards AVEVA E3D 2 1 may also be used in conjunction with other products in the AVEVA product portfolio please refer to Chapter 6 Compatibility amp Interoperability AVEVA ESD 2 1 requires the use of AVEVA Catalogue and AVEVA Administration these are distributed and installed with it but are licensed separately and may also be used for AVEVA PDMS Hull amp Outfitting Engineering and Schematics products 2 1 Workstation Configuration The following configuration is recommended in the use of AVEVA E3D 2 1 A 64 bit operating system is required for the installation of AVEVA Everything3D 2 1 and for the visualisation and use of laser data in the application Windows 7 Professional or Enterprise Service Pack 1 Windows 8 1 Microsoft NET Framework 4 0 Sup
73. a One or more databases are required from the following list MDS DESITMPL GRI MDS DESITMPL PIHASA MDS DESITMPL PSL 4 Add the New Steelwork Reference Databases D MASTER STL PROFILE CATA MASTER STL PROFILE SPECS MASTER STL JOINTS FITTS MASTER STL JOINTS FITTS TMPL Update all MDBs to re add the included new databases D Where user modified databases are being included within the AVEVA E3D 2 1 environment additional update steps may be required for use in the supports application These are detailed in subsequent sections Copyright O 2015 39 AVEVA Solutions Limited and its subsidiaries WWW aveva com All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide 4 3 2 Supports Application Defaults The new Supports application uses an application defaults database MDS APPDEFAULTS to store user customisable design data in the same way that the previous MDS application did within AVEVA PDMS 12 1 SP4 and AVEVA E3D 1 1 Several updates have been made to the structure of the MDS APPDEFAULTS database at E3D2 1 which means that user maintained versions of this database will need to be upgraded to the new version before use The provided upgrade tool allows the user to easily update existing standards or add application defaults for any new standards that have become available The tool is relevant where upgrading from a previous version of a project or continuing work on a project that uses a pre
74. abase or picture file D The Transformation process and the use of the user interface in the ADMIN tab is as previously described the marine transformation process is triggered automatically in a marine project The overall requirement for the transformation process is to ensure the Drawing deliverable is identical to that found in AVEVA Marine Drafting 12 1 SP4 However some drawing entities may lose their intelligence and connection to the Model where a functional difference exists between AVEVA E3D Draw and AVEVA Marine Drafting The following sections will explain in more detail the effect on various kinds of entities in an AVEVA Marine Drafting drawing when undergoing the transform operation 5 5 3 1 Form Views Where an AVEVA Marine Drafting Drawing contains a Form the Form is converted during the transform operation to an AVEVA ESD Draw Backing Sheet BACK The Backing Sheet is referenced by the Sheet via the Backing Sheet Reference BSRF attribute The converted Backing Sheet is stored in a Library local to the Drawing Any Text originating from Form rules will be converted to Text Primitives TEXP and will lose their original intelligence As part of the transformation process 2D geometry and texts are stored in the PADD Database and the Administrator should note and correct any font or line style discrepancies Potential discrepancies in line styles and text fonts during the transformation process are described in Section
75. ails the process of migrating data from AVEVA PDMS Draft 12 1 SP4 and AVEVA Marine Drafting 12 1 SP4 to AVEVA E3D 2 1 Draw 5 1 Module Definition Prior to the use of an AVEVA PDMS or AVEVA Hull amp Outfitting 12 1 SP4 project in AVEVA ESD 2 1 the Administrator must define the Draw module Admin 1n This definition is achieved by opening the migrated Project in AVEVA Administration 1 4 and performing a Savework The Draw module is automatically xu defined at this point D It should be noted that Users can no longer define new modules in AVEVA Aaministration Eee E DOE rb ores tlle ee Same Without the correct Draw module definition the referenced EAS n E UES AU EE lis ETE SE project will not be opened and a notification will be displayed to the user 5 2 Draw Transformation Visual elements originally created by AVEVA PDMS Draft or AVEVA Marine Drafting must be transformed before being viewed or modified by a Draw user in AVEVA E8D 2 1 The transformation of visual elements such as Sheets Backing Sheets Symbol Templates and Sheet Templates is only necessary when migrating AVEVA PDMS or Hull amp Outfitting 12 1 SP4 project data to AVEVA E3D 2 1 Draw Transformation is not required for new projects created with AVEVA E8D or for new visual elements created in AVEVA ESD Draw Once transformation is complete and a Save Work has been applied it is no longer possible to view or modify the sheet using AVEVA PDMS Draft or AVEVA Mari
76. ant to AVEVA E3D 2 1 where there is a wish to make use of this feature Please refer to the AVEVA Hull amp Outfitting 12 1 SP3 User Bulletin Chapter 2 Upgrading from Previous Release for further information Copyright 2015 23 www aveva com AVEVA Solutions Limited and its subsidiaries All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide 3 2 Preparing an AVEVA PDMS or Hull amp Outfitting 12 1 SP4 Project There are no major database changes between PDMS 12 1 and AVEVA ESD 2 1 However if PDMS 12 1 is to be used on the same project as AVEVA ESD it is important that PDMS 12 1 SP4 Fix 28 or later is used Chapter 6 Compatibility amp Interoperability outlines the use AVEVA E3D 2 1 alongside AVEVA PDMS or AVEVA Hull amp Outfitting 12 1 SP4 A project that uses only AVEVA PDMS or AVEVA Hull amp Outfitting 12 1 and or AVEVA E3D has no need for legacy text formats so all databases could be migrated to the current Unicode database format However this is not mandatory D The encoding of a database can be checked using the command Q DBTEncoaing It is of course necessary to ensure that the AVEVA ES3D environment variables are set up to access the PDMS project this can be achieved by adding a call to the project in custom evars bat In order to secure legacy data projects may continue to reference 12 0 databases in read mode as foreign databases However customers are recommended to
77. applications have been replaced by a new version However the Structural and Supports disciplines have undergone a major redesign at AVEVA E3D 2 1 which means customers are strongly advised to evaluate the need for their own customisations A key example in Structural and Supports is the replacement of SCTNs with GENSECs If customers have modified AVEVA delivered PML then each case will require evaluation as extensive changes to AVEVA applications has taken place at this release The following applications are not in the AVEVA ESD 2 1 Model amp Draw modules e ASL has been replaced by SLH e Hangers and Supports PML code e Penetrations utility e Assembly Planning e Room Design e AVEVA Outfitting Supports e Equipment Seat Application e AutoDraft AVEVA ESD has a Piping application which is largely compatible with the PDMS Piping application PDMS piping application customisations may need modification to be used in AVEVA ESD AVEVA E3D has an improved Search and Collections tool PML Lists are not implemented in AVEVA ESD A new interface is available to replace PML lists with collections See PMLLIB common listinterface pmlob j Handling of 3D views has changed in AVEVA E3D Model Some of the functions found on buttons on 3D views in AVEVA PDMS and Hull amp Outfitting are located on the 3D View tab in Model 7 6 AVEVA PDMS Draft amp AVEVA Marine Drafting Customisations some additional considerations apply 7 6 1 Acces
78. bed above e Create a new View Task A new View Task is created that calls a PML function to manipulate either the View parameters to update the gridline annotation or manipulate the generated annotation For example NEW TASK equipment 2 S1 V1 VTask3 SPPURPOSE ABAV FUNCTION Modify View Grid Parameters PMLFUNCTION MODIFYVIEWGRIDS define function modifyViewGrids arguments is ARRAY At view IviewRefe ce Set grid parameters Copyright O 2015 62 AVEVA Solutions Limited and its subsidiaries WWW aveva com All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide AGSIDE TOP LEFT Update the grid annotation UPDATE GRIDANNO endftunctiorn 3 4 2 The Isometric ADP The Isometric ADP application uses the grid system to calculate the nearest gridline to the spool origin This is handled by a PML function specifically designed to suit a particular project since different projects may have different model data In the case of the AVEVA supplied sample project the PML function is as follows PMLLIB isometricadp userfunctions isoapskeyplan pmlfnc At AVEVA E8D 2 1 this has been modified to extract data using the new Reference Grids to produce this example result Where the relevant AVEVA functions previously supplied have been modified or a user defined function has been created and are required to use the new Reference Grid element they must be upgraded in a similar way
79. but this would need careful consideration Please refer to Section 7 8 Writing PML code to work in both PDMS amp AVEVA E3D for further information It should be noted that PML can always access Engineering and Schematics data as AVEVA ES3D always operates in integrated mode Please refer to the NET Customisation Guide the Software Customisation Guide and the Software Customisation Reference Guide for further information on the use of C and PML in forming AVEVA E3D 2 1 customisations D AVEVA E3D 2 1 utilises Infragistics 15 1 Any C customisations that utilise Infragistics via a Design Licence must use the same Infragistics version Note that the AVEVA GridControl and ExplorerControl can be used on PML forms without having to have an Infragistics Design licence 7 2 General Considerations The following are general considerations to the migration of customisations to AVEVA E3D 2 1 7 2 4 Environment Variables AVEVA E3D and AVEVA PDMS and Hull amp Outfitting rely on the use of environment variables for various aspects of configuration AVEVA ESD has a different set of Environment Variables to PDMS Most notably for PML developers PMLLIB is unchanged but PDMSUI has been replaced by PMLUI There is a compatibility mode so most applications will work using PDMS environment variable names Where AVEVA PDMS and Hull amp Outfitting environment variables are used in PML code these should be changed to the equivalent AVEVA E3D envir
80. by a double arrow to indicate it has been transformed A Message rem Cannot display STAB00001 S1 it can only be accessed using AVEVA E3D Draw Any attempt to open the transformed Sheet in AVEVA PDMS Draft or Marine Drafting prompts a Message informing the user that the Sheet has been transformed and may be accessed using Cox AVEVA E3D Draw 5 2 2 Library Elements Visual library elements namely Backing Sheets Overlays Symbol Templates IsoDraft Symbol Templates and Sheet Templates must be transformed before they can be viewed or modified in AVEVA E3D Draw On being transformed it will no longer be possible to view or modify them using AVEVA PDMS Draft or AVEVA Marine Drafting AVEVA PDMS Draft or AVEVA Marine Drafting may still reference transformed AVEVA E3D Draw library elements but this is not recommended as any changes made by E3D Draw may not be represented correctly In a mixed project environment it is therefore recommended to copy library elements before modifying them in AVEVA ES3D Draw The modified library elements can then be referenced exclusively by AVEVA ESD Draw sheets Transformation can be made via a bulk transformation through the Draw Administration User Interface or by using a designated command 5 2 2 1 Draw Administration User Interface D d EN onn Library Elements may be transformed via the All button in the Transform group of I sheets the ADMIN tab in Draw The action applies to the Current
81. ccess to the ADMIN tab is only available to users with administration rights or as a free user D The Refresh Overlay result can be viewed in the Command Window where open 5 2 4 2 Command Syntax One can refresh Overlays using the command REFRESHOVERLAYS THUMBNAILS NOTHUMBNAILS NOPROMPT The default command is THUMBNAILS as although it slows the conversion process there are not expected to be very large numbers of Overlay elements D wopPRoMPT is automatic in tty mode in graphical mode the default is to prompt you to confirm transformation When the refresh Overlay process is complete a log file is created and stored in the directory 9eAVEVA DESIGN USER e The file name is of the form DraftLibraryRefresh 20141114 144807 log The log file details the transformed elements Copyright O 2015 57 AVEVA Solutions Limited and its subsidiaries WWW aveva com All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide 5 3 Modification of Library elements In addition to the transformation of Library elements for use in AVEVA ESD Draw a Draw Administrator should also consider updating Draw library elements to account for Model changes at AVEVA E3D 2 1 e g supporting Libraries for the tagging and representation of Reference Grids In addition a Draw Administrator may consider changes to Draw library elements in order to best utilise Draw functionality in both Plant and Marine projects e g the transformation
82. cial templates and hanger templates for the project ORI framework templates are based on the selected framework template Creation Zone and Framework Templates a 2 ml Zone for Supports Framework Templates Special Templates Hanger Templates ZONE SUPPORTS AREAD1 ZONE SUPPORTS MDS ZONE SUPPORTS AREAD2 WORKSHOP MDS DEF ZONE ZONE SUPPORTS AREAD3 MDS Standards Supports Zone Total Items 6 In regards to the setting of the Support Zone default it is important to note that AVEVA PDMS Supports and AVEVA E3D 2 1 Supports cannot share the same Zone The purpose of the Zone should also be set as defined within the Support Admin Data form in AVEVA Catalogue 2 1 By default the Zone Purpose is set to SUPP Once set the selection is stored in AVEVA_ DESIGN DFLTS and is retained for each user session 4 3 3 3 Missing UDA Definitions Prior to Support Template conversion UDA updates may be required to support the conversion of SCTN to GENSEC elements UDA updates would be required where users have appended their own attributes to SCTNs within a project Because we are converting from SCTN to GENSEC we need to ensure that GENSEC elements can store the same UDA data that a SCTN can otherwise we risk losing user data when performing the conversion Th We have detected missing UDA sha ela dog aera isan A Message is prompted on clicking the Convert Templates button converted to GENSEC elements during in the Supports group o
83. ddin MyDataAddin MyDataAddin MyDataAddin MyDataAddin MyDataAddin MyDataAddin MyDataAddin MyDataAddin MyDataAddin MyDataAddin MyDataAddin MyDataAddin MyDataAddin Name AVEVA MyD AVEVA DES AVEVA OUT AVEVA TAG AVEVA SC AVEVA DRA AVEVA OU AVEVA MyD AVEVA ADN AVEVA MyD AVEVA DRA AVEVA DES AVEVA MyD AVEVA DES AVEVA MyD AVEVA DES AVEVA MyD AVEVA MyD AVEVA MyD AVEVA MyD AVEVA MyD AVEVA MyD AVEVA MyD AVEVA MyD on yDa in y ab Butt MyDataAddi AVEVA MyD StateButton MyDataAddin AVEVA MyD 7 4 1 Customising Ribbon Menus with PML The Software Customisation Guide describes how to use PML Command Objects how to modify ribbon menus and how to approach common customisation scenarios It includes sections on e How PML functions PML commands and ribbon tools are linked together e Replacing a standard product function invoked from a ribbon menu button or other tool with a customised version of that function e Removing or hiding a standard product function e Adding a new function to a tab e Adding a new tab containing buttons for user functions e Adding a new PML add in application 7 4 2 PML Add in files PML Add in files are used to customise applications in AVEVA PDMS and Hull amp Outfitting This mechanism also works in the AVEVA E3D MODEL module but with one major change the menu definition callback Object declaration is ignored In AVEVA PDMS and Hull amp Outfitting the PML object specified
84. ds are present in the AVEVA PDMS Hull amp Outfitting Model Explorer but appear as an Unknown Type 6 2 2 2 Supports Data Where a customer intends to use MDS at PDMS12 1 SP4 with AVEVA E3D 2 1 it is recommended that the administrator replaces the foreign reference to database MDS CATA DB Number 7320 from the MAS project version or ACP at E3D1 1 to the AVEVA E3D 2 1 version of this database This substitution will not require any additional upgrades to the project Please refer to Section 4 3 Supports for further information on the migration and interoperability of Supports data 6 2 2 3 Saved Views The changes in the 3D graphics between AVEVA PDMS Hull amp Outfitting and AVEVA E3D mean that the files saved when module switching are incompatible By default they will be in different locations so there is no problem and this arrangement is recommended If however the same User folder is used for both AVEVA E3D and PDMS an error will be detected when trying to read the serialized status in PDMS after running AVEVA ESD and the 3D view will not be restored Copyright O 2015 75 AVEVA Solutions Limited and its subsidiaries WWW aveva com All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide User Options File a 2 779 Method amp Ci Usersi54M 1 MAC AppData LocahTempide F GPHVIEWOPT DEFALULT sBOOLEAN not s gphview pmidat is corrupt found Son Spi 6 2 3 Outfitting
