Home

English - Lucky Technology Ltd.

1. Description LCD Display 1 The default access status is OUT at 6 59 Thu Aug 30 06 59 ID _ OUT 2 The default access status changes to IN at 7 00 to F1 at Thu Aug 30 07 00 11 30 to F3 at 12 30 and back to OUT at 16 30 ID IN Thu Aug 30 11 30 ID F1 Thu Aug 30 12 30 ID F3 Thu Aug 30 16 30 ID OUT The entry can be removed by simply clicking on the blue Time link which is circled in red in the above figure for illustration purpose 60 iGuard LM Series Operation Manual Version 3 6 Note The user can always override this default access status by pressing the Backspace key a few times until the desired access status is displayed on the LCD before entering the ID Holiday Setup Use this page to establish the Company Holiday List The Holiday list is used for the time restriction purpose along with the day of week settings for access right control The following is a typical example of the setting 3 iGuard Fingerprint Security System Microsoft Internet Explorer File Edit View Favorites Tools Help Q Back 0 x 2 A Search Favorites gt Address e http 192 168 0 Gecke html EJ e iGuard Security System Company Holiday List Date of Holiday MM DD YYYY BRETT co Company Holiday MM DD YYYY Jul 2007 07 01 2007 Sun Tue wed Thu SE SE En M 7 ie aa asa 22 23 24 25 26 27 28 29 3
2. In most cases use the default settings for optimum performance Security Level This is the System Level setting that specifies the security level iGuard would use for a user if the Personal Security Level for the user is set to Normal follow system setting as shown in the following figure e Guard Fingerprint Security System Microsoft Internet Explorer WS ID x File Edit View Favorites Tools Help aw Q Back Y gt sl l2 el gt Search e Favorites gt Address a http 192 168 0 del html E Ho E iGuard Security System IA CH Employee Record First Previous Next Last Acc Log Help Employee Record Employee Data Department Employee ID if 00 10 Char Max 0 9 4 8 M EVERYONE Last Name No 20 Char Max Check All Clear All First Name EH 20 Char Max Other Name Title F 20 Char Max Password Password Not Assigned Save New Password See Remarks 1 New Password 8 Char Max 0 9 4 B Existing password is not shown for security reason Status V Active Security Level Personal Normal follow system setting zl n a in automatch Save or Delete this record 1 Check to save New password UncCheck to use Existing password not shown AAA AAA O aaa Other Personal Security Level settings would overrides the System Level setting above 54 iGuard LM Series Operation Manual Version 3 6 AutoMatch Security Level This is to specif
3. PE Terminal ID shows the ID of the unit Terminal Descriptions shows the description of the unit Firmware Version shows the Firmware Version of the unit The information is necessary should technical support is required in the future Other Feature contains three entries The first one Remote Door Relay Support indicates that this unit is equipped with the hardware interface for connecting to the optional Remote Door Relay unit more detail can be found in the Appendix The 2 one SSL refers to the optional Security Socket Layer feature which is a standard network security protocol for network communications between iGuards Note The SSL is not a standard iGuard feature It is available at extra cost Please contact the manufacturer or the local dealer for more information in obtaining this feature 43 iGuard LM Series Operation Manual Version 3 6 The 3 one Authenticated Master Slave means that the System Administrator Password is required for Slave units to communicate with a Master unit More on this can be found in the last chapter Keypad Operation gt Function Menu gt Func 0 Advanced Feature Model shows the model number of the unit Registered Employees amp AutoMatch show the number of the registered users and the number of AutoMatch enabled users IP Address shows the IP address of the Guard unit iGuard s indicates the total number of units that are connected
4. The program iServer exe can be downloaded free of charge in the manufacturer s website Please refer to the Appendix for more information about this iServer exe program 4 Configure Master Slave Password Authentication for Master Mode only A new feature has been introduced in this firmware release that enables the Master unit to check against the Slave unit s System Administrator Password and only accepts the slave units that match the password with the Master unit As a result only authorized Slave units can be connected to and communicate with the Master unit If the slave unit s System Administrator Password does not match with the one in the Master unit the Slave unit will be rejected and an error message will be shown on the LCD display of the Slave unit However this feature is not available in previous firmware release and the Master unit by default will not check the password for the Slave unit that runs on the previous firmware versions Therefore for security reasons the Master unit may be configured so that it will not accept any slave unit that runs on the old firmware version as illustrated in the following Description While in Function Menu press 0 to select Advanced Feature then press 2 a few times to skip the other items until you get to the item Configure Master Slave Password Authentication scrolling message gt Press 2 to select YES for this Configure Master Slave P
5. Thu Aug 30 13 28 ID IN If the master unit is not reachable e g the network connection is lost or the Master s IP address is wrong the error message Master Offline will appear on the LCD display 17 iGuard LM Series Operation Manual Version 3 6 Note It is suggested that all units run on the same firmware version in a Master Slave network And one cannot mix the other Guard model e g the FPS model with the LM model in a network Note For security reason the system administrator password of the slave unit must be the same as the Master unit Otherwise the master unit will reject the slave unit and the error message Master Password Mismatch will appear More on this topic will be discussed in the later section KEYPAD OPERATION gt Function 0 gt Configure Master Slave 18 iGuard LM Series Operation Manual Version 3 6 KEYPAD OPERATION This section will discuss the Func Key i e the Function Menu and the Backspace Key More functions and options are available in the built in web interface which will be discussed in next section The Function menu To enter the Function Menu press the Func key in the Standby Mode and enter the System Administrator Password default 123 then press the Func key again to confirm the password Then the device will scroll and display all the available functions one by one There are 12 entries in the Function Menu i e Functio
6. Version 3 6 iGuard LM Series Operation Manual Connection Diagram Basic Connection v002 B01 9 T z 1 abed eae quawquedag Bug weubetq uor343S uuo9 puengt DUT Abo ouyos jang uwe T IPuJj 3xg WYETH IPuj lyxg O uvwe jy TeuJe3x panuesay panuesay vJOSUSS Jo JOSUSS ADO WA4EIH euue4xg JOSUSS uoo DN 841495 4007 WOJ 941435 voo ON 3143S 400 D 2 198 amod DU pyengt Bn d Aamod 21 Velo E venopd 0 AZI poi 14017237044 JN 19848 92433 WOOg 21449913 0 A 20421 91 4143S oog 403 h ddnS enmncd 79 Version 3 6 iGuard LM Series Operation Manual ic Connection Large Load Bas 1 7 1 Beq vOBZ B1 9 BT ny 3uaw3 edag Bug weubetq UOTIJIGUUOS puenyt p37 AboTouyss ong ue TB P4u493x3 WME TY euua4xg panuasay panuasay Mosuas uco Mosuas cog ON 91433 coq WOO 917495 Jo ON 9217495 400 ADEC J modg 20 puengt Bntd vamog 20 JOSUSS ADO wwe TB IEN UY WA IEN vencd OU he1 poi uo132 10J4d J343 40eg H ATA JUne1 3 3 0 F 3143S oog 403 Ayddns J nog gI ueu3 uebueq JUSAAND ulnul1xXP gt 343S Jop 214739813 80 Version 3 6 iGuar
7. Department in the next chapter Using The Web Browser for more information Function 0 Advanced Feature This function contains a number of handy tools for setup and network diagnosis 1 Connection Test This is for testing the network connection between two iGuards It shows the connection speed with the target Guard It also shows the Firmware Version and the Serial Number of the target unit as shown in the following example Description LCD Display 1 While in Function Menu press 0 to select Advanced Connection Test Feature Then you will be asked if you want to perform a Yes No 1 2 _ Connection Test 25 iGuard LM Series Operation Manual Description 2 Press 1 to select Yes then you will be asked to enter the IP address of the target iGuard Enter the IP address of the target iGuard 3 Press Func to confirm and then enter the Port number 4 Press Func to confirm If the target iGuard is valid the Firmware Version the connection speed and the target Serial Number of the target iGuard will be displayed as shown note only the last 8 digits of the serial number are shown 5 Press Backspace to return to the Standby Mode Version 3 6 LCD Display IP Address 192 168 000 123 Port 80_ Target Firmware Ver 3 6 8583 Echo Received Time 190ms Target Serial No 021A 121F Thu Aug 30 13 56 ID _ IN This test is