85. e Destination Configuration Attributes For more information on the general functionality of Compare Update please refer to the Compare Update User Documentation For further information on new features introduced at AVEVA E3D 2 1 please refer to the AVEVA E3D User Bulletin Configurations from earlier versions of Compare Update require upgrade at AVEVA E3D 2 1 A member of team CUADMIN can trigger an automatic upgrade by opening the Options dialogue If upgrades are available a prompt will be displayed to proceed Once completed a log file will be displayed This file is stored in the folder CUConfigs2 0 under the project defaults folder The file will list which configurations have been upgraded or skipped along with any warnings D The upgrade will not overwrite any configurations already defined in the later version It will first upgrade available configurations from AVEVA Engineering 14 1 and then from earlier versions of AVEVA PDMS or Hull amp Outfitting 12 1 SP4 Note that configurations with a source AVEVA P amp ID will require a service port number to be added manually Copyright 2015 51 AVEVA Solutions Limited and its subsidiaries WWW aveva com All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide Copyright O 2015 52 AVEVA Solutions Limited and its subsidiaries WWW aveva com All rights reserved A J Sb j r ANN AV TAB AA TR The following Chapter det
86. e optional In other words the 12 1 software can work with a database that has not been upgraded and will degrade gracefully that is it will continue to work although some new functions may not be available This means that it is possible for customers to continue to work with Foreign DBs which may be shared with 12 0 or earlier projects and which have not been upgraded included in their projects An example would be a Corporate Catalogue DB used for 12 0 and multiple projects Databases which have not been upgraded will however be read only The following warning will appear when opening an MDB from a project that has not been upgraded x There are databases with an upgrade number that does not correspond to the upgrade number of this software 12010103 There are 2 databases that are not upgraded to current version They are opened as read only This warning or similar indicates that the project needs to be upgraded to the latest version in order to allow write access All the Part Upgrades will be run by a DBUPGRADE command which converts a PDMS 12 0 project to 12 1 This is initiated from Admin using the following commands in the Command Pane or TTY mode LOCK dbupgrade project to latest unlock This procedure may also be used with Global projects if some additional precautions are taken A brief summary is given below further details are given in the 12 0 to 12 1 Upgrade manual Earlier projects should first b
87. e ADMIN tab is only available to users with administration rights or as a free user The Transformation result can be viewed in the Command Window where open 5 2 1 3 Command Syntax The Draw command TRANSFORMSHEETS operates on the current element and the hierarchy below it e g it could be utilised at the Sheet Drawing Registry Department or World levels TRANSFORMSHEETS THUMBNAILS NOTHUMBNAILS NOPROMPT The default is NOTHUMBNAILS to aid the speed of transformation The GENERATETHUMBNAILS command can be called separately Copyright 2015 54 AVEVA Solutions Limited and its subsidiaries WWW aveva com All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide NOPROMPT is automatic in TTY mode in graphical mode the default is to prompt the user to confirm transformation When the transformation process is complete a log file is created and stored in the directory 9eAVEVA DESIGN USER e The file name is of the format DraftTransform 20141114 144807 log The log file details the transformed elements A query of transformed Sheets may be formed using the syntax Q ACPICT ACPICT Only equates to a Sheet created or transformed in AVEVA ESD 2 1 5 2 1 4 Transformed Sheet in AVEA PDMS and Marine Drafting EN di tei iari An AVEVA E3D Draw transformed Sheet does still appear in the AVEVA a x PDMS and Marine Drafting 12 1 SP4 Explorer The transformed Sheet is H S LIBY STABODOO1 LIBY denoted
88. e World AVEVA Steelwork Cata PANE FITT modifications AVEVA Hide Panel fittings with no geometry design e para AVEVA Further Steelwork Cata PANE FITT modifications AVEVA Ring Plate and Bracing Modification AVEVA Remove PPM Production Prep Model Panel Fittings TFS 146586 Unset P2 for FLAN elements amp PTREF additions AVEVA Fix to OLET PTSET BBTY5XT P3 2 AVEVA Add MDS and related projects into Standard d Sample Data AVEVA Version Number format changed to suit product d AVEVA Major Sample Data Overhaul for E3D 1 1 Create hd APS ACP AVEVA Create DRAW Module Definition Copyright 2015 100 www aveva com AVEVA Solutions Limited and its subsidiaries All rights reserved Origin Ref TFS 80631 AVEVA TFS 81139 AVEVA AVEVA AVEVA TFS 142894 AVEVA TFS 168041 TFS 162761 TFS 68017 TFS 185450 TFS 185610 APS Project Origin Ref AVEVA AVEVA AVEVA AVEVA AVEVA AVEVA AVEVA TFS 78211 AVEVA TFS 81362 SI 50220 SI 50292 TFS 80262 TFS 77632 TFS 79012 AVEVA AVEVA TFS 80350 TFS 78047 AVEVA TFS 81229 TFS 81519 TFS 81605 Project Change Description Piping Catalogue and Piping Design Sample Data updates Project Description PDF files E3D Bolt Weight Update including STD ISO opt file Relocate MDS dbs Move MDU CATA db from ACP to APS Apply Optional Upgrade to project dbs Status data for subset of pipes Removal of xxxMAR Folder BS JOIST PLINES need CCON ANY Admin Team
89. e across a number of laptop hardware specifications Desktop score based on System information Processor Intel R Xeon R CPU E5 1603 v3 2 80GHz Installed Memory 8 00GB 64 bit Operating System 2 3 Server Configuration The following configuration is recommended in the use of AVEVA E3D 2 1 with a server configuration A 64 bit operating system is required for the installation of AVEVA Everything3D 2 1 Windows Server 2008 R2 Service Pack 1 Windows Server 2012 R2 Microsoft NET Framework 4 0 Supplied with AVEVA E3D 2 1 and installed if necessary Operating System s Intel x86 or x64 compatible Modern architecture multiple core processors Processor Type Speed recommended AVEVA ESD 2 1 has been verified using a Server Machine with 4 core CPUs 16 GB RAM Additional RAM increases the caching capability and thereby the performance The amount of disk space should be configured according to the customer s requirement based on the number and size of projects incl supporting laser data Hard Disk Requirements To secure data and improve performance the use of RAID 0 1 or 5 storage is recommended 15k rpm drives are preferred Copyright 2015 15 AVEVA Solutions Limited and its subsidiaries WWW aveva com All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide NTFS For information on conversion to NTFS please see http technet microsoft com en us library bb
90. e default is to skip elements which already have thumbnails unless FORCERECREATE is specified D woPnonuPrT is automatic in tty mode in graphical mode the default is to prompt the user to confirm generation When the thumbnail creation process is complete a log file is created and stored in the directory 9eAVEVA DESIGN USER e The file name is of the form DrawThumbnailRefresh 20141114 144807 log The log file details the generated thumbnails 5 2 4 Refreshing overlays One exception to the transformation of Sheets on the fly is the requirement to refresh Overlays This is not required where Overlays are to be transformed as part of a bulk up front transformation process Refreshing is necessary in order for Overlays to appear correctly in AVEVA E3D Draw sheets Unlike transformation a refresh does not affect the use of overlays in AVEVA PDMS Draft or AVEVA Marine Drafting in any way This is important when using AVEVA ESD Draw in a mixed project environment An Overlay Refresh can be made via a bulk refresh through the Draw Administration User Interface or by using a designated command 5 2 4 1 Draw Administration User Interface ADMIN E gt lia Thumbnails can be generated for Sheets and Library Elements via EE monos the Refresh Overlays button in the Transform group of the ADMIN e tab in Draw The action applies to the Current Element and the gt m hierarchy below it D The Refresh process is an administration task a
91. e of design workflows Another primary development at AVEVA E3D 2 1 is the provision of a redesigned Supports application that promotes an efficient and intuitive design workflow across different locations New innovation with laser data utilising the immersive living Point Cloud capability of AVEVA HyperBubble will deliver project benefits especially in brownfield projects Powerful 2D drafting also allows the inclusion of Laser data removing the need to remodel existing Digital Assets Tl lt a 7 a a ESI M mna a Z ECCUET F1 877 o pet E i a M HR e eee iT i ele aii eH Ss a ee Ham i T 1 Imm A0 System administration and configuration together with catalogue and specification capabilities are provided by the separate AVEVA Administration and AVEVA Catalogue products respectively AVEVA Catalogue has been updated at this latest release and introduces a new user interface that is aligned in design with AVEVA ESD 2 1 Copyright 2015 10 AVEVA Solutions Limited and its subsidiaries All rights reserved WWW aveva com AVEVA Everything3D 2 1 Migration amp Interoperability Guide AVEVA ESD 2 1 has been designed from the outset to be compatible with AVEVA PDMS and Hull amp Outfitting
92. e upgraded to PDMS 12 0 Schematic Model Manager has its own units handling at PDMS 12 0 It also has its own upgrade mechanism which is separately documented the software will advise if it is necessary to run this Units Upgrade Required It is recomended that you run the Schematic Model Manager Units Upgrade Please see the documentation for more information C Don t show this again DBUpgrade command The Upgrade procedure is invoked from Admin it controls the upgrade process and runs each Part Upgrade in the appropriate order Upgrades relevant to PDMS that are covered by this process are e UKEYs now include database number to avoid duplicates Copyright 2015 2i WWW aveva com AVEVA Solutions Limited and its subsidiaries All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide e Performance of finding database elements index by type e Module Definitions new TAGS module and renamed Marine Drafting module e Character handling Unicode representation for names text etc e Line widths in Draft widths of thin medium and thick lines now stored in system database The upgrade process puts an upgrade number in the databases indicating the level to which they have been upgraded This makes it easy to detect on opening whether a database has or has not been upgraded This upgrade number will also be used by the Reconfigure process Database Version Control The upgrade version
93. e will be converted to the most suitable Draw element type 5 5 3 4 Texts On transformation Text elements within the AVEVA Marine Drafting Drawing will be stored in the PADD database as Text Primitives TEXP where not already present If in the instance the Text font is a TBSystemFont the font is converted to the true type Marine System Font that has the closest resemblance within the AVEVA ESD 2 1 install However unlike TBSystemFonts true type fonts respect the current zoom scale i e the font becomes emboldened as one zooms in D Please note that the Slant and Aspect text properties are not supported in AVEVA E3D 2 1 Draw The transformation process preserves the Text height in principal but AVEVA Marine Drafting and AVEVA E3D Draw differ in text height interpretation A factor of 1 25 is applied and the length of the text may appear to be elongated 5 5 3 5 Loss of 2DGeometry There are situations where geometry in the drawing may be lost during the transform operation This is observed when the 2D geometry has been manually added to a system defined drawing component label dimension or ruler or to a component that represents a model The entire drawing component will be replaced and recreated during the transformation process In general terms the loss of geometry observed in AVEVA Marine Drafting on an Update Design or Update Annotation operation is also observed on opening the same Drawing in AVEVA E3D Draw and an Upda
94. ed and its subsidiaries WWW aveva com All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide 4 3 3 2 Template Sets Different sets of templates individually contained in APPLDW elements can exist in the same MDB For example an APPLDW may contain BS DIN and AISC framework template sets Each APPLDW must have a Purpose attribute PURP set By default the correct Purpose is automatically assigned during the conversion process Each template type is based on the Purpose of the APPLDW e Framework templates Purpose MDST e Special templates Purpose MDSS e Hanger templates Purpose MDSH e ORI framework templates Purpose MDSO The Description DESC of the APPLDW is taken from the description of the converted SITE For example e SUPPORT FRAMES BS e SUPPORT FRAMES DIN e SUPPORT FRAMES AISC SUPPORTS Gal Autoname Ue Welds The Supports application defaults may be interrogated at any time a Defaults 7 via the Defaults option in the Settings group of the SUPPORTS tab G Reload The prompted Supports Application Defaults window allows an overview of and the ability to modify the Supports application defaults Support Creation Zone and Templates Miscellaneous Support Zone Supports Max Pipe Angle 30degree Frameworks ISUPPORT FRAMES AISC Special Num Prefix SPS Specials ISUPPORT FRAMES SPECIALS AJSC Special Num Unique No Hangers ISUPPORT HANGERS PSL Transport Prefix zT
95. eee eee 17 244 Microsot O SoftWare ae ne eee ene ne eee 17 25 Environment Variabl6S uuuieri iden oa oS muc detrint Ko n kie qo diuo audi dad o i ue adonde E is 18 5 29 50 t 18 aM 18 2 8 AVEVA Everything3D Projects 2 1 Leeecc e eiieeeeeee eres eene nennen enn n nnn aaa n nn nennen nne 19 2 8 1 AVEVA Sample Laser Data 1 1 uses sien ske ni etr vnta wide du eeckia a RN o oet RR ES EUER ER 19 2 9 AVEVA Everything3D Documentation 2 1 eeclesie ieeeelieeen eee enean nhan nhan 20 2 10 Entering AVEVA Everything3D 2 1 1 e lieeeeeee e ieeeeee nee e eene nennen nnn anna nnn anne nana nnn 20 9 Project Migr atoi iasecuss inus s ntes Era ouieusuE s NES Smau sua S nS RESE DAE ERE uS UK RR SUPE EA udE uS usu E aPrE EE KS UE MEE eK E E 23 3 1 Migrating projects from AVEVA PDMS or Hull amp Outfitting 12 0 23 3 1 1 AVEVA PDMS 12 0 AVEVA PDMS 12 1 nennen nnns 23 3 1 2 AVEVA Hull amp Outfitting 12 0 gt AVEVA Hull amp Outfitting 12 1 ssseeeeeeeeessssss 23 3 2 Preparing an AVEVA PDMS or Hull amp Outfitting 12 1 SP4 Project 24 3 2 1 Marine Projects Hull data in AVEVA ESD 2 1 sssseeesessessseeeeenne nnne 24 3 3 Preparing an AVEVA Every
96. ence Grids Reference Grids are formed in the Model Database and may be used across an entire project and added with automated annotation to project drawings in AVEVA ESD 2 1 Draw In regards to the migration to AVEVA ESD 2 1 Draw in addition to any updates to Project Libraries to account for the new elements previously Grid Systems was the primary grid facility the following Automatic Drawing Production updates may be required 5 4 1 General ADP The General ADP application has been modified so that the previously inherent gridline annotation functionality is disabled by default to allow for the new grid annotation at AVEVA E3D 2 1 via the View Visual Style Copyright 2015 61 AVEVA Solutions Limited and its subsidiaries WWW aveva com All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide The following application defaults have been modified to disable the previous gridline annotation S PDMSUI dflts dra genadp equilocn S PDMSUI dflts dra genadp piping S PDMSUI dflts dra genadp plotplan S PDMSUI dflts dra genadp supports In each case the following setting has been altered var CDDIMLEV3FLG FALSE D If an administrator wishes to reinstate the previous gridline annotation each file global variable may be set back to TRUE However one must remember to set the system automatic Reference Grid annotation off by setting the relevant View Visual Style attribute AGMODE OFF Otherwise dup
97. eroperability Guide Select SPWL or SPEC to Translate STEEL SECTION FITTINGS SPWL F1 Baseplate Fitings Baseplates F2 Stiffener FitBngs Stiffeners F3 Lif amp ngLug Fitings Lifng Lug F4 Padeye Fittings Padeyes F5 ShearStud Fittings Shear Stud F6 ScaffokiCiip Fittings Scaffold Clip STEEL JOINTS SPWL J1 BeamToBeam Joints Beam to Beam Joints J2 BeamToColumn Joints Beam to Column Joints J3 Splice Joints Splice Joints J4 Bracing Joints Bracing Joints MDS Joints Spwi Connecbon joint spec for MDS MDS External Joints Spec MDS Joints MDS Internal_Joints Spec MDS Joints It is important to consider that if the catalogue joints or fittings do not comply with the way the AVEVA sample joints and fittings in the old catalogue are constructed or the parameter order Dkey attributes of the profiles that they relate to have been changed then the translation process will be unsuccessful and the translation must be done manually Itshould also be noted that template joints and fittings cannot be translated automatically They must be translated manually 4 1 3 Catalogue Profiles As indicated in the previous section a new profile catalogue has been introduced alongside the AVEVA E3D 2 1 structural capability The new profiles have common Gtype geometry and P line sets together with a common data set Therefore joints and fittings developed for and used with the previous profile catalogue AVEVA PDMS and Hull amp