8. ID A03 Added OK Enter ID Thu Aug 30 13 34 ID _ IN Once the personal password is assigned the user can use it to get authenticated as follows Description 1 While in Standby Mode key in the user ID number e g A03 2 Instead of using the fingerprint press the Func key to indicate you are using the Personal Password The unit will prompt you to enter the Personal Password 3 Enter the Personal Password e g 1234AB 4 Press the Func to confirm If the password is correct the unit will authorize the user and will return to the Standby Mode as shown Checking the Access Log LCD Display Thu Aug 30 13 36 A03_ IN Your Password Your Password k lt lt A03 Authorized Thu Aug 30 13 36 ID _ IN In the Web Browser specify the IP address of the iGuard e g http 192 168 0 100 to go to the iGuard webpage Click on the Access Log link at the left side circled in red and the following entry in the access log will be shown 14 iGuard LM Series Operation Manual Version 3 6 O x E File Edit View Favorites Tools Help Q Back x 2 0 Search lt Favorites gt address a http 192 168 0 100 Adminsfindex html SE E iGuardm Security System E Access Log Employee ID Terminal ID Department Status iod From To MM DD YYYY all Departments ET I DR Terminal In Ou
9. 1 While in Standby Mode press the Func key to enter the Function Menu You will be prompted to enter the System Administrator Password as shown 2 Enter the System Administrator Password default 123 3 Press the Func key to continue and the function menu will appear 4 Enter 5 to select the System Configuration menu The current date is displayed 5 Press the Func key 9 times to skip the other settings You will then see the message asking if this unit is a master or slave unit 6 Enter 2 to select Slave Then the unit will ask for the IP address of the Master unit 7 Enter the IP address and press the Func key to continue You will then be asked to enter the port number of the Master unit 8 Enter the port number and press the Func key The unit will reboot itself and then return to the Standby Mode 9 After a few seconds if the Master unit can be reached the user database will be synchronized from the master unit to this slave unit and the corresponding message will appear during the process 10 Once the synchronization is done the unit will return to standby mode and is ready for use LCD Display Enter Password Enter Password kkk Press 1 Add Update ID Date M D Y 08 30 2000 Master Slave 1 2 Master Master IP Addr 192 168 000 100 Master Port 80_ Thu Aug 30 13 25 ID _ IN Synchronizing Please Wait
10. All rights reserved US Patent No 6 643 779 To delete a single department or a group of departments first check the checkboxes of the departments and press the Delete button at the bottom Please note that the default department EVERYONE cannot be deleted and it does not have a corresponding checkbox next to it Click on the Department ID hyperlink to edit the access right for each individual department For example to edit the marketing department click on the Department ID MARKET and the following page will appear 39 iGuard LM Series Operation Manual Version 3 6 3 Guard Fingerprint Security System Microsoft Internet Explorer File Edit View Favorites Tools Help Q Back x 12 2 Search Favorites gt address B Guard Security System Department Record First Previous Next Last Acc Log Help Department Record Department Data Department ID MARKET 8 Char Max Description Marketing Department 30 Char Max Time Restrictions Click Monday Sunday to edit the time restriction i DO 01 02 03 04 05 06 07 08 09 10 11 12 13 14 15 16 17 18 19 20 21 22 23 TETANY BNO eee a A a VANA A EE YY h E A Aa h SA YY S ENA NANA YY AA AEN E e YY APAY hh ay ON a ER G PY EE MYER HEEN R EE inet hitless ed YY YY YY YY YY YY YY Terminals M Any Terminal A123 Check All Terminals Clear All Checked Terminals Save or Delete