98. erties form Active Properties e 4 2 8 Current Owner DRWIG E3D TRAINING P S g Current Layer 0 M Select the current visual layer j b Visual Layer 1 Visual Layer 2 Visual Layer 3 5 3 5 Plot Styles Current Line Type Current Colour At AVEVA E3D 2 1 changes have been made to the storage mechanism for Plot Styles Plot Styles are now accessed and stored in the database JA Master PenStyles Explorer 1 x The Plot Style is stored beneath a Style World STYWL and Plot Style Table PSTYTB and defined by a series of Action Types PLTACT 4 a STYLWL Master PenStyles gt Ed LSTYTB DRA MASILineStyleTable Basic gt Eg FSTYTB DRAMASFFillStyleTable Basic 4 Bg PSTYTB DRA MAS PlotStyleTable Basic gt Ey PLTSTY Greyscale e Colour b En PLTSTY Monochrome gt Bg PLTSTY AlLinetypes as Solid 4 Pp PLTSTY Al Filtypes as Solid ig PLTACT 1 fp PLTACT 2 e Fill Type In PLTACT 3 Ig PLTACT 4 n Available Action Types include e Line Type D As highlighted by the screenshot here updates to Plot Styles have been made to the Draw sample data Copyright 2015 60 AVEVA Solutions Limited and its subsidiaries www aveva com All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide A new user interface has been provided at AVEVA E3D 2 1 to create and administer Plot Styles ADMIN bb To create or modify Plot Styles the Plot Styles button is clic
99. exited from project e Lock project at all locations upgrade will check for this see below e Disable Automatic update events if required Recommended but not essential e Expunge all users in the system at the local location e Flush data from Working extracts these will not be considered in Global projects they should be deleted e Check project using DICE Integrity Checker e If DICE reveals issues address them then re run DICE e Administrator may want to unlock project while DICE issues are being addressed but will need to exclude all users and Lock project again before final DICE check e After clean DICE check e Back up project at all locations e Temporarily relocate all non Foreign DBs to their master s Primary location e Check for No Transient Databases e Upgrade the project at each location e Optionally Merge Sessions e Optionally Reconfigure for Unicode e DICE check project e Relocate extracts back to their original locations e Perform non framework upgrades if applicable e Unlock the project Locking the Project The project as a whole cannot be locked only individual locations however it is possible to lock all online locations from the HUB through Global To do this run the following command from the HUB LOCK AT lt location gt Copyright 2015 93 AVEVA Solutions Limited and its subsidiaries WWW aveva com All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperabilit
100. f the ADMIN tab where missing GENSEC cn E CCHMED UDA definitions are detected that exist for SCTN elements On confirming the message dialog the SCTN GENSEC UDA checking tool is displayed with the UDA and Error Types listed Copyright 2015 46 AVEVA Solutions Limited and its subsidiaries WWW aveva com All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide Uda messages Drag a column header here to group by that column UDAname UDAdatabase name 4 UDA db file name a Error Type Rz e p FP UDASSTX MASTER DICT ACP000 acp7006_0001 GENSEC missing from element list for this UDA this is required to ensure that SCTN uda data is copied to converted GENSEC elements UDA SENX MASTER DICT ACP000 acp7006_0001 GENSEC missing from element list for this UDA this is required to ensure that SCTN uda data is copied to converted GENSEC elements UDA SPREF MASTER DICT ACP000 acp7006_0001 GENSEC missing from element list for this UDA this is required to ensure that SCTN uda data is copied to converted GENSEC elements MP update files have been created in the icki i i UN x On clicking the write uda update macro button a message is CAUserslPubliciDOCUME TAVEVALUSERDATA prompted to inform the user of the location of the update files and need to be run into lexicon m update fles db7006 UDA update pmidat to be run into the Lexicon module of AVEVA Administration 1 4 4 3 3
101. formed elements 5 2 3 Thumbnails The thumbnail generation function allows an ESD Draw user to view thumbnails of the transformed sheets and library items created in AVEVA PDMS Draft and AVEVA Marine Drafting Thumbnail creation is not required for sheets and library items created in AVEVA ESD Draw Thumbnail previews display for example when a user wishes to open a sheet m REGI GEMERAL PRESENTATION APS 0002 Thumbnail generation can be made via a bulk up front action through the Draw Administration User Interface or by using a designated command 5 2 3 1 Draw Administration User Interface ADMIN bd Thumbnails can be generated for Sheets and Library Elements via a oe the Thumbnail button in the Transform group of the ADMIN tab M in Draw The action applies to the Current Element and the Ly ses hierarchy below it n Library Elements D The Generation process is an administration task access to the ADMIN tab is only available to users with administration rights or as a free user The Thumbnail Generation result can be viewed in the Command Window where open Copyright 2015 56 AVEVA Solutions Limited and its subsidiaries WWW aveva com All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide 5 2 3 2 Command Syntax One can create thumbnails using the command GENERATETHUMBNAILS ALL SHEETS LIBRARYELEMENTS FORCERECREATE NOPROMPT Th
102. g the Specification Reference of existing GENSECs to use the new catalogue profiles This is due to the Profile Catalogue update referring to the updated Joints amp Fittings in the update process D Please refer to the AVEVA E3D 2 1 User Bulletin for an outline of the key changes to the structural catalogue at AVEVA Catalogue 2 1 D Itis not necessary to update to the new catalogue as AVEVA E3D 2 1 will function correctly with the old catalogue data however images on the joint and fitting selection forms will not be available Paragon A utility is provided in AVEVA Catalogue 2 1 to translate joint and fitting catalogues and specifications that work with the previous catalogue to work with the new catalogue o SPECIFICATION T The utility Translate Joints Fittings Catalogue in the vE E X Tools group of the SPECIFICATION tab in Paragon copies Preferred Selection Delete Translate Joints Fittings the former specifications and then interrogates the reference Profiles Table Catalogue Modify TT data to translate it to the new catalogue The Translate Joints and Fittings Specifications form is displayed as shown on the following page and allows the selection of the Specification World SPWL or Specification SPEC to be validated and translated Copyright O 2015 29 AVEVA Solutions Limited and its subsidiaries WWW aveva com All rights reserved AVEVA Everything3D 2 1 Migration amp Int
103. gt 4MySystem7 5 MySystemB OONN NNO ae 6 MySystem9 7 MySystem15 A number of User Defined line styles which can be used to 8 MySystem 16 simulate some of line styles not supported by Draw have been added to the AVEVA Marine Sample Project AMS and can be 000000 0 OG MySystem copied toa project PD ST NS a ISI P NN 4i MySystem26 bAAAAAAAAAAAASL 13 MySystem27 ee i v Track There is a built in mapping between AVEVA Marine Drafting Line Types and AVEVA E3D Draw Line Styles Where a user defined line style mapping is required a mapping table can be used to dictate to the system that certain Marine Drafting line styles should be replaced with identified Draw line styles The line style mapping table is referred to when transforming marine drawings and on creating a Hull Symbolic View in Draw The line type mapping file is referenced via an environment variable SBD ES3D DRAW LINETYPE MAPPING in the d065 file for the marine project Copyright O 2015 69 AVEVA Solutions Limited and its subsidiaries WWW aveva com All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide E CER f _ linetypemapping xml Notepad File Edit Format View Help k xml version 1 0 gt lt TransformSettings gt lt LineTypesMap gt lt LineType lt LineType lt LineType lt LineType lt LineType lt LineType lt LineType lt LineType lt LineType lt LineType lt LineType lt LineType lt LineType lt
104. hieved using the Windows Components feature of Windows Control Panel Add or Remove Programs For full details please refer to the AVEVA Everything3D 2 1 Installation Guide 2 4 3 AVEVA Catalogue 2 1 0 AVEVA Catalogue 2 1 is installed as part of the AVEVA E8D 2 1 install and is fully compatible 2 4 4 Microsoft Software The following Microsoft products are required to support the operation of AVEVA ESD 2 1 2 4 4 1 Microsoft Office amp Fonts Microsoft Office 2010 and later is required for some functions e Optimum operation of the AVEVA Design Platform GUI requires Arial Unicode MS font supplied with Microsoft Office and also with Microsoft Office Visio e The layout and display of forms and the general user interface may also be adversely affected if the screen font size is not set to the smallest size e Microsoft Office Excel import utilities in AVEVA E3D 2 1 require NET Programmability Support enabled when Office is installed This can be found under Advanced customization of applications and installs the Microsoft Office Interop Excel dll AVEVA E3D 2 1 has been verified with Microsoft Office 365 Microsoft Office Visio 2010 Standard edition 32 bit or later is required where AVEVA Schematic Model Viewer is used in conjunction with AVEVA E3D 2 1 Copyright 2015 17 AVEVA Solutions Limited and its subsidiaries WWW aveva com All rights reserved AVEVA Everything3D 2 1 Migration amp Interope
105. hts reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide 7 8 1 The interface to main bar menu and tool bar functions eesesseeseesseeeeeenrrneenee 88 7 8 2 Changes to environment variables iunc ea ecco ban Pate pia Ed ena aea een Edo estt Fe ub HR tuae Sus Ebaeode 89 7 8 8 Use of Lists which have been replaced by Collections in AVEVA ESD 89 LOS 3OBSHOSSdO TOR H IO VOL renee nee ane ten nr er ener entum tus a eee weet ee ener ae 89 7 8 5 Use of resource files for Icons cccceeeecccccececseeeeeeceeeeeeeaeeeseeceeeeessaeeeeeeeeeeesseaaseeeeeeesessuaaeeeeees 89 7 8 6 PML code setting view Prope rtieS ccccccccccsssssseecceeeeeeeeeeseeceeeeeesaeeeseeeeeeeessaaaaeeeeeseessaaageess 89 7 8 7 Changes to PML TABSET gadgets sees nennen nennen nnns nna nnn nnns 89 Appendix A Migration from PDMS 12 0 to 12 1 eeee eee reee eene 91 Upgrad i UC t C 91 DEUD dECOMMANO an ea ann nn een TO EE 91 Da tabas i r aRikm i 92 i ee 92 The Upgrade TOSS semis arta eee eee eee 93 Weeditsbiu dde cem m T Um 93 Extract Riera o El TTE sm 94 International characters Unicode ssseseseessssesseseseeeeee nennen nennen nnn nnn hann nnns inan nnns nnns 94 STI C
106. i e Extend E Split F Gaps ce E Connect ER Force Trim To Material lt unset gt X ai W Shape X ER lt unset gt lig Mitre Ex Splice EJ Disconnect E amp i Check Justification NA T Wa4x13 H lt unset gt Modify Delete Connections Defaults Storage Midpoint between Node and End oT angle 90deg PS ai Please refer to the AVEVA ES3D 2 1 User Bulletin for an outline of the key structural concepts and available structural functionality in the E3D 2 1 Model module Copyright 2015 S WWW aveva com AVEVA Solutions Limited and its subsidiaries All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide 4 1 1 Section Conversion To enable the use of the AVEVA ESD 2 1 structural application functionality to modify existing model data itis necessary to convert all Section SCTN elements to GENSEC elements It is recommended that this action is the first step taken in the conversion process for a structural model and that the process is completed in manageable hierarchy segments i e STRUs or FRMWs depending on the complexity of the model D It is recommended that where the conversion of MDS Template data is required the SCTN to GENSEC conversion process should be undertaken using the Support Convert Template utility and not the Structural Conversion utility Please refer to Section 4 3 3 Template Data As part of the conversion process e Fitting FITT and Joint SJOI
107. iewer which comprises an Explorer style Contents list complete with Search function and a reading pane E Contents Index M search Introduction os AVEVA Everything3D 2 1 AVEVA Global TRADEMARK http help aveva com AVEVA Everything3D 2 1 index html tabz contents 2 10 Entering AVEVA Everything3D 2 1 AVEVA Everything3D 2 1 may be accessed via the Windows Start menu or Start screen depending on the Windows Operating System being used z AVEVA Plant gt Design gt Everything3D 2 1 0 from the Windows Start Menu AVEVA Everything3D 2 10 Copyright 2015 20 AVEVA Solutions Limited and its subsidiaries www aveva com All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide LIS AMS APS LIS ProjAMS ProjAPS PSL d d d d AVEVA Website www aveva com See the AVEVA Website for the latest news Bi Show Masked Projects The Login form is displayed Model Draw Isodraft we xXx JAVzVA AVEVA Everything3D From the Login form a project may be accessed by selecting the identified Project tile prior to entering the required login information and clicking on the desired module M The Project search Tile allows the user to search for a project and to display B masked project tiles APS Project ProJAPS ds at Number APS 2 1 0 1RC1 i d Description AVEVA Supplied Sample Plant Data FP mca na Referenced ACP User EQUIPMAN Password 800008
108. ilities The catalogue has been enhanced for structural supports and bolt holes Additional data has been added to support the use and demonstration of Supports Structural and Laser data The AVEVA sample projects are regularly revised Please check the AVEVA Support Site AVEVA Everything3D Fix Release History frequently for updates ACP Project Origin Ref SI 39911 DFN P 45252 Extra HVAC Joint sizes DFN P 45442 Update CCTA with COCDES description DFN P 45528 UDAs for Al and AE Integration TFS 67925 DFN P 45524 UDAs and Plines for AVEVA OpenSteel Interface SI 41769 AVEVA AVEVA AVEVA AVEVA AVEVA AVEVA AVEVA AVEVA AVEVA AVEVA E3D AVEVA E3D Project Change Description 1 1 1 1 0 7 2 1 2 1 0 0 COCO Table in New Database MASKED_PROJECTS evar added to evars bat AISC rectangular tube depth and width correction Flat Bar OBST value changed from O to 2 Add default mdb ALL to supplied ACP project Legrand Cable Tray Data HVAC Catalogue element rename to satisfy MC1174 Version Number in Project Number not Description Rem db MASTER UNIT from ALL mdb Add 2 additional MASTER dbs to mdb ALL Relief Valve Update Bolt holes for ANSI DIN and BS flanges Copyright 2015 n www aveva com AVEVA Solutions Limited and its subsidiaries All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide AVEVA E3D 1 1 1 1 0 7 AVEVA E3D 2 1 2 1 0 0 Origin Ref Pr
109. ility Guide Copyright 2015 108 AVEVA Solutions Limited and its subsidiaries www aveva com All rights reserved mc APPENDIX C t7 Selection E 1 Joint s selected The use of the AVEVA E3D 2 1 structural application and workflows therein are greatly aided by the available images png for joints and fittings An important consideration is the inclusion of user defined images of Project Joints and Fittings to Column Flange Column Web complement those already found in the structural application Refer to Section 4 1 4 for details on the inclusion of the Image s in the application via the resource file Depth End Feble Erd Pte Flexible End Plate Pate Modes 200x 10mm The following sections explain the recommended process to form images for use in the user interface of the Structural application D It is recommended that customers add something specific to their images that make them distinct from those supplied by AVEVA Colours The colours to be used for the joint and fitting images in AVEVA ESD and AVEVA Bocad have been given the following RGB values Preferred Style 222 176 63 Hj New 84 130 171 g Master 0 173 131 BS Slave 0 173 208 E Neighbour 247 64 58 E Additional In E3D 2 1 only three of the colours are required and have the following designations e Owning Profile Master colour RGB 84 130 171 e Attached Profile Slave colour RGB 0 173 131 e Joint or Fitting
110. ility Guide In the Model Explorer navigate away from joint fitting elements and with the cursor in the 3D View press the Esc key to de select the graphical selection Copyright 2015 114 AVEVA Solutions Limited and its subsidiaries All rights reserved www aveva com AVEVA Everything3D 2 1 Migration amp Interoperability Guide The joint fitting should now look like this Taking the Screenshot Any image capture software must have the capability to take a fixed region image of 85x85 pixels in different positions on the screen as it is not possible to get the model centred in exactly the same position every time Make sure the joint fitting model is centred in the 3D View and zoom in and out until it fits in the image capture software s 85x85 pixel view frame as fully as possible The CIE command Zoom gt Realtime is very useful for this Double check the view direction is the first isometric direction and take the screenshot Naming the Image All joints and fittings specification components SPCO elements are named following a simple naming convention For example Joint SPCOs are typically named like e J181 WEL PFC PFC 001 e J1S2 SNS PFI PFI 001 e J2S4 FEP PFI CTUB 002 Fitting SPCO are typically named e F1 CIR CTUB 4H STIFF e F3 PLT PFI 001 e F2 FLS PFI VAR The image must be named the same as the SPCO except that any forward slash is replaced by a hyphen for example the image name for SPCO J1S1 WEL PFC P
111. ion amp Interoperability Guide PML gadget exists get its value return appdesmain wallSpec val else get value from E3D Command object return wallSpecification value endif endmethod 7 8 2 Changes to environment variables A table of equivalent AVEVA PDMS and Hull amp Outfitting and AVEVA E3D environment variables can be found in section 7 2 1 above AVEVA E3D has a compatibility mode so most references to AVEVA PDMS and Hull amp Outfitting variables will work in AVEVA E8D but references to AVEVA ESD variables will not work in PDMS One way to allow PML code to work with environment variables in both products is to create a set of customer specific environment variables that can be used in both 7 8 3 Use of Lists which have been replaced by Collections in AVEVA E3D The function IstCurrentList returns the members of the current list in AVEVA PDMS and Hull amp Outfitting and it returns the members of the current collection in E3D PML code accessing the PDMS current list directly should be replaced by a call to IstCurrentList 7 8 4 Changes to form layout Changes to form layout are unlikely to cause problems However in cases where form layout has become untidy it is often possible to define the position and width of gadgets in a way that is acceptable in both products by using relative positioning functions and by setting explicit width and tagwidth properties 7 8 5 Use of resource files for Icons In AVE
112. ion databases These are user defined database items that may already exist within customer versions of AVEVA PDMS or Hull amp Outfitting 12 1 SP4 or AVEVA E3D 1 1 For example e MDS APPDEFAULTS e MDS DESITMPL BS e MDS DESITMPL BS ORI e MDS DESI SPECIAL TMPL BS e MDS DESITMPL PSL In such cases were existing user corporate versions of these databases exist then such databases can either be included within the working project by either foreign reference or by a direct copy into the working project D Further information regarding project setup is located in the Supports Customization guide The following is an example administrative workflow to replace the MAS Project reference library data with the ACP Project library data within a working project User defined template databases are included via foreign data reference but they could also be copied into a working project as previously stated Copyright O 2015 38 AVEVA Solutions Limited and its subsidiaries WWW aveva com All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide It is recommended that where user maintained data is to be updated to work in the AVEVA E3D 2 1 environment backup copies of the project or relevant databases are taken before work commences e 2 3 Exclude MAS Reference Databases Include required ACP Reference Databases Include required Support Template Databases If the project to be updated for use in AVEVA ESD
113. ions Limited and its subsidiaries www aveva com All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide 6 2 6 1 Transformation Visual elements originally created by AVEVA PDMS Draft or AVEVA Marine Drafting must be transformed before being viewed or modified by a Draw user in AVEVA ESD 2 1 The transformation of visual elements such as Sheets Backing Sheets Symbol Templates and Sheet Templates is only necessary when migrating AVEVA PDMS or Hull amp Outfitting 12 1 SP4 project data to AVEVA ESD 2 1 Draw Transformation is not required for new projects created with AVEVA ESD or for new visual elements created in AVEVA E3D Draw Once transformation is complete and a Save Work has been applied it is no longer possible to view or modify the sheet using AVEVA PDMS Draft or AVEVA Marine Drafting Similarly new sheets created in Draw will not be accessible The same PADD database can be accessed both from AVEVA E3D 2 1 Draw and AVEVA Marine Drafting 12 1SP4 but the storing format for drawings is different though In AVEVA E3D Draw all drawing data is stored in the PADD database while in AVEVA Marine Drafting some data is stored in PADD database and other data in a separate file the SDB file and is therefore subject to an extended marine specific transformation process One exception to the transformation of Sheets on the fly is the requirement to refresh Overlays This is not required where Ove
114. it should be noted that the AVEVA E3D 2 1 Draw Supports Area Based ADP utility only recognises the new Support hierarchy introduced at AVEVA E3D 2 1 Therefore where a customer intends to use the MDS application in AVEVA PDMS or Hull amp Outfitting 12 1 SP4 with AVEVA E3D 2 1 MDS Area Based ADP drawings must be created in AVEVA PDMS 12 1 SP4 Draft 6 3 AVEVA Administration 1 4 0 Where AVEVA E3D 2 1 and AVEVA PDMS or Hull amp Outfitting 12 1 SP4 Fix Release 28 products operate on the same project it is strongly recommended and is mandatory for some operations that AVEVA Administration 1 4 or later is used for all on going administration work One should be aware of the following considerations where AVEVA Administration 1 4 is used to administer a project environment using AVEVA PDMS or Hull amp Outfitting 12 1 SP4 and AVEVA E3D 2 1 Copyright 2015 77 AVEVA Solutions Limited and its subsidiaries WWW aveva com All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide 6 3 1 New Database Types New Database Types introduced by AVEVA Administration 1 4 XPRD CONF TASK and RDFN will not be opened in AVEVA PDMS or Hull amp Outfitting 12 1 SP4 The Cross Product Database Type XPRD contains Comments shared between AVEVA ESD 2 1 and AVEVA ESD Insight 2 1 For information on the use Cross Product Databases please refer to the AVEVA Administration User Documentation D The CONF TASK and RDFN
115. it will be running in software rendering mode To minimise the CPU load would you like the system to reduce certain 3D graphical effects Following extensive testing of current market Graphics Cards and AVEVA E3D 2 1 a recommended configuration is summarised in the table below Desktop Laptop e NVIDIA Quadro K2000 or K2200 e NVIDIA Quadro K2000M or K2100M Graphics Card e AMD FirePro W4100 e AMD FirePro 4000M DirectX Support e DirectX 11 Shader Model 5 0 e DirectX 11 Shader Model 5 0 D Users using only AVEVA Catalogue or AVEVA Aaministration could consider a lower specification graphics card such as a NVIDIA Quadro K620 Desktop or NVIDIA amp Quadro K1100M Laptop Where laser data is utilised the Graphics Card memory allocation is an important consideration as this is further exploited in the visualization and manipulation of laser data incl HyperBubble Note that the system will post an error message on entering the HyperBubble where the GPU memory is less than 1GB D AVEVA strongly recommends that clients should test their chosen card or laptop in their own environment before purchase LL Availability and support of graphics cards changes frequently a full updated list of graphics cards that have been verified with AVEVA E3D 2 1 is available via the IT Configuration area of the AVEVA Support Site http support aveva com Copyright 2015 14 AVEVA Solutions Limited and its subsidia
116. ked in the System Plot Settings group of the ADMIN tab Defaults Styles settings The Plot Styles form is displayed listing the existing Plot Styles The list s of actions that comprise the Plot Style are displayed in the Plot Style Actions area of the form In the example below colours in the Sheet are to be transformed to a shade of grey Monochrome through a colour Action Type Available Plot Styles All Fillypes as Solid Plot Style Actions Action Type Wr From Colour Y To Colour Y From Line Type Y To Line Type Y From Fill Typ Y To Fill Type Y PH Colour E Colour 1 z ae ee 0 Ge rRemi meme cane E EE CNET Bes cme Action Type From Colour From Fill Type From Line Type To Colour To Fill Type To Line Type 4 4 amp I XI I I Rer rpenes cmi coor eine min Colour Plot Styles can be migrated added to the database from a macro file using the following command line syntax while the destination Plot Style Table PSTYTB is selected PLOTMAP IMPORT FROM FILE filename Where filename is the file path of the macro file this shouldn t contain any spaces Plot styles can also be added for temporary use by running the macros in the normal way D A Plot Style macro file can be generated using the Plot Styles user interface in AVEVA E3D 1 1 5 4 Reference Grids in Draw A principal aid to the AVEVA ES3D 2 1 Model Designer is the provision of new Grid elements called Refer
117. l examine the interoperability of this release a particular focus being the interoperable relationship between AVEVA E8D 2 1 and AVEVA PDMS and Marine amp Outfitting 12 1 SP4 6 1 Compatibility with other AVEVA Products For full compatibility details and for information about AVEVA E3D 2 1 compatibility with any later versions please refer to the compatibility matrix A full and up to date compatibility matrix can be found via compatability aveva com matrix The following AVEVA products are compatible with AVEVA Everything3D 2 1 0 AVEVA Administration 1 4 0 Note This release supersedes all previous AVEVA Administration versions delivered with other AVEVA products AVEVA Applications Service 1 3 0 amp 2 1 0 Note For customers who use AVEVA E3D Insight 2 1 0 AVEVA Applications Service 2 1 0 or higher must be used Earlier versions are incompatible AVEVA Bocad 2 2 1 amp 2 30 Note The supporting AVEVA Bocad Steel Interface is not included in the first release of AVEVA E3D 2 1 0 and is to be included in a forthcoming Fix Release AVEVA Catalogue 2 1 0 AVEVA Client Cache Service 1 0 5 AVEVA Clash Manager 2 1 0 Note This is a planned compatibility on the release of the AVEVA Clash Manager product AVEVA Design Checker 1 1 0 AVEVA Diagrams 14 1 0 Fix Release 4 AVEVA E3D Documentation 2 1 0 AVEVA Electrical 12 1 3 Fix Release 8 AVEVA Engineering 14 1 1 Fix Release 4 AVE
118. l or pure economic loss costs damages charges or expenses which may be suffered by the user including any loss suffered by the user resulting from the inaccuracy or invalidity of any data created by the AVEVA software irrespective of whether such losses are suffered directly or indirectly or arise in contract tort including negligence or otherwise 1 3 AVEVA s total liability in contract tort including negligence or otherwise arising in connection with the performance of the AVEVA software shall be limited to 100 of the licence fees paid in the year in which the user s claim is brought 1 4 Clauses 1 1 to 1 3 shall apply to the fullest extent permissible at law 1 5 In the event of any conflict between the above clauses and the analogous clauses in the software licence under which the AVEVA software was purchased the clauses in the software licence shall take precedence Copyright O 2015 3 AVEVA Solutions Limited and its subsidiaries WWW aveva com All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide Copyright Notice All intellectual property rights including but not limited to copyright in this Training Guide and the associated documentation belongs to or is licensed to AVEVA Solutions Limited or its affiliates All rights are reserved to AVEVA Solutions Limited and its affiliates companies The information contained in this Training Guide and associated documentation is commercially sen
119. l to the project in the custom evars bat file this is by default stored in CAUsers Publici Documents AVEVA Projects E3D2 1 e Define the Draw module using AVEVA Administration 1 4 Please refer to Section 5 1 Module Definition for further information e AVEVA Hull amp Outfitting 12 1 SP4 Project In most cases an interoperable project setup will typically involve adapting an AVEVA ESD 2 1 setup to use an AVEVA Hull amp Outfitting project The following is recommended e Check that the project defined as Marine is up to date and is using AVEVA Hull amp Outfitting 12 1 SP4 Fix 28 or later Copyright 2015 74 AVEVA Solutions Limited and its subsidiaries www aveva com All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide e In AVEVA ESD 2 1 add a call to the project in the custom evars bat file this is by default stored in C Users Public Documents AVEVA Projects E3D2 1 e Define the Draw module using AVEVA Administration 1 4 Please refer to Section 5 1 Module Definition for further information Please note that spaces in pathnames should be avoided for AVEVA Marine Hull 12 1 SP4 projects For the inclusion of Marine data in AVEVA E3D 2 1 please also refer to Section 3 2 1 Marine Projects Hull data in AVEVA E3D 2 1 e AVEVA ESD 2 1 Project It is also possible to use AVEVA PDMS 12 1 SP4 to access a project newly created for AVEVA ESD 2 1 using AVEVA Administration 1 4
120. lements TFS 85979 Include db SDNF DICTSDNF in the ALL MDB e AVEVA Reset SHEET TITL attribute on template drawings e e AVEVA Remove TT DRA PRJ TMP DEMO e e AVEVA Re set MDS ABA template idli refs AVEVA Reset backing sheet on APS 1001 1 to A1 e AVEVA Idli fix for Tags d AVEVA SLH RLADDR DDDFAULT change e e AVEVA Additional APS Libys Set Mstyid to O for liby MRKP e e Copyright O 2015 102 AVEVA Solutions Limited and its subsidiaries All rights reserved WWW aveva com AVEVA Everything3D 2 1 Migration amp Interoperability Guide AVEVA E3D 1 1 1 1 0 7 Origin Ref Project Change Description pire Add New Air Cooler TMPL AVEVA Std Equi AVEVA Reset MDS References AVEVA Piping Re connections AVEVA SLH data to refer to MASTER SLHCATA AVEVA Set MDSYSF attribute for HVAC Systems TFS 87689 Pipe Tasks amp Tasks for Spools for default Pipe AVEVA Re reference for supports dbs TFS 69993 Create HVAC defaults for min fill length TFS 87689 Resolve DATACON errors TFS 66403 Update MDSRange ATTR for MDS DESITMPL BS STRU AVEVA Set HREF for Branch trunnions SI 32916 Resolve D880 error for Circular branch on Circular TFS 61515 main TFS 92615 Pipe Fabrication Data modifications TFS 76765 Populating the PBOR3 for fabricated OLET TFS 93254 New version of the DBSCATALOGUE file for DFLTS TFS 95636 TAGS Datasheets TFS 95217 Detail plot file for non standard branch connections TFS 95339 TFS
121. licate annotation will be generated 5 4 2 Area Based ADP Area Based ADP generates annotation using TASK elements which call PML Functions The standard supplied examples include tasks for the generation of Gridline Annotation Labels and Dimensions Since the system now generates these automatically these tasks may no longer be required Consequently some changes have been made to the application data to ensure that gridlines are not annotated twice o The View Tasks that generated the gridline annotation have been removed from the AVEVA sample templates that were previously supplied o The AVEVA sample Drawlist rules that is used to find the old grid system have been modified to find the new reference grids to ensure gridline annotation is automatically generated For example consider the IDLI equipment discipline ADDE 2 ALL REFGRD WITH ATTRIB PURP EQ PLNT In the supplied sample project this rule would find REFGRD PLANT GRID A customer may continue with former grid annotation tasks but should ensure that the system automatic grid annotation is turned off This is achieved by setting the template View to reference a View Visual Style that has Grid annotation mode set to OFF In the instance where the Automatic Grid Annotation parameters are not TASK driven they may be modified by e Create a new Visual Style Set the Grid Annotation parameters as necessary and set the template view to reference this View Visual Style as descri
122. line styles not mapped will be converted to a default line style and a message output to the transform log 5 5 3 13 Line Thickness Alignment In AVEVA Marine Drafting the user can apply a shift option controlling the line thickness alignment during rendering This is not supported in AVEVA E3D Draw Left None Right In AVEVA Marine Drafting each line type has a system default thickness mm pattern definition pen ups and downs and pattern length mm At a project level it is possible to configure these parameters via environment variables This is not possible in AVEVA E3D Draw There are a number of differences in how lines are rendered in the Draw Canvas compared to AVEVA Marine Drafting and AVEVA PDMS Draft In AVEVA E3D Draw all lines are shown with the same thickness unless the line weight option is activated and the line thickness line pattern renders to the Draw Canvas zoom scale 5 5 4 Marine Transform Configuration File The Marine Transform Configuration file is used when the type of the transformed drawing is marine The Transform operation can be configured by defining a Transform configuration file This file should be pointed to in the Marine Project setup in the D 065 fie via the environment variable SBD ES3D DRAW TRANSFORM SETTINGS This is an example of a setting file XML format lt xml versione l 0 eTransrormoettings lt GridRuler gt lt RulerBaseLineStyle name MARINE BASE STYLE gt dae 70 w
123. ll rights reserved WWW aveva com Convert Profile Sprefs X Add Elements Current Element v Named Element unset Selected Elements Type Name 4 Attempted Succeeded a a Total Items 0 Mapping File SIGN_DFLTS profileist pmidat Conversion Summary Log File 3IGN_USERS LogConvertedSprefs txt AVEVA Everything3D 2 1 Migration amp Interoperability Guide The Convert Profile Sprefs form allows the Administrator to convert the profile specification of GENSEC and FIXING elements When the conversion is complete the Attempted and Succeeded columns are populated with the number of profile specifications that were attempted for conversion and the number that were successfully converted The conversion utilises a mapping file AVEVA DESIGN DFLTS profilelist pmldat to convert the Specification references Gtypes justification lines etc Mapping File SIGN_DFLTS t profilelist pmidat The Browse button adjacent to the Mapping File text box allows the Administrator to navigate to a required location and select an alternative mapping file It should be noted that whilst the new catalogue contains many more profiles compared to the old catalogue for some profiles in the old catalogue there are no equivalent profiles in the new catalogue This is because the National Standards have been updated and the profiles have been deleted from the standards Similarly customer profile catalogues or profiles where