11. Security System Add Access Log New Access Record ID 8801 Date 07 29 2007 MM DD YYYY Time f18 00 HH MM SS In Out Cin out C F1 CF2 CF3 CF4 Last Updated Sun 29 Jul 2007 05 55 20 01999 Lucky Technology Ltd Al rights reserved US Patent No 6 613 779 E Wi A Wiese It is sometimes necessary to add a record manually for an employee For example the employee might have forgotten to clock out before going home at the end of the day and so it is necessary to make up for the mistake by manually adding this entry back which is particularly useful for payroll purposes By default only access records which have been manually added can be changed or deleted In the above example an entry for user BB01 will be manually added to the access log and the access log report will become 64 iGuard LM Series Operation Manual Version 3 6 iGuard Fingerprint Security System Microsoft Internet Explorer Edit View Favorites Tools Help ay Ce A e O Search o Favorites gt address http j 192 168 0 100 edoisfndex tin E ze B Guard Security System Access Log First gt Next Last Employee ID Terminal ID Department Status Period From To T an Departments lat za d Ia y ID Name Date Time Terminal In Out B1011 Leung Wei Kun ES 07 30 2007 08 39 30 002 BB12 Ng Raymond Engineer O7 30 2007 08 37 28 Main B1009 Chu Kin Man FER 07 30 2007 08 27 39 Ma
12. Time Restrictions Click Monday Sunday to edit the time restriction Department ID MARKET Description Marketing Department DO 01 02 03 04 05 06 07 08 09 10 11 12 13 14 15 16 17 18 19 20 21 22 23 NBs hu Q ACA A fh aa O y db dices as a EE YUY YY YY YY AN AAA ee s EEN A as qap ha y EE EE Ee Et YY YY YY YY YY YY YY YY YY Ye Time Setting SelectAll C No Access User Define Houroo 01 02 03 04 05 06 07 os 09 10 11 12 13 14 15 16 17 18 19 20 21 22 23 00 30 Mini r cic ic ie e e e v ie e elei ie e sssi e aad al ala ll lc cll cl cl cll cl cll alll Apply Setting to Wed Thu Fri sert Holiday The authorized time period can be selected at the bottom of the page If it is necessary to select all the time slots simply select the Select AUT checkbox above The All Days checkbox can also be selected to include all the days of the week The Holiday option is set in the Holiday Setup page which will be discussed later in this chapter Add Department Use this page to add new department The operation is similar to the steps discussed above Note The maximum number of departments is 32 including the default department EVERYONE Access Control Quick Access is an access control feature of Guard which when activated allows users to come and go without authenticating individually The system administrator can authorize this Quick Access per
13. iGuard LM Series Operation Manual Version 3 6 Description LCD Display 3 Press the Func key to confirm The ID is deleted and the ID A01 user can no longer access the system Deleted Press Backspace to return to Standby mode Thu Aug 30 13 47 ID IN Note Once the user ID is deleted all the information associated with the user including the fingerprint data name and the access right will also be permanently deleted The user must be re registered to regain access rights However access log data will be retained Function 5 System Configuration This is for setting up the system date and time and for the network configuration as discussed in the last section Getting Started Function 6 Set Password iGuard has three global passwords e System Administrator Password for system administrator to access the system menu and to configure the system This password gives full access to the iGuard e User Administrator Password for user administrator to manage the user accounts Specifically the user administrator can access the Function 1 2 3 4 amp 9 in the function menu only This password does not give access to change system settings e Door Access Password if Quick Access mode is enabled users can use this password to bypass the normal user verification process to release the door strike This Quick Access mode can only be enabled through the web interface which will be discu
14. Acc Log Help New Employee Record Employee Data Department Employee ID d 10 Char Max 0 9 4 B V EVERYONE PEA Last Name d 20 Char Max fsck f M icom First Name 20 Char Max IT Other Name f Title d 20 Char Max KNIT Password Password Not Assigned MAKT Save New Password See Remarks 1 I TECH New Password 8 Char Max 0 9 4 B Existing password is not shown for security reason Status V Active Auto Match Security Level Personal Normal follow system setting zl n a in automatch Check All Clear All Save or Delete this record Remarks 1 Check to save New password UnCheck to use Existing password not shown By default the department EVERYONE is assigned to all new users Uncheck the checkbox if no department is to be assigned to the user After adding the user follow the same procedure discussed above to further assign a smartcard to the user i e using the Func 9 menu if the user is to use smartcard for authentication Similarly for iGuards equipped with the optional fingerprint sensor the user needs to register his fingerprint using the Func 1 menu discussed above for fingerprint authentication Department Prior to adding employees to the iGuard unit it is a good idea to establish departments For smaller companies this may not be as applicable but departments are helpful for establishing permission to individual iGuard units and access times