124. meter save eases estou edema eeu sen UU EI UU CE UE EE 83 7 3 1 OI Ml ON C 83 AC EE OMIA TONS ME E E E A 83 ri MEME eM COINS 83 e m GU VIEW Form BOJE RE iaee Ea aSo Taes 83 7 4 Modules with Ribbon Menus cccccssceseeeeeeeeseeeeeeeenseeeseeeenseeeeeoeesseeeeeoeesseeeseoesseeeseoenseeessooeess 84 7 4 1 Customising Ribbon Menus with PML ueeeeesssssesseeeeeeenennennnnn nennen nnne nnne 85 PL MEE FS gare sec m 85 TED Other COM SIGS RENE 86 rP MEE ee 0 OPERE E 86 7 6 AVEVA PDMS Draft amp AVEVA Marine Drafting Customisation 86 7 6 1 Accessing DRAW 2D VIEWS iciiscisnestasansianeciansaidennanedeentanandanawaidssniicdcstongenansawdenannanavadeaneiciusieaneneaes 86 7 6 2 Accessing the Draw BrowSel cccccccsssccccseseeccceeseecceseeccseseeecceuseeessseeessaueeesseuseeesseseeessageees 87 A NEU COLD eee E eer ee ee ee ee eee 87 TDA PMLODIect TOF Sections issii ane aaa EA iaaa 87 TOS Mame Daling esee tots cesaecte eee uciaebaatasinesardamedte datiendnecstimeuaeccubeaiesneeadaandneceiiendeceees 87 Dah Mod le SWHCNING RR ct cet acts ect access eee team E E R 87 7 8 Writing PML code to work in both PDMS amp AVEVA ES3D cccccccssssssssssseeeseeeseneseeeeeeesenseeeeeeonnes 88 P I e 6 WWW aveva com AVEVA Solutions Limited and its subsidiaries All rig
125. n is considered an administrative task and is Hb u Lu E E available via the Convert Grid System button in the Grids group of the ADMIN tab New Grid Convert Grid Create Configure Links World Grids Integrator The Convert Grid System process is an administrative task access is only available to users with administration rights or as a free user Convert GRIDSY REFGRD x Add Elements ALL GRIDSY v Named Element unset Selected Elements Type H Name Initial GRIDSYs Final REF GRDs S 1 The Convert GRIDSY REFGRD form alows the Administrator to select GRIDSY elements for conversion by defining all elements selected elements or named elements within the project Total Items 0 SAL See The utility presents a conversion summary and maintains a log file to which any errors in the conversion process are written Log File 3M LISERSeLogConvertedGRI DS Y txt 4 H GRIDWL GRID SYSTEMS gt bg GRIDSY AREA 01 GRID When the GRIDSY to REFGRD conversion is complete the REFGRD SUC elements are displayed in the Model Explorer gt Bg REFGRD AREA 02 GRID REF By GRIDSY AREA 03 GRID All Grid Axis GRIDAX and Grid Line GRIDLN elements are converted to 4 REFeRDanEA 03 cup ner Grid Face GRIDFA Grid Elevation GRIDEL and Grid Plane GRIDPL gt Bg GRIDSY All Areas Grid elements gt Bg REFGRD All Areas Grid REF D The original GRIDSY elements are not deleted as part of the conversion and can be deleted
126. ne Drafting Similarly new sheets created in Draw will not be accessible The transformation process is not reversible other than by reverting or backtracking a database session It is recommended to copy libraries prior to transformation Transformation can be achieved in two ways e On the fly Visual elements will be transformed automatically on being opened the system will prompt the user to confirm first The advantage of this mechanism is that no up front transformation is required Instead visual elements are transformed as and when required A notable exception is the requirement to refresh Overlays please refer to Section 5 2 4 Refreshing Overlays e Bulk up front Visual elements can be bulk transformed up front This functionality is available from the Draw Command Window and also from the Draw ADMIN tab It is possible to run the transformation commands in both TTY and graphics mode When transforming an entire project the Transformation commands can be run at World level in Draw for each MDB Copyright 2015 93 WWW aveva com AVEVA Solutions Limited and its subsidiaries All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide Running the commands repeatedly is safe as they skip visual elements that have already been transformed A full log file listing transformed elements is produced D Prior to transforming drawings all relevant model data changes should be carried out first
127. ng Grid Plane names for the Ship Grid in the same format as in AVEVA Hull amp Outfitting 12 1SP4 is installed with AVEVA ESD 2 1 4 3 Supports A key development in AVEVA ES3D 2 1 the Supports application enables users to create multi discipline supports using an efficient and intuitive workflow that does not require write access to Piping Cable HVAC or connecting Steelwork elements Extending existing configuration capabilities AVEVA E3D 2 1 allows the user to configure various support types available within the Supports application to meet project requirements SUPPORTS f o LF 4 E E Ix Ta w Copy Support L Lock Unlock amp Align Support Drawlist work Trunnion Hanger Special Support Convert Delete Delete Supports E Heal x i Support To Special m Support Browser x Pad Support Wizard Che Create Modify Delete Tools J Support Editor x XFTOS XRTO1 Common Q P4 9 LL Primary Additional X d O P ae A 5 n na ly 1 co Orientate View Sand ed 2E Delete Copy Change T A EX dk an 7 F D Please note that AVEVA Outfitting Supports is not available in AVEVA E3D 2 1 In order to use the new Supports application with AVEVA PDMS or Hull amp Outfitting 12 1 SP4 or AVEVA E3D 1 1 version model data a number of conversion steps are necessary to make existing model data compatible with the new application Before project data can be successfully upgraded to function within the
128. ntation Rule Sets and Styles that will emulate the S RRST TT DRAPRJ REPRIGENISTRU representation found in AVEVA Marine Drafting 12 1 SP4 2 RRST TT DRA PRJ REPR IGEN HVAC 2 RRST TT DRA PRJ REPR GEN ELEC 2 RRST TT DRAIPRJ REPRIGEN PLOT PLAN In addition to alterations to the View Representation there may also be some Line Types that cannot be resolved in AVEVA E3D Draw This can be mitigated by using line style mapping please refer to Section 5 5 3 12 Line Types for further details It should be noted there are also some differences in how Hull Models are drawn in AVEVA ESD Draw As an example a Profile section will have a more accurate look for bulb bars but conversely there are instances where a Hull Model cannot be currently drawn in AVEVA E3D Draw Please refer to Section 6 3 4 Hull Data for a list of Hull elements not supported at the first release of AVEVA ESD 2 1 e Hull Symbolic Views A Hull Symbolic View will be transformed and maintained in AVEVA E3D Draw 2 1 Following the transformation it should be noted that subsequent to an Update Design the appearance may alter as the View reverts to a default setting e The View properties that control whether Text and Symbols are currently visible are not preserved and will revert to the default setting e nregards to Line type and colour control the Hull Symbolic View will be generated with the current AVEVA Marine Drafting default setting of keyword SVIEW LT COL If
129. ny database must be upgraded as a group It is not possible to upgrade a single master or extract independent of the remainder of the extract hierarchy In a Global project this requires the extracts to be relocated to the primary location of the master In ADMIN the Upgrade Status query Q UPGRADE STATUS provides additional information on secondary databases and those which own secondary extracts Global cannot upgrade extract hierarchies which contain working extracts at more than one location and it is not possible to relocate working extracts It is recommended that these should be deleted before upgrade Copyright O 2015 92 AVEVA Solutions Limited and its subsidiaries WWW aveva com All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide after data has been flushed If all working extracts are at a single location this location should be used to upgrade the master and its extracts The Upgrade Process The upgrade process will be undertaken by System Administrators responsible for the project at all locations When upgrading multiple projects many System Administrators will need to co ordinate The upgrade process will upgrade one project at a time Customers will need to give careful consideration to the order of upgrade for the various projects The projects will need to be locked for the duration of the upgrade with all Users out of the system The upgrade process will be e Ensure all users have
130. o Model element changes in AVEVA E3D 2 1 e g the use of GENSEC elements in lieu of SCTN elements modifications to Supports inclusion of Hull data and the introduction of Reference Grids it is expected that a number of customer Representation Rules and Styles will require updating and extending a TI DRA PRI REPW GEN PRESENTATION JA Nulref Updates to representation rules and pg TI DRA PRV REPRW GEN gt Jh TI DRA PRI REPRW GEN ALL styles have been made in the sample d TT DRA PRI REPRW GEN BASIC data amp TUDRAIPRREPW GENIPRESNTATON iB TI DRA PRI REPRW GEN PIPE n the example here the Representation i TI DRA PRI REPRW GEN PIPE PIPEINSUL Dashed Library denoted by REPRW GEN ih TI DRA PRJ REPRW GEN PIPE PIPEINSUL Solid includes a set of representation rules sia TI DRA PRJ REPRW GEN EQUIP adapted to the default white background a 11 DRA PRJ REPRW GEN STRU Draw Canvas JL TI DRA PRI REPRW GEN HVAC S TI DRA PRJ REPRW GEN ELEC S TI DRA PRJ REPRW GEN PLOT PLAN 5 3 2 Label amp Symbols In a similar fashion to the update of Representation Rules and Styles it may prudent to assess Label Templates and Symbol Templates in the customer project libraries to understand whether new Draw Copyright 2015 58 AVEVA Solutions Limited and its subsidiaries WWW aveva com All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide functionality may be utilised and whether updates are re
131. oduced in AVEVA E8D 2 1 include e Integrated Laser User Interface e Exact Clashing with intuitive object centric reporting e Integrated and simplified Pipework Modelling e Laser data area management amp Demolition e Incorporation of Laser Data in E3D Draw Drawings e HyperBubble technology allowing the user to walk or fly though a combined Model and BubbleView quality environment Copyright 2015 50 AVEVA Solutions Limited and its subsidiaries WWW aveva com All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide Please refer to the AVEVA E3D 2 1 User Bulletin and User Documentation for further information on laser capabilities in AVEVA ESD 2 1 4 5 1 Preparing for the HyperBubble There is no specific migration process for laser data within a Project but in order to access the HyperBubble functionality the laser data must have a texture render applied using LFM Server 4 4 Please refer to the LFM Server 4 4 user documentation for further information on the rendering process for laser data 4 6 Compare Update Compare Update has a dedicated tab and form accessed via the Compare Update Link Integration Accept AE Y AVEVA Instrumentation vi b TH Options MANAGE COMPARE UPDATE e 9 By By Filters cable Login Refresh Update Side by Source Destination Database Summary Side View Scope Source Selection Sourc
132. of Microsoft Corporation The Fluent user interface is licensed from Microsoft Corporation by AVEVA and use of the Fluent trade mark is strictly forbidden All other trademarks belong to their respective owners and cannot be used without the permission of the owner Copyright O 2015 4 AVEVA Solutions Limited and its subsidiaries www aveva com All rights reserved a A A PAT e an NT CONTENTS MM o el no TESI Em 9 1 1 Introducing AVEVA Everything3D 2 1 lleeelLeeeclieecuiiee nennen nhan nana a sana n sana n anna nna 9 1 2 The Migration amp Interoperability Guide 11111eee eee Leeeee ce e eeeee enne nena anna anna nnn 11 1 2 1 BUR NUI E C101 e NT m OT mM 11 L4 JAVEVAEXDOHODOO sentem tiududatsSexsdi cm seco ai Mer uc dU DMNEENS CMM esu uS a 11 2 AVEVALVSEDVIIIBOSD 2 ates 13 2 4 Workstation Configuration socccisisiccscssscsivccseincsiswsccanacivacdenssavevessnsasnesssenssancussdueausevessssnneuessseanswucsaecs 13 MAS CS ER RR A 14 2 2 1 Graphical PerdormnaNCE TITRE 15 MEE SE COR IG s issia eaa R aa A oR 15 2 4 Prerequisite for this Release Products c ccccccsssseeecesssseeesecensseeeseceasseeeseoeseeeeneoesseeeeseoaaas 16 24 1 AVEVALiconsing 2 0 0 sinsabi aai Ea 16 24 2 AVEVAChentGache Service 1 0 5 disiniccicniedccvsainvcttcaisnastuaimontieesabdetarinsuciicaswncatinleamvecicedphackeminnd 16 24 93 AVEVA Ca talog 2 1 0 eee een ce ee ee
133. of a project Backing Sheet and the replacement of any company logo in the Backing Sheet frame with a better defined Image logo Examples of AVEVA E3D 2 1 Libraries Styles and Templates are provided in the AVEVA Plant Sample Project APS and AVEVA Marine Sample Project AMS These examples may be referenced and or can be copied to a customer project as required For further details please refer to the Project Documentation The following sections outline a selection of Library administrative tasks in AVEVA E3D Draw that may be considered alongside the migration process from AVEVA PDMS Draft and Marine Drafting 12 1 SP4 to AVEVA E3D Draw 5 3 1 Representation Rules amp Styles The Representation Styles group within the View Format 2D tab allows the control of the View representation in the Draw Canvas through the definition of the View Type Representation Style and Hatching Style FORMAT 2D Sih id Global TT DRA PRI REPW GEN PRESENTATION TI DRA PRI HRUL GEN Hatch Representation Styles D The presented Hepresentation Styles are set by the User Defaults and usually defined by a Draw Administrator The displayed Representation Library RPLB contains Representation Ruleset RRST elements that are used to control the View representation of various Model elements This is achieved by the given Representation Ruleset containing Representation Rules that apply a referenced Style to a specified Model element type or name Due t
134. oject Change Description AVEVA TFS 79366 AVEVA AVEVA AVEVA AVEVA AVEVA AVEVA TFS 78338 AVEVA TFS 81668 TFS 81779 TFS 81225 TFS 81680 SI 51229 TFS 84190 TFS 78548 AVEVA AVEVA TFS 79366 AVEVA AVEVA TFS 87563 TFS 87847 AVEVA TFS 87786 TFS 87847 TFS 88566 AVEVA AVEVA TFS 69684 AVEVA TFS 64974 TFS 91807 AVEVA AVEVA TFS 82253 AVEVA TFS 95202 TFS 95040 TFS 94705 TFS 95168 TFS 95244 Copyright O 2015 Update to SLH catalogue data MDS Naming Files Update Incorrect elbos tee in AAEC and AATC TEE ELBO Para out of range 6 correction Updated Bolt holes for ANSI DIN and BS flanges Structural joint Standard Clearance Cutback COCO Table Update Add MDS Default files to ACPDFLTS folder Set PSIWEI UDA UUTYPE to MASS PPROP modifications to AVEVAHVAC CATA PTYP DIST on all SLH profile for Imperial Update of MDS Cross SKEY E3D Update to Pipe Data Table for Wall Thickness Parameter Error in catalogue category ABCF360 Bolting Catalogue Updates Extra COCO for screwed fittings Filter out SDNF plines PDMSPIPE COCO requires Purpose set to PIPE COCO Modifications MDS Naming Files Update SDNF UDA SDNF TYPE SLH Catalogue Data Update TT DRA MAS BACKS MET Revision Text Change Rung Ladder Hoops to ref MASTER SLHCATA Adjustment to mdb ALL structure Cabling Legrand amp Cablofil catalogue corrections Re structure Structural Dbs hide remove ASL dbs MDS Forward port Marine Endcut
135. om All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide 4 2 Grids A principal aid to the AVEVA E3D 2 1 Model Designer is the provision of new Grid elements called Reference Grids Reference Grids are formed in the Model Database may be used across an entire project and added with automated annotation to project drawings in AVEVA ESD 2 1 Draw Clipped Model Graphic along a Grid Plane with Model annotation Elevations and Grid Labels ms xA qu AA Sy WS 4 Isometric view of Grid with associated Structure in Draw with automated annotation Elevations and Grid Labels Please refer to the AVEVA E3D 2 1 User Bulletin for an outline of available Grid functionality and how they may be utlilised and incorporated into both Draw and Model alike 4 2 1 Ship amp Plant Grid Conversion To facilitate use across a project Plant and Ship Grids are stored in a Design DESI database In AVEVA PDMS and Hull amp Outfitting 12 1 SP4 and AVEVA E3D 1 1 the Grid is stored beneath a Grid System GRDSYS element while in AVEVA E3D 2 1 the Grid is stored below a Reference Grid REFGRD A conversion tool is available in AVEVA E3D 2 1 Model to convert Grids from GRDSYS to REFGRD elements Copyright 2015 35 AVEVA Solutions Limited and its subsidiaries All rights reserved www aveva com AVEVA Everything3D 2 1 Migration amp Interoperability Guide ADMIN 4 A The conversio
136. onment variable name Copyright 2015 e WWW aveva com AVEVA Solutions Limited and its subsidiaries All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide The following table shows equivalent AVEVA PDMS Hull amp Outfitting and AVEVA E3D environment variables PDMS Environment Variable AVEVA E3D Environment Variable PDMSEXE AVEVA_DESIGN_EXE PDMSUI PMLUI PMLLIB PMLLIB PDMSDFLTS AVEVA_DESIGN_DFLTS PDMSPLOTS AVEVA DESIGN PLOTS PDMSUSER AVEVA DESIGN USER PDMSWK AVEVA DESIGN WORK PDMSREPDIR AVEVA DESIGN REP DIR PDMSHELPDIR AVEVA DESIGN HELP DIR PDMS INSTALLED DIR AVEVA DESIGN INSTALLED DIR PDMS MARINE AVEVA DESIGN MARINE PDMS ACAD AVEVA DESIGN ACAD PDMS ACAD PATH AVEVA DESIGN ACAD PATH PDMS CONSOLE WINDOW AVEVA DESIGN CONSOLE WINDOW PDMSLOG AVEVA DESIGN LOG PDMS DEBUG AVEVA DESIGN DEBUG PDMSABALOG AVEVA DESIGN ABA LOG PDMSABAHYPER AVEVA DESIGN ABA HYPER PDMSABAPLOT AVEVA DESIGN ABA PLOT PDMSABABATCH AVEVA DESIGN ABA BATCH PDMSABAREPORT AVEVA DESIGN ABA REPORT PDMSABADATA AVEVA DESIGN ABA DATA PDMSLOGOPT AVEVA DESIGN LOG OPT PDMSABA AVEVA DESIGN ABA 7 2 2 PMLLIB PMLUI and CAF UIC PATH Path It is recommended that PMLLIB and PMLUI paths are used to add customised PML functions to AVEVA ESD This is the same approach as used in AVEVA PDMS and Hull amp Outfitting with PMLLIB and PDMSUI paths A variable CAF UIC PATH is used in AVEVA ESD to specify where the system will find c
137. ork Cabling Plines amp Ppoints Steelwork Settings v Profile F Insulation Profile Obstruction Visibility Translucency Primary Nodes F Display Size 100mm Colour ii Secondary Nodes F Display Sie 50mm Colour L AVEVA Everything3D 2 1 Migration amp Interoperability Guide On the Steelwork tab uncheck the Display checkboxes in the Primary Nodes and Secondary Nodes frames Click the Save button the Apply button and then the Cancel button On the 3D VIEW tab in the Manipulate group open the View Direction options list and select the first Isometric button the icon may be different i e North must be pointing to the top left hand corner of the 3D View pu d In the Status bar in the bottom left hand corner of the E3D window Bt yat H click the Display Grid toggle to turn the LCS grid off Plan Setting the Auto Colours rules and Translucencies Colour Representation Steelwork Cabling Plines amp Ppoints General Colours CE BN Active E Visible L Aids Highlight Tracing EN Auto Colour Settings Auto Colour W Auto Colour Components 4 Dynamic Auto Colour Auto Colour Rules Copyright 2015 AVEVA Solutions Limited and its subsidiaries All rights reserved On the 3D VIEW tab in the Settings group click the Graphics button to display the Graphics form Check the Auto Colour Components toggle This will allow to have Joints Fitting in a
138. patial maps Copyright 2015 106 AVEVA Solutions Limited and its subsidiaries All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide AVEVA E3D 1 1 1 1 0 7 AVEVA E3D 2 1 2 1 0 0 AVEVA E3D 1 1 1 1 0 7 www aveva com AVEVA E3D 2 1 2 1 0 0 Origin Ref AVEVA TFS 176513 TFS 176542 TFS 176621 AVEVA AVEVA AVEVA TFS 168886 TFS 183081 SI 151262 TFS 158073 TFS 164854 AVEVA TFS 180161 TFS 181499 TFS 162761 TFS 185203 Project Change Description Multiple Updates and Corrections Power system diagram released for 3D Change DB MPROJECT DICT to Multiwrite Access Replace AvevaNetExportConfigAddin xml AMSDFLTS Multiple Updates and Corrections Project Description document updated to Rev 3 New format Project Description document BSHEE Update and ILP Defect Text Enable BSHEE Versioning Linkdoc XPRD dbs VSI View Section Indicator DRAW Libraries Set Isometric preview to PDF Support Reports in DFLTS DATA Supports Symbol File added to ISO OPT Files Commenting Report Templates Admin Team and User for Structures UI AMS Master reconfigure to remove compatibility issue AVEVA Everything3D 2 1 Migration amp Interoperability Guide AVEVA E3D 1 1 1 1 0 7 AVEVA E3D 2 1 2 1 0 0 Copyright 2015 107 AVEVA Solutions Limited and its subsidiaries All rights reserved WWW aveva com AVEVA Everything3D 2 1 Migration amp Interoperab
139. patible with the AVEVA 12 0 series or earlier A file for example APS Project description pdf is included in each project folder giving brief details of the purpose and data included in that project The Catalogue Project ACP provides example component data and specifications Component Data All data in the projects are provided as sample data only and should be verified prior to production use Major project differences at AVEVA E3D 2 1 include e The main catalogue sample project formerly MAS is now called ACP AVEVA Catalogue Project e The main sample data projects formerly SAM and MAR are now called APS AVEVA Plant Sample and AMS AVEVA Marine Sample e Sample drawings are in the new Draw format and Draw project libraries have been extended to support new Draw capabilities e The catalogue has been enhanced for structural supports and bolt holes e Additional data has been added to support the use and demonstration of Supports Structural and Laser The AVEVA sample projects are regularly revised Please check the AVEVA Support Site AVEVA Everything3D Fix Release History frequently for updates A detailed list of changes is included in Appendix B Details of Sample Project Changes 2 8 1 AVEVA Sample Laser Data 1 1 AVEVA Laser Sample Data 1 1 is available for use with AVEVA ESD 1 1 for the purpose of familiarisation with the extensive laser functionality available including the new HyperBubble technology
140. perties are subject to the same limitations described earlier e The following AVEVA Marine Drafting dimension properties via menu options have no direct equivalent in AVEVA E3D Draw 2 1 Modify Modify Dimension Flip Arrow Modify Modify Dimension Hide Unhide Create Dimension gt Advanced gt Fit Create Dimension gt Advanced gt Text position Create Dimension gt Unsymmetrical tolerance Note AVEVA E3D Draw displays the tolerance via the text lt max gt lt min gt Create Dimension gt Advanced gt Arrow type 25 Note AVEVA E3D Draw displays this as solely a Circle rather than the Circle and Cross observed in AVEVA Marine Drafting Create Radius Diameter Dimension gt Type 3 2 arrows Note The Text and Arrow Layout is limited to the first choice in AVEVA E3D Draw and a line between the arrows Is omitted 5 5 3 8 Position Rulers A position ruler will be transformed to a Grid Ruler element GRDRLR in AVEVA ES3D Draw In order for this to succeed the project must contain a Reference Grid REFGRD element with a Ship Coordinate definition Please refer to Section 4 2 1 Ship amp Plant Grid Conversion for further information on the conversion of Grid Systems to Reference Grids in AVEVA E3D 2 1 Model Grid Rulers in AVEVA E3D Draw are more advanced than the former Position Rulers with the ability to configure the appearance of the Grid Ruler via a Visual Style
141. plied with AVEVA ESD 2 1 and installed if necessary Processor Type Speed Intel x86 or x64 compatible CPU with high performance in each processor core A full installation requires approximately 1GB of drive space Operating System s In addition extra capacity is usually required for local storage and data this may be Hard Disk Storage used for the database cache where the Database Cache Service is employed The use of two SATA 300 RAID HDDs is recommended where projects are stored on the local machine The product has also been verified with solid state HDDs Displa High resolution widescreen display recommended 1920 x 1200 dual screens also dio supported Minimum resolution 1280 x 1024 NVIDIA Quadro AMD FirePro or similar Graphics Card Please refer to Section 2 2 Graphics Cards for further information NTFS File System For information on conversion to NTFS please see http technet microsoft com en us library bb456984 aspx Please note that a Windows Platform Update Windows 7 SP1 and Windows Server 2008 R2 SP1 is a pre requisite for accurate 2D rendering for example Text graphics in the 3D canvas http support microsoft com kb 2670838 AVEVA does not support the installation of E3D 2 1 software and or Projects on to disk volumes with Short 8 3 file name format disabled Please ensure that Short 8 3 file name format is enabled on all relevant volumes before installation Please refer to Knowledge
142. pproach is not compatible with automated conversion so the storage units must be defined For compatibility it is possible to set the units to NUMERIC which will disable Units conversion for that physical dimension Disabling a specific dimension in this way means that no advantage will be gained from the introduction of that dimension Previous versions of Schematic Model Manager had special units support for Angle Area Pressure Temperature Volume and Weight values that could be included in the ISO 15926 format import file Units UDAs were provided as mandatory UDAs and were attributes on each Diagram element SCDIAG The chosen units for these dimensioned quantities could be set in the Project Options form in Schematic Model Manager In 12 1 the new units capabilities mean that the special units support in Schematic Model Manager is no longer required Data imported in 12 1 will be stored in the appropriate units consistent with the data read from the ISO 15926 import file The upgrade process for projects moving to 12 1 includes a part upgrade for Schematic Model Manager dimensioned data Please note that the CATA database elements MSET MTYP ATLI USEC and UDEF are no longer used they will be removed from the database in due course Schematics functions Projects that are upgraded from PDMS 12 0 or earlier need a suitable module definition in order to use the new Engineering functions in the new Tags product see above Copyright 20
143. qui DRWG IDLN fix C1101 SKIRT amp COLM SKIRT ae Team Membership for DB ASSOC ASSOC TFS 118930 Integrator Redesign data TFS 85183 TFS Diagram File realignment for Cable and HVAC 86327 TFS 122573 Pipe Fabrication Sample Data TFS 57069 CU Config Default Mapping Files TFS 123714 PIPER amp EQUIPMAN R W access to Links and Groups AVEVA Reset Integrator Links TFS 120297 Isometric ADP MDS Symbol amp Label TFS 124375 Project Liby update for Pipe Fabrication TFS 126553 EX of User Defined Fitt Strt Bran Conn off End of Main AVEVA Lib Update Structural DRWGs with REFGRIDs AVEVA Renumber DBNOs for Imperial DBs TFS 136671 Norsok sample datasheets and data TFS 95675 Convert SCTN to GENSEC AVEVA Flexible Explorer Structural PBS changes TFS139949 Commenting Database Additions XPRD DB TFS139953 Lexicon Data for Cross Product Databases DICT TFS 95675 Convert Refs to new Cata Profiles for GENSECs TFS 129316 Replace GRDSYS elements with GRDREF elements AVEVA Unset Badrefs on Area03 Zone and two pipes TFS 129316 Structural FRMW GRDREF setting and name changes TFS 129316 Set GRDAXE on Grid faces amp elevations GRIDX GRIDY GRIDZ TFS 112167 Structural PBS USDA Usysty correction to STRUCL AVEVA Add REFGRDS to GPSET Groups AVEVA Correction to FRMW names AVEVA CABLE HAVC and PIPING Diagrams Update TFS 146534 A Area01 100 B 1A Branch Href reset AVEVA Revision Control Config for Diagrams TFS 139099 Sample Bolt Reports
144. quired e g Auto tagging rules that reference SCTN elements will be required to be updated for GENSEC elements and Label Templates may be required to identify and support Grid annotation of the new Reference Grids 5 3 3 Visual Styles Introduced at AVEVA E3D 1 1 a Visual Style contains pre set representation properties for the Draw elements View Text Label Dimension and Grid Ruler An element adopts a Visual Style either through definition on creation or by modification The use of a Visual Style ensures the consistency within the Sheet and across a series of Drawings The properties of the Visual Style are determined by the Draw Administrator and any further alterations to the Visual Style are reflected in each instance the style has been referenced At AVEVA E3D 2 1 the View Visual Style has been extended to allow the definition of Grid Annotation in a View and a Grid Ruler Visual Style has been introduced For further information on the use of Visual Styles including the definition of Grid Annotation and Grid Rulers in Draw please refer to the AVEVA E3D 2 1 User Bulletin and User Documentation AVEVA E3D 2 1 Draw is supplied with the AVEVA Default Visual Style which is initially assigned to labels text dimensions rulers and view frames by default The Visual Style may be specified by the Draw user prior to element creation by setting the style within the Active Visual Styles group of the Annotate tab ADMIN A n To add or modify a
145. r to the NET Customisation Guide for further information on the use of the Flexible Explorer customisation in AVEVA E3D 2 1 6 3 6 Unit Sets Unit Sets can be created using AVEVA Administration 1 4 Lexicon module but are not utilised in AVEVA E3D 2 1 Please refer to the AVEVA Lexicon User Guide for further information on the definition and use of Unit Sets Copyright 2015 78 AVEVA Solutions Limited and its subsidiaries www aveva com All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide 6 4 AVEVA Global 3 2 1 AVEVA Global 3 2 1 has been released to support AVEVA E3D 2 1 AVEVA Engineering 14 1 1 AVEVA Diagrams 14 1 and AVEVA Administration 1 4 products but is also compatible with AVEVA PDMS and Hull amp Outfitting 12 1 SP4 AVEVA Global 3 2 1 should be used for all sites in a project whether running AVEVA E3D 2 1 or AVEVA PDMS or Hull amp Outfitting 12 1 SP4 For further information on the use of AVEVA Global with AVEVA ESD 2 1 please refer to the AVEVA Global 3 2 1 Release and User Documentation 6 5 AVEVA Clash Manager 12 1 HOME B amp P9 b Clashes Checker Data Integrator z MENEP The forthcoming AVEVA Clash Manager 12 1 will be B Clashes compatible with both AVEVA E3D 2 1 and AVEVA PDMS or E a Check CE Hull amp Outfitting 12 1 SP4 GM Auto Clash Copyright 2015 79 AVEVA Solutions Limited and its subsidiaries WWW aveva com All rights reserved
146. rability Guide 2 4 4 2 Microsoft Internet Explorer Internet Explorer 8 or later is required to support AVEVA ESD 2 1 e g the Model and Draw Design in Context feature 2 4 4 3 Microsoft NET Framework AVEVA E3D 2 1 uses Visual Studio 2010 and NET 4 0 SP1 for NET Customisation Please note that serialized settings of the user interface configuration are now saved in the following location on Windows 7 and 8 1 C Users lt username gt AppData Local Aveva AVEVA Everything3D 2 1 2 5 Environment Variables AVEVA ESD 2 1 relies on the use of environment variables for various aspects of configuration notably the location of folders for project databases and user workspace When setting up a user s environment please bear in mind that Write access is required for folders such as AVEVA_DESIGN_USER and AVEVA DESIGN WORK The installer uses default locations for both the program files and these data folders that are different from those used for PDMS These were chosen to work better on Windows 7 and 8 1 additional dialogs enable the user to control them better The defaults are Work files C Users lt username gt AppData Local Temp User files C Users Public Documents AVEVA USERDATA Environment variables are usually set up for AVEVA ES3D by the program initialisation INIT file when running interactively or by using a batch BAT file D Note that at AVEVA E3D 2 1 an optional feature is available whereby a customer may
147. raw could then be formed and the new database included while excluding the PADD databases to be used in AVEVA Marine Drafting only This recommendation is aided in AVEVA Marine Drafting by the Copy Drawings tool available File gt Databank Copy Drawings thus allowing drawings to be copied prior to the transformation process This prior copying of drawings will prevent AVEVA ES3D users from accidentally overwriting AVEVA Marine Drafting drawings For detailed information on the Copy Drawings function please refer to the 12 1 SP4 Marine Drafting User Guide 5 5 3 Transformation of a Marine Drafting Drawing incl SDB File amp Picture File In AVEVA Marine Drafting a Drawing is stored in the PADD database but also defined by a SDB file and Picture file While the Picture file is a cache and can normally be regenerated from the information found in the PADD database the SDB file may contain information that is only found therein and not in the PADD database AVEVA ESD Draw does not support SDB files and will solely operate with the data found in the PADD database and Picture file Therefore the AVEVA Marine Drafting drawing must be modified during the transformation operation on being opened in AVEVA ESD Draw 2 1 This operation is a variation of the transformation process previously described in the chapter the key difference being the need to account for all the information contained only in the SBD file and translate it to the PADD dat
148. re adding to the MDB structures required Using RECONFIG SESSIONS in the FROM phase of the reconfigure operation will preserve both the sessions and references As a summary Locally Encoded Legacy Databases e can be opened for read access in both PDMS 12 1 and earlier versions of PDMS e can be opened for write access in both PDMS 12 1 and non Unicode versions of PDMS but the range of characters which may be used is restricted to the set defined by the project settings e require that the project settings are correct so that characters can be interpreted correctly e canbe reconfigured to a Unicode encoded database Unicode Encoded Databases e cannot be opened for read or write access in versions of PDMS prior to 12 1 e can store the full range of Unicode characters available in PDMS 12 1 Units of measure Distance and bore units are handled in much the same way as before and should need no conversion Other attributes will now be converted to and stored in appropriate units Details are given in the PDMS 12 1 User Bulletin Where a database has stored all quantities of a dimension in the appropriate unit the new functions can be used without upgrade Attributes other than distances and bores have the UNIT field set for the first time in previous versions of PDMS they were until now stored as values with no specified unit other than by use and convention they could change from application to application and project to project This a
149. remove all the Project evars from the corresponding bat files apart from proj 000 and ID required to display project in Login form On selecting the project and entering AVEVA E3D 2 1 the start up process will look to the project and set up any required environment variables Where an evar is already set the start up process will leave that untouched thus avoiding any unnecessary changes 2 06 Network AVEVA ESD 2 1 is best run on a network offering Internet access The system will by default be set up to access the latest online version of the documentation from the AVEVA website It is possible instead to install the documentation locally It may be downloaded from the AVEVA Support website currently AVEVA Everything3D Documentation 2 1 2 7 Install Installations using setup exe will install to C Program Files x86 AVEVA Everything3D2 1 0 by default The individual msi files will use the drive with most free space by default It is important that any files including configuration files or sample data that need to be updated by users are accessible for read write etc so they are not by default installed with the software This is particularly important when installing in Program Files due to the introduction of User Account Control UAC In particular this makes it important to ensure that files that need to be written are accessible by users without Administrator privileges This applies to folders specified by environment