15. B1077 Yu Andre SES R 09 30 1999 19 58 58 FLATB Out 3 C0O01 Leung Brian tote o 09 30 1999 19 58 50 FLATB Out 4 B1166 Chan Chuen au 09 30 1999 19 56 45 FLATB Out 5 A1174 Go Kai Yin Sdt0 A 09 30 1999 19 52 30 F1103 In 6 B1082 Cheung Moni ti f y 09 30 1999 19 21 05 FLATB Out 7 B1011 Leung Wei Kun c G U 09 30 1999 19 06 18 FLATB Out 8 B1067 Lau Ester Bi py 09 30 1999 18 58 11 FLATB Out 9 A1154 Chow Man Keung Psaatj 09 30 1999 18 36 48 F1103 Out 10 A1050 Chan KC 645W 09 30 1999 18 20 59 FLATB Out 11 A1002 Wong Kit Ching A a s 09 30 1999 18 19 07 F1103 Out Export Employee Use this to selectively backup particular users information from the internal user database to another device instead of backing up the whole database 67 iGuard LM Series Operation Manual Version 3 6 a iGuard Fingerprint Security System Microsoft Internet Explorer File Edit View Favorites Tools Help Q Back Y Pis JO Search Favorites gt Address hetp 192 168 0 eeschte html bi B iGuard Security System Export ort Employee s Information Select Employee s to export Important 1 Maximum 20 Employees can be exported each time 2 If you want to export all Employees record use the Back
16. Door Relay Control for IN If enabled the built in door relay will be switched on for all successful clock in accesses This is also applicable to the optional Remote Door Relay unit which will be discussed in the Appendix Door Relay Control for OUT This is the same as the IN counterpart discussed above except it is for the OUT access status Note This option is useful if the device is installed outside of the main door of the premises and the device is used for both access control and time keeping purposes By disabling this option the door will not open if someone clocks out from the device when leaving the place Door Relay Control for F1 F4 This is the same as the IN counterpart discussed above except it is for the F1 F2 F3 amp F4 access status Door Relay Delay Timer This is to specify the duration in second of the door relay when it is switched on The default is 3 seconds Set this to a larger value if the iGuard is 55 iGuard LM Series Operation Manual Version 3 6 not installed immediately next to the door and the user may take a few seconds to reach the door after being authenticated Beep Sound Use this to enable disable the built in beeper which is useful if quiet operation is required Code Setting This is for Smart Card operation only This Code is a 4 character string that will be written to all smartcards issued b
17. File Edit View Favorites Tools Help Q Back 9 x 2 Le J Search gt Favorites gt Address a http 192 168 0 100 Adminsfindex html SE C Others fen 1 65535 Subnet Mask 255 955 255 0 DNS Server IP 203 80 96 10 203 80 96 9 Default Gateway IP 192 168 0 252 Internet SNTP Time Server time synchronization SNTP Time Server URL stdtime gov hk Status Enable Oise Time synchronization DNS Server IP and Time Zone Clock setup must be valid Others Options Weekday Start fg 0 Sunday 1 Monday 6 Saturday Default In Out Follow In Out Trigger y Disable Key In ID CC yes Quick Access By Key In ID I yes cannot use with Disable Key In ID SC Quick Access If No FP And psw F Yes Normal Working Hour BEE EE SNTP Time Server URL Enter the URL of the SNTP Time Server The default is stdtime gov hk Status Check this checkbox to enable this feature In addition one must also specify the Time Zone of the unit in the Clock Setup page located at Administration gt System Clock Setup which will be discussed later in this section The DNS Server must also be properly setup to resolve the URL of the SNTP Time Server Other Options This section contains several drop down boxes and check boxes to configure how the Terminals will respond to user interaction 48 iGuard LM Series Operation Manual Version 3 6 E iGuar
18. Local Records Only Site Code p Note Only last 4 digit of Employee ID will be used as the card no Wiegand 26bit format Remote Door Relay Setup e v Output Enable Remote Relay 1D y pass Serial No fvK 9940 01 12 10D0 Terminal may need to restart after configuration saved Last Updated Sat 28 Jul 2007 12 11 19 01999 Lucky Technology Ltd All rights reserved US Patent No 6 643 779 L A internet Z Output Enable this setting if it is necessary to connect iGuard to any existing Wiegand based system To include only the local access log records i e to exclude the access log records from other slave units check the last option Enable Local Records Only Site Code This is the Wiegand site code Use this setting to communication properly with existing Wiegand systems Remote Door Relay Setup This is for setting up the optional Remote Door Relay which is a small device for controlling the electric door strike Normally the electric door strike is connected directly to the built in door relay of the device For higher security purpose this Remote Door Relay can be used instead of the built in one to control the door strike to avoid the possible intruder break in by opening the iGuard and directly shorting the door strike wires More details will be discussed in the Appendix Output Enable this if the optional Remote Door Relay is available Remote Relay
19. access log Follow these steps to toggle the test mode Description LCD Display 1 While in Function Menu press A to toggle the device to Test Test Mode Mode The unit will return to Standby Mode and the Test ID _ IN Mode status will appear on the 17 line as shown 2 Repeat the above step and the unit will return to the normal Thu Aug 30 14 15 Standby mode ID IN Note The Test Mode must be toggled back to Normal Mode before the unit will begin to record transactions in the access log again 29 iGuard LM Series Operation Manual Version 3 6 Function B Open Door This is for the System Administrator to quickly open the door without going through all the verification procedure This feature has been added as a backup mean to open the door In the unlikely event when the iGuard fails to read any smartcard or fingerprint image due to hardware failure the System Administrator can still have a way to open the door Description LCD Display 1 While in Function Menu press B to open the door The door will then open and unit will return to the Standby Mode Open Door Thu Aug 30 14 17 Tp E IN The Backspace Key The backspace key on the keypad mainly serves three functions to erase the last entered key to abort in the middle of an operation and to toggle the access status between IN and OUT during Standby Mode This section will discuss how to
20. gt Address http 192 168 0 100 Adminsfindex html y gt EE B iGuard Security System BS Employee Record First Previous Next Last Acc Log Help Employee Record Employee Data Department Employee ID amp 1041 10 Char Max 0 9 4 8 V EVERYONE Last Name Chan 20 Char Max FACT 4 S IT icom First Name dy wai 20 Char Max Dr Other Name Title pues 20 Char Max M KNIT Password Password Not Assigned MAKT Save New Password See Remarks 1 J TECH New Password 8 Char Max 0 9 4 B Existing password is not shown for security reason Status M Active IT Auto Match Security Level Personal Normal follow system setting y n a in automatch Save or Delete this record Remarks 1 Check to save New password UnCheck to use Existing password not shown Check All Clear All 36 iGuard LM Series Operation Manual Version 3 6 Use this page to edit the employee information in this page Employee ID The ID is a unique value up to 10 characters and is limited to the characters 0 9 A and B This is because these are the only characters on the keypad of the iGuard unit Last Name First Name amp Other Name Title Enter the name and the title of the user Password Enter the Personal Password of the user Active The default user status is Active Uncheck this box if it is necessary to temporarily suspend the user s access rights A
21. Enable Remote Relay ID y Serial No Vi lt 9940 01 12 10D0 Terminal may need to restart after configuration saved Last Updated Wed 15 Aug 2007 16 21 41 01999 Lucky Technology Ltd AR rights reserved us Patent No 6 643 a D gt gt gt a The following is the connection terminals of the Remote Relay Terminal Label Description 1 NO Door Relay s Normal Open 2 COM Door Relay s Common 3 Door Relay s Normal Close 4 amp 5 Door Switch 6 Connect to iGuard 7 Connect to iGuard 8 12V DC 9 Power Ground Care must be taken when connecting the two twisted pair wire to the devices and do not mix up the two labels A amp B and the corresponding terminals of the Remote Relay device Warning A twisted pair of