150. ries All rights reserved www aveva com AVEVA Everything3D 2 1 Migration amp Interoperability Guide To ensure the optimal performance of the graphical memory i e when utilising laser data it is recommended that the Physical Processor is altered where employing a NVIDIA graphics card T NVIDIA PhysX is a powerful physics engine that can utilise GPU acceleration to provide amazing realtime physics effects Select a PhysX processor Using the NVIDIA Control Panel setting a Quadro K2100M v GPU allows an increase in PhysX processing and may improve overall performance und In the example here the PhysX processor has been set to the NVIDIA Quadro K2100M graphics card RJ m GE 2 2 1 Graphical Performance To ensure optimum graphical performance and in addition to any Graphics Card specified the workstation used for AVEVA ESD 2 1 must conform to a reasonably high specification To aid this specification AVEVA E3D 2 1 has been verified with 3DMark amp www 3dmark com A measure of overall system performance the score includes CPU RAM etc Following verification with AVEVA E3D 2 1 a recommended 3DMark score is summarised in the table below Please note that the rating may vary from machine to machine depending on hardware specification and software installed The recommended scores are therefore indicative only 3DMark Combined Score 130 000 70 000 Note Laptop score is an average scor
151. rkflows therein are greatly aided by the available images png for joints and fittings Selection Z 1 Joint s selected z Specification 2 Beam to Column Joints Y X Joint Group ol The Section Fitting Modify Joints forms include a selection gallery displaying all available joints and fixings that may be applied within the current specification Column Flange Column Web All icons and help files are available for the J standard Joints and Fittings catalogue These are Joint png files which are stored in the file S a Aveva lInteraction Structural Resource S resources Full Depth End Flexible End Plate Flexible End Plate Plate 200m 150mmx8mm 200 10mm In addition a sketch of the joint or fitting including the defining Parameters of the joint or fitting can be opened via the Detail button on the Create Fixing Modify Joints forms No of Bolt Rows In regards to the migration process an important consideration is the inclusion of user defined customer images of Project Joints and Fittings to complement those already found in the structural application The following will describe how to create icons png format for a customer joint and fitting catalogue and the process to follow in the naming and storing of them Please refer to Appendix C Forming Structural Joint amp Fixing Images for further information and a recommended workflow for the creation of quality image
152. rlays are to be transformed as part of a bulk up front transformation process Refreshing is necessary in order for Overlays to appear correctly in AVEVA E3D Draw sheets Unlike transformation a refresh does not affect the use of overlays in AVEVA PDMS Draft or AVEVA Marine Drafting in any way This is important when using AVEVA E3D Draw in a mixed project environment Please refer to Chapter 5 Draw Data for further information on the transformation process from AVEVA PDMS Draft and Marine Drafting 12 1 SP4 to AVEVA E3D 2 1 6 2 6 2 Sharing Library Elements Sheets in Draw can reference DRAFT library elements without the need to transform them with the result that these can be shared between DRAFT and DRAW Overlays only must be refreshed before use in DRAW see section Transforming DRAFT data for DRAW This does not affect their use in DRAFT in any way AVEVA PDMS Draft or AVEVA Marine Drafting may still reference transformed AVEVA E3D Draw library elements but this is not recommended as any changes made by E3D Draw may not be represented correctly In a mixed project environment it is therefore recommended to copy library elements before modifying them in AVEVA E3D Draw The modified library elements can then be referenced exclusively by AVEVA E3D Draw sheets 6 2 6 3 Supports Area Based ADP There is no specific upgrade requirements for the Draw module in regards to the representation and drawing of the new supports However
153. rred that may require review Errors occur when rules are re executed and cannot be evaluated or when the geometry of the support template does not match that of the previous template Copyright 2015 43 AVEVA Solutions Limited and its subsidiaries WWW aveva com All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide Conversion status including possible conversion errors is highlighted by the Conversion status area of the form l HeH Total Items 3 Templates with possibl j b emplates with possible conversion errors can be Lo selected and investigated via the Details button The Template Conversion Details form is prompted and displays possible errors detected Rule Definition Joint Definition or Geometry Definition errors r T Template Conversion Details We oS Possible errors detected Item a Typ A Error Type A Description Ez e p CYLINDER 1 of SUBSTRUCTURE SUPPORT SPECIAL CYLI RULE DEFINITION Rule for attribute HEIG of CYLINDER 1 of SUBSTRUCTURE SUPPORT SPECIALS BSILIGHTING 1 SUBS1 cannot be evaluated BOX 1 of SUBSTRUCTURE SUPPORT SPECIALS BS BOX RULE DEFINITION Rule for attribute POS of BOX 1 of SUBSTRUCTURE SUPPORT SPECIALS BS LIGHTING 1 SUBS1 cannot be evaluated CYLINDER 2 of SUBSTRUCTURE SUPPORT SPECIAL CYLI RULE DEFINITION Rule for attribute POS of CYLINDER 2 of SUBSTRUCTURE SUPPORT SPECIALS BS LIGHTI
154. s 4 1 4 1 Naming All joint and fitting specification components SPCO elements within the AVEVA Sample Catalogue are named following a simple naming convention For example e Joint SPCO J1S1 WEL PFC PFC 001 J1S2 SNS PFI PFI 001 and J2S4 FEP PFI CTUB 002 e Fitting SPCO F1 CIR CTUB 4H STIFF FS PLT PFI 001 and F2 FLS PFI VAR Copyright O 2015 32 AVEVA Solutions Limited and its subsidiaries WWW aveva com All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide The reciprocal image must be named as per the SPCO with the exception that any forward slash is replaced by a hyphen In addition SELE elements also require an image with a similar naming convention used Attributes x F1 SGR ANGL D02 Track CE ut In AVEVA Catalogue Paragon SPCO and SELE elements Attribute Value P have an attribute Icon which is the full name of the icon file stored in the resource file The ID prefix is added to all icon names In determining the help sketch image the file name is based upon the name of the STCA element owning the Catref of the SPCO where a Catalogue joint fitting or alternatively the Template name Tmpref of SPCO is used where a Template joint fitting D The image names are case sensitive so it is advised to use only upper case in icon names Indeed when files are added to resource files the names are all upper case D When adding pngs files to a resources file with
155. s 7 Outline Translucent elements Utilities 7 Show World Axes 7 Show Borders Background Colour Graduated Capping Colour L 7 Capping Lighting Brightness 0 70 Reflection 0 60 Reset to Defaults A Graphics Settings Colour Representation Steelwork Cabling Plines amp Ppoints Representabon Settings v Tube 7 Flange Bolt Holes Drawn Centreline Tracing V Holes Drawn J Ant Alias Levelof Ant Aiss 8 v Insulation Visibility Translucency Off v Obstruction Visibility Translucency off Representation Rules Level Pipe Nozzle Structure Others Mass Cable Tolerance Arc Tolerance 0 1mm On the 3D VIEW tab in the Settings group click the Current View button to display the View Settings form e Inthe Effects frame make sure that all four checkboxes are checked e n the Background frame change the Colour to white and uncheck the Graduated checkbox e Inthe Lighting frame change the Reflection value to 0 60 using the slider On the 3D VIEW tab in the Settings group click the Graphics button to display the Graphics Settings form e On the Representation tab in the Representation Settings frame set the Level of Anti Alias to 8 from the options list e n the Tolerance frame set the Arc Tolerance to 0 1mm Copyright 2015 AVEVA Solutions Limited and its subsidiaries All rights reserved 111 WWW aveva com Colour Representation Steelw
156. s stored in PADD sometimes not Where they are stored depends on by which function the geometry was created and how the Persist environment variables are set in Marine Drafting Such element types are Texts Contours and Dimensions of type Linear Radial Angle 5 5 3 11 Referenced Drawings In the scenario where a drawing contains a reference to another drawing the reference will be expanded upon prior to the transform This will result in the reference becoming a part of the transformed drawing in AVEVA ESD Draw Copyright O 2015 68 AVEVA Solutions Limited and its subsidiaries WWW aveva com All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide 5 5 3 12 Line Types The set of system defined line types in AVEVA E3D Draw do not fully correspond to the line styles available in AVEVA Marine Drafting The following AVEVA Marine Drafting Line Types do not exist in Draw DashedAndSolid SS SSS Track sy ems Oo RO RO RO Ro RO RO Ro RO Ro Ro RO m System6 system Systema Systema System15 System16 System22 oo 6 O0 0 6 O D O O O O O D O O0 6 OD O0 O O0 O OD 6 O O0 0 O DO O System23 System24 System25 System26 System27 ARAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA ik My System 5 CNNNNNNWANNNNS 3 My System e
157. semasuiosupesEmpI ESI nde ern a nee CPI M M Ru eee ee eee 58 obo Vica CENE RE E 59 Sor VU Ey SNR 60 OO MEMMIUS a E E E 60 5 4 Reference Grids in Draw AE 61 5 4 1 cens IA DP 61 5 4 2 Area Based ADP eee ne er ee en ene eee ee eee ee eee ee eee 62 3 4 2 The Isometric a MEC 63 5 5 Using a Marine Project with Draw ssannnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn mennun mnnn 63 Sd Draw System Defaults ccccccccccsssssecceeeeeeeessesseceeeceeeaenssseeeeseeeeaeenseceeeeeeeaeansseceeeeeesaaasseeeeees 63 5 5 2 Drawing Database Storage ccccccccccccccceceeececeesesssseesececeeeeeeeeeeeeeeeasaueeseeeeeeeeeeeeeeeeeeesesaaaaas 63 5 5 3 Transformation of a Marine Drafting Drawing incl SDB File amp Picture File 64 5 5 3 7 p eee eee 67 5 5 4 Marine Transform Configuration File ecciesie nnne nnne 70 6 Compatibility amp Interoperability Le eese see eee creer eee rennen enn nnne nana 73 6 1 Compatibility with other AVEVA Products ceeeeeeeeeeeeee eene n nenne nnn nnn nha nasa asas annu nr nnne 73 6 2 Interoperability AVEVA PDMS or Hull amp Outfitting 12 1 SP4 74 6 2 1 mice m
158. siderations ahead of the successful implementation of the product 1 1 Introducing AVEVA Everything3D 2 1 AVEVA Everything3D 2 1 AVEVA E3D 2 1 is an innovative new flagship 3D design product from AVEVA covering the needs of Plant industries AVEVA ESD 2 1 also introduces the capability to display interact with and draw Hull models produced in AVEVA Marine AVEVA ESD 2 1 provides a platform that enables lean construction principles to be adopted increasing quality and speed of execution throughout the entire project This is achieved through advanced usability for all design tasks which improves productivity by utilising latest technologies and best in class User Experience to enable innovative and ever more efficient project execution processes This is demonstrated by the clean and intuitive user interface of the product that encourages graphical centric modelling and interaction GENERAL HOME VIEW TOOLS MANAGE DESIGN AIDS GENERAL lt a ee E er C amp Paste fs C Rotation i fs Copy xi Editor Move Rotate Delete Collections Comments Properties Attributes fh Paste 3 Copy Mirror Wo Painter Selection Create Modify Delete init Li J NI 1 ON ax A X LIAN LA ul V ah N S Hull Model in AVEVA E3D 2 1 Copyright 2015 3 WWW aveva com AVEVA Solutions Limited and its subsidiaries All rights reserved AVEVA
159. sing DRAW 2D Views DRAW does not support additional 2D Area View gadgets Instead DRAW has a single 2D View commonly referred to as the DRAW 2D canvas which supports multiple tabs Copyright 2015 86 AVEVA Solutions Limited and its subsidiaries www aveva com All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide The DRAW 2D canvas supports all expected CURSOR interaction commands To display a logical element BACK SHEE OVER SYTM in a new tab on the DRAW 2D canvas use the following command runsynonymwithargs CALLIBM UELEMSEL Element Name Notes e The INSERT command for dimension points is deprecated and now always adds the new point as the last dimension point The SORT DIM command should be used as required e The HIGHLIGHT command is deprecated and no longer do anything The ENHANCE command is recommended to be used where Draw elements are to be highlighted through selection e Some of the more obscure PLOT and LIEXEC syntax is deprecated and does nothing Please refer to the Draw User Manual for the full PLOT and LIEXEC syntax The recommended way of adding user defined controls to the canvas is by defining a new ribbon tab and adding user defined controls to that 7 6 2 Accessing the Draw Browser In general terms in order to open a picture owner the following syntax may be used omsys executeCommand AVEVA Draw CommandOpenPicture Alternatively the following synta
160. sing the user interface has been removed at AVEVA ESD 2 1 but it is still possible to prompt using PML The following will display the borders but the statements must be in the order given Copyright O 2015 83 AVEVA Solutions Limited and its subsidiaries WWW aveva com All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide view statusline true Iview borders true 7 4 Modules with Ribbon Menus AVEVA PDMS and Hull amp Outfitting main menu bar and toolbars are not implemented in AVEVA ESD 2 1 Model and Draw modules All code referencing menu gadgets must be changed to access equivalent PML Command objects D The menu bar and toolbar has also been removed from AVEVA Administration 1 4 and AVEVA Catalogue 2 1 The PML Command objects allow application code written in PML to access properties of gadgets on ribbon menus PML Commands are described in the Software Customisation Guide and the Software Customisation Reference Guide Menu Button In AVEVA PDMS and Hull amp Outfitting and in AVEVA E3D modules with a main menu bar and toolbars PML code can query and change properties of menu gadgets directly as illustrated in the diagram Menu Properties Application Function All access to gadgets on a ribbon menu in AVEVA ESD is via Command objects as illustrated below User Interface Configuration UIC files contain a definition of the content and layout of ribbon menus Visibili
161. sitive and shall not be adapted copied reproduced stored in a retrieval system or transmitted in any form or medium by any means including photocopying or electronic means without the prior written permission of AVEVA Solutions Limited Where such permission is granted AVEVA Solutions Limited expressly requires that the Disclaimer included in this Training Guide and this Copyright notice is prominently displayed at the beginning of every copy that is made Licenses issued by the Copyright Licensing Agency or any other reproduction rights organisation do not apply If any unauthorised acts are carried out in relation to this copyright work a civil claim for damages may be made and or criminal prosecution may result AVEVA Solutions Limited and its affiliate companies shall not be liable for any breach or infringement of a third party s intellectual property rights arising from the use of this Training Guide and associated documentation AVEVA Solutions Limited 2015 Trademark Notice AVEVA AVEVA Everything3D AVEVA E3D AVEVA Tags Tribon and all AVEVA product and service names are trademarks of AVEVA Group plc or its subsidiaries Use of these trademarks product and service names belonging to AVEVA Group plc or its subsidiaries is strictly forbidden without the prior written permission of AVEVA Group plc or AVEVA Solutions Limited Any unauthorised use may result in a legal claim being made against you Fluent is a trade mark
162. ssing Standard TT42 PR27 MDS PRELIMINARYIDEF ALULTS Missing Standard PR27 DTU4 MDS STRUCTURE DEFALILTS Missing Standard DTD4 A Message E T qp ET The Update Defaults button is clicked to add or update an application C Users Public Documents AVEVA default within the project defaults database Once completed a Message ii cree window is displayed to inform the user that the required number of OK defaults have been successfully created or updated A log file containing detailed information about the modifications to the database is created during the defaults update The log file is created in the current AVEVA DESIGN USERS directory and is named mdsDefaultsUpdate log 4 3 3 Template Data MDS TEMPLATES based template data from AVEVA PDMS 12 1 SP4 and AVEVA E3D 1 1 is no longer compatible for use with the Supports application at AVEVA E3D 2 1 A conversion tool is provided to transfer existing template data into a recognised format Three main changes have been implemented to the format of template data for use with the Supports application e Template data is now stored in an application data world hierarchy rather than a site based hierarchy e All SCTN members and sub members have been converted into GENSEC based hierarchies e All PNOD PJOI constructs are converted to ENDATU FIXING constructs that are owned by GENSECs a In APPLOW SLIPPORT F RAMESIBS a In APPDAR SUPPORT F RAMES BSIAREA i In APPLDA SLIPPORT F RA
163. stration work Although Everything3D 2 1 is industry neutral and can be used on either Plant or Marine projects it does use project settings to customise itself in ways appropriate to Plant or Marine Later fix releases of AVEVA PDMS or Hull amp Outfitting 12 1 SP4 may be required for compatibility to account for fix releases of AVEVA E3D 2 1 which contain modelling enhancements Please regularly refer to the AVEVA PDMS or Hull amp Outfitting 12 1 SP4 and AVEVA E3D 2 1 release notes for information on continued compatibility between the products The following sections will outline a number of project considerations where AVEVA PDMS or Hull amp Outfitting 12 1 SP4 and AVEVA ESD 2 1 are used on the same project Please refer to the AVEVA E3D 2 1 Release documentation for the latest information on known exceptions to the interoperarbility of AVEVA E3D 2 1 and AVEVA PDMS Hull amp Outfitting 12 1 SP4 6 2 1 Project Setup To facilitate the use of AVEVA PDMS or Hull amp Outfitting 12 1 SP4 and AVEVA E3D 2 1 on a project it is important that the appropriate environment is defined to utilise both products on the project e AVEVA PDMS 12 1 SP4 Project In most cases an interoperable project setup will typically involve adapting an AVEVA ESD 2 1 setup to use an AVEVA PDMS project The following is recommended e Check that the project is up to date and is using AVEVA PDMS 12 1 SP4 Fix 28 or later e In AVEVA ESD 2 1 add a cal
164. te Design is invoked for the first time Copyright O 2015 66 AVEVA Solutions Limited and its subsidiaries WWW aveva com All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide 5 5 3 6 Symbols Symbols in AVEVA Marine Drafting will be exploded during the transformation process i e converted to 2D geometry Thus a transformed symbol will not be treated as a single entity in AVEVA E3D Draw but as a collection of primitives without model intelligence 5 5 3 7 Dimensions There are a number of 2D and 3D dimension types in AVEVA Marine Drafting and the transformation process will endeavour to include them in AVEVA E3D Draw as true dimensions AVEVA Marine Drafting dimensions that have no corresponding equivalent in AVEVA E3D Draw will be transformed as simple 2D geometry Examples include Curved Area 3D Coordinate Curve Length WCOG Shell Profile Mounting Angle and Distance to RSO dimensions In general dimensions will be transformed to AVEVA E3D Draw and displayed with a similar appearance However there are notable differences in how a dimension is transformed and thereafter managed in AVEVA E3D Draw compared to AVEVA Marine Drafting e A Dimension that has been de persisted in AVEVA Marine Drafting will be transformed as simple 2D geometry The dimension will look like the dimension found in AVEVA Marine Drafting but it will no longer be a dimension e Dimension Text fonts and other text pro
165. the Resource Editor the prefix is added automatically so the prefix is not required on the png file itself 4 1 4 2 Storage of User defined Images Customised images icons or help sketch may be added to the default resource file Aveva Interaction Structural Resources resources in the AVEVA E3D 2 1 installation folder but it is recommended to create a new Resource file to store customer images D Please note that the Joint Fitting forms must be prompted in AVEVA ESD 2 1 to first populate the Resource Editor To create a new Resource file the Resource Editor can be utilised from the installation folder of AVEVA E3D 2 1 Resource Editor mE jS Ta ag g Invariant Language InvariantC 23 Strings i j 3 Strings S Icons dd B Add New RESOURCES file m A new Resource File is added on RENTUR clicking the icon A new image is added to the resource file by clicking the Add New Resource File from the Bitmaps tab and then selecting the required png file to be added Resource Editor New File jesse DR A png file can also be added to the Resource Editor window by a Drag and Drop action The file is to be saved with an easily identifiable name for example Company Resources resources The next step is to open the Aveva lInteraction Structural RHesources resources file and edit the string ID FILE STRU IMAGE FILE to refer to the created resources file
166. thing3D 1 1 project eeeeeeeeee eee eeeeeeeeeeeeee eene 24 3 4 AVEVA Catalogue and AVEVA Administration eeeeeeeeee ecce ccce eere enne nennen nnn 25 3 5 Customer PML amp NET Applications 1 ceeeeeeseeeeeeeeeee nenne nnne e enn n nnn n anna nana asas annu rr nnus 25 A LORI em HR 27 SREY RETE Um 27 4 1 1 wj eue CONV Cl SIU DRE TDOR Hm 28 41 2 Catalogue Joints amp Fittings ieu rrt nan ttkntkin tan xem nah eno nr eye uma erAn XR VES xxn d namUu a n TR n cH gn 29 EE icio e PI uei 21 ee ee 30 4 1 4 Adding Joint amp Fitting Images sseseessseseesseeeeeene nnnm nenne nn nennen nnns 32 4 1 5 Stairs Ladders amp Handrails si cancoespcticnesiustinctrannetuaccuncenegancacvnoce sient Unten Edo cer EREE Se dentur Seno KREA 34 cue tm ee ee eee 35 4 2 1 Ship amp Plant Gnd Conversion ca vskendketisexRs QURE TE PUER xU Pha te ER R KY FU PEB ES EK TERUP Enn Fui PU PEDI dA QUOI 35 SUPPO TE E B wt 37 4 3 1 AAO ASS WOO CS o ar E T stes M DeceU NE UD MUN MIU Ih UE 38 4 3 2 Supports Application Defaults eessssssessesesseeeeeeeeeennn nennen nnne nennen nnns nnns 40 AS MEME 00 1 18 rm 41 4 3 4 Model Data Upgrade rH 47 A35 S ppon Designer ACCESS siiis aaraa aa aa a e aa ONU IR NaN 47 P PNO e E 48 4 4
167. thod used with PML main menus Both methods are described in the E3D Software Customisation Guide In order to maximise sharing of PML code between AVEVA E3D and AVEVA PDMS and Hull amp Outfitting it is necessary to separate functions that access properties of the GUI from application code or data access code One approach to this is to create PML functions or objects that provide a standard interface to GUI specific code allowing application code to be written that works with either GUI For example setting the tooltip on a PML menu button is done with PML code but tooltips on ribbon buttons are set in the uic file A PML function or method can be implemented that sets the tooltip on a PML menu button but does nothing in AVEVA ESD For example define method setWallSpecTooltip tooltip is STRING if defined appdesmain wallSpec then appdesmain wallSpec settooltip tooltip endif endmethod Similarly a method or function can be used where the action taken differs between AVEVA E3D and AVEVA PDMS and Hull amp Outfitting In the following example a value is retrieved from a PML gadget in PDMS and in AVEVA E3D it is retrieved from a command object linked to a field on an AVEVA E3D ribbon define method getWallProfileSpecification is STRING if defined appdesmain wallSpec then Copyright 2015 88 AVEVA Solutions Limited and its subsidiaries All rights reserved WWW aveva com AVEVA Everything3D 2 1 Migrat
168. ty active state and where appropriate content of ribbon tab buttons and controls can be controlled by PML Command Objects but new gadgets can only be added to ribbon menus in UIC files uic File Tabs Buttons Command and other controls Command Context Properties Message Application Function D Note that Command Objects can be implemented in PML or in C Copyright 2015 84 AVEVA Solutions Limited and its subsidiaries www aveva com All rights reserved A user interface customisation tool is provided to modify UIC files button shown below in the Model and Draw modules ProjAPS ALL Model AVEVA Everything3D AVEVA Everything3D 2 1 Migration amp Interoperability Guide The Customise form is accessed via the 98 amp Clashes Checker Mark Mark Active Customization File Module 4 h amp Context Menus 2 Active Customization File Command Bars 5 Menubar Ribbon Resource Files i X E IS ee uv Ui CU o B M ws D e hee CJ B Display Control Type Menu Menu Menu Menu 5 Menu Menu Menu Menu Menu Menu Menu Menu Menu Menu Menu Menu Menu Button Button Button Button Button Button Button F Integrator Search Collections Comments Properties Attributes File MyDataAddin MyDataAddin MyDataAddin MyDataAddin MyDataAddin MyDataAddin MyDataAddin MyDataAddin MyDataAddin MyDataAddin MyDataA
169. ural Conversion utility This is required to support the new hierarchy described The User may wish to convert the structural profile specifications for support template steelwork In this case the user should use the Update Profile tool detailed in Sections 4 1 2 amp 4 1 3 Please note that cases in which profile size substitutions have been made in the case of deprecated steelwork sizes it may be necessary to manually reposition the template steelwork to account for any size differences Copyright 2015 42 AVEVA Solutions Limited and its subsidiaries All rights reserved WWW aveva com AVEVA Everything3D 2 1 Migration amp Interoperability Guide Convert Template Site X Total Items 3 Selected template sites to convert Name H Database Name On clicking the Convert Templates button the Convert Template Site form is displayed The potential Template Sites to be converted are listed alongside the respective Database Names s Total Items 0 Conversion status Mame Conversion Status Total Items 0 Convert Template Site X Candidate templates may be promoted and demoted for conversion by the use of the up and down arrow buttons below the listed Template Sites Total Items 3 al Selected template sites to convert Mame H Database Name d At the end of the conversion process a number of checks are performed against the old MDS TEMPLATES site to identify any conversion errors that have occu
170. ustomised User Interface Configuration files Copyright 2015 82 AVEVA Solutions Limited and its subsidiaries www aveva com All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide 7 2 3 Core dlls The name of many of the AVEVA assemblies DLLs have been altered at AVEVA ESD 2 1 In most cases the word CORE has been introduced to replace the former PDMS notation for example the assembly Aveva Pdms Database has been renamed to Aveva Core Database This change is to align naming with the core codebase that AVEVA ESD 2 1 utilises Core functionality and supporting code has now been separated to support a number of AVEVA products As a consequence customised C Visual Studio projects will need to be refactored for the new references The USING amp NAMESPACE commands used in PML and associated with C controls will also need to be updated such as the PMLFILEBROWSER NETGRIDCONTROL etc 7 3 Forms amp Menus 7 3 1 Form Layout The AVEVA ESD form definition language is compatible with PDMS but the presentation of form gadgets is different This can lead to minor problems with the layout of forms moved from AVEVA PDMS and Hull amp Outfitting to AVEVA E3D Most forms will work without modification but some will require minor adjustments to gadget spacing and alignment Form layout of docked forms may need to be changed to account for the new Sliding Forms minimum form width See section 7 6 4 for
171. variables such as AVEVA DESIGN WORK and AVEVA DESIGN USER The AVEVA Everything3D installer has been designed to allow the separate definition of suitable folders with different defaults Copyright O 2015 18 AVEVA Solutions Limited and its subsidiaries www aveva com All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide D Itis not recommended that any combination of AVEVA products are installed in the same folder because AVEVA does not guarantee runtime compatibility between Separate Products on different release cycles and the uninstall of one of them subsequently damaging the other For further details please refer to the AVEVA Everything3D 2 1 Installation Guide This may be accessed from the start screen of the installation process or found within the E3D210 release folder 2 8 AVEVA Everything3D Projects 2 1 As part of the install process for AVEVA E8D 2 1 a variety of standard model projects may be installed and thereafter used in the product The projects are also available as a separate download available here AVEVA Everything3D Projects The sample projects have been extended enhanced and renamed but wherever data matches the previous AVEVA PDMS and Hull amp Outfitting sample model data the same reference numbers and database numbers are used to ensure compatibility D Note that all databases are in Unicode format as found in the AVEVA 12 1 Series so are not com
172. vious version of the MDS APPDEFAULTS database The utility to check and update the Supports Application Defaults is provided in the AVEVA Catalogue 2 1 Paragon module SUPPORTS The tool is accessed by clicking the Check Supports Application Check Supports Defaults button in the Tools group of the Supports tab Application Defaults 1 The user must have suitable permissions to modify the catalogue to successfully update the Supports Application Defaults The Check Supports Application Defaults form is prompted Check Supports Application Defaults 2 X i No pons setst NE no problem detected The Check Defaults button allows the user to check the Supports application defaults database against the standard set of defaults contained in the MDS Update Defauts project Copyright 2015 40 AVEVA Solutions Limited and its subsidiaries All rights reserved www aveva com AVEVA Everything3D 2 1 Migration amp Interoperability Guide The defaults database is checked to determine if any default standards are missing or if any updates to existing standards need to be applied D The Check and subsequent update may take a prolonged period of time to complete All detected updates to existing standards or missing default standards are identified in the Check Supports Application Defaults form Check Supports Application Defaults 2 X Identified Updates Discipline Description TT42 MDS TRUNNION DEFALLTS Mi
173. ww aveva com AVEVA Solutions Limited and its subsidiaries All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide lt RulerCenterLineStyle name MARINE CENTER STYLE gt RulerLongHorStyle name MARINE Y STYLE gt RulerLongVerStyle name MARINE Z STYLE gt RulerFrameStyle name MARINE X STYLE gt lt GridRuler gt lt TransformSettings gt The Grid Ruler section of the Configuration file has settings which are relevant when transforming a Drawing with Position Rulers A Position Ruler is transformed to a Grid Ruler GRDRLR The appearance of a Grid Ruler in AVEVA E3D Draw is controlled by a Visual Style and a required style can be defined within the Configuration file depending on the ruler type e RulerBaseLineStyle Visual style for a Base Line ruler e RulerCenterLineStyle Visual style for a Centre Line ruler e RulerLongHorStyle Visual style for a Longitudinal Horizontal ruler e RulerLongVerStyle Visual style for a Longitudinal Vertical ruler e RulerFrameStyle Visual style for a Frame ruler E 71 WWW aveva com AVEVA Solutions Limited and its subsidiaries All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide Copyright O 2015 72 AVEVA Solutions Limited and its subsidiaries WWW aveva com All rights reserved i Way vA 4 a TIN WV The following Chapter will outline the AVEVA products that are compatible with AVEVA E3D 2 1 and wil
174. x may be used to call the Administration Browser it should be noted that the Browser does not support selection omsys executeCommand AVEVA Draw CommandShowPictureBrowser In the specific context of a selection for example the selection of a label via the Select Label browser the browser can be called using omsys executeCommand AVEVA Draw CommandLabel 7 6 3 Use of CDLimits It should be noted that the use of the CDLimits UDA has been replaced by the use of the Attribute VWLIMI It is recommended that this attribute is used in any customisation Please note that for existing Drawings VWLimits is set from CDLimits on first entering the 3D View but is not used thereafter 7 6 4 PML Object for Sections With the introduction of extensive Section functionality in the Draw Canvas and 3D View the PML Objects SectionPlaneManager and SectionPlane have been deprecated at AVEVA ESD 2 1 7 6 5 Marine Drafting In regards to a Marine Drafting specific customisation it should be noted that the MAR API is not available in AVEVA ESD 2 1 7 7 Module Switching AVEVA E3D 2 1 does not include the AVEVA Administration or AVEVA Catalogue products now in the Manage product family Is should be noted that if macros are used that switch between modules now in Copyright 2015 87 AVEVA Solutions Limited and its subsidiaries WWW aveva com All rights reserved AVEVA Everything3D 2 1 Migration amp Interoperability Guide
175. y Guide The HUB can be locked without the need for a server command using the command LOCK It is possible to confirm whether locations are locked by evaluating the return result from QUERY LOCK AT location The Hub can also unlock satellite projects UNLOCK AT lt location gt Extract Hierarchies It should not be necessary to change the extract hierarchy nor to consolidate data within extract hierarchies Therefore the System Administrator should not need to FLUSH ISSUE DROP data between extracts working extracts are an exception to this see below Nor should they need to delete any extract families to leave only Masters However all extracts will need to be relocated to a single location although this does not need to be the HUB Working Extracts Working Extracts cannot be propagated as they are specific to a single location See note in section 3 2 1 Offline Locations Global supports Offline locations without a Global connection Offline locations do not support distributed Extracts but can support stand alone extract families It will not be possible to co ordinate the upgrade from another location if Offline locations are used The Offline satellite databases and standalone extract families will need to be upgraded there and data transferred to the hub in the normal way International characters Unicode New text files including Datal files will be output by default in UTF 8 with a BOM unless the CADC LANG

Additional User guide/upgrade information.

Contents

Download Pdf Manuals

Related Search

Related Contents