wire must be used to connect the iGuard and the Remote Relay device Otherwise the wire may pick up the noise in the environment such as the noise generated from the power wire nearby and may make the device malfunction 77 iGuard LM Series Operation Manual Version 3 6 SuperMaster SuperMaster is a device for supporting up to 20 000 users It is used to replace the normal Master unit which supports a maximum of 1 000 users only The operation of the SuperMaster is very much like the normal Master unit except that it does not perform any user authentication itself It acts like a file server that serves the requests for user information from all the slave units and to centrall
22. First Previous Next Last Help First Name LastName Status Department an al Departments a co LastName First Name Active FP SC PSW A M IN OUT Wong Kit Ching Tsui Ping Fuk LO Liu May Wan Chu Chuk Ching 19 Chan Chuen Heung Chan Kin Wai 5 Mo Hang Hing Chan KC 73 Ng Luk Mui Mui Chow Man Keung Shek Ying Kuen Chan Tai Wan Chan Tim Sun Go Kai Yin Chow Sin Yi Wong Leung Fong SE In 09 17 eo eo eo eo e Ge oie Bes es eee e LAENEN 1 0000600000000000 ec ecoecoeoeecceceeee c amp Y o o o o o o o There are four columns on the right side of the list with green or grey e ON OFF indicators These are e The Active Indicator indicates that the employee is in Active status e not suspended e The FP Fingerprint indicator shows whether the user has registered his fingerprint image and he can use fingerprint for authentication e The SC Smartcard indicator shows that a Smartcard has been issued to the user 35 iGuard LM Series Operation Manual Version 3 6 e The PSW Password indicator shows a Personal Password has been assigned to the user Personal Password is optionally assigned to each individual user using Func 1 in the function menu as discussed previously or can be assigned using the browser in the user setup page which will be discussed later in this section e The AM Auto Match indicator indicates that the optional auto match
23. ID This number must match the 8 bit jumper block setting located on Remote Door Relay device Terminal Reset Shutdown Use this page to remotely reset or shutdown the iGuard 57 iGuard LM Series Operation Manual Version 3 6 3 Guard Fingerprint Security System Microsoft Internet Explorer File Edit View Favorites Tools Help Q Back 2 x 12 Search lt Favorites gt Address http 192 168 0 100 Adminsfindex html iGuard Security System Terminal Reset Shutdown ae command will reset shutdown the iGuard Terminal Select the reset option and then press Go button to reset shutdown C Shutdown C Restart C Reset Daily In Out Status Reset Terminal IT Factory Default Setting Purging Employee Database IT Purging Access Log Database Last Updated Sat 28 Jul 2007 18 18 35 01999 Lucky Technology Ltd All rights reserved ee Patent No 6 643 779 2 S S A S E Press the Go button at the bottom to reset the device according to following selections Shutdown This is to simply shut down the device The device can be restarted again by pressing any key on the keypad Restart Select this one to restart the device Reset Daily In Out Status iGuard keeps a list of all users most recent IN OUT status and the corresponding date amp time information View this on the webpage in the Employee List page discussed earlier Use this option is to clear the informat
24. The transmission is in real time manner The iServer program can be downloaded free of charge in the manufacturer s website More detail about iServer will be covered in the Appendix Important Always set the first option Type to Auto Mode and leave the other options unchanged to work with the current version of iServer program Fingerprint Matching Setting This is for setting the security level for fingerprint matching for the system applicable to iGuard with the optional fingerprint sensor only 53 iGuard LM Series Operation Manual Version 3 6 E Guard Fingerprint Security System Microsoft Internet Explorer File Edit View Favorites Tools Help GQ Back x 2 Search e Favorites gt Address 42 http 192 168 0 100 Adminsfindex html Jo Sec 0 30 3600 No Retry if zero ESTE Standard y Default Standard Automatch Security Level maximum Default Maximum Door Relay and Beep Setting Door Switch 7 Disable Door Relay Control for In Enable C Disable Door Relay Control for Out Enable C Disable Door Relay Control for F1 F4 C Enable Disable Door Relay Delay Timer lo eae Time delay for door relay from on to off 1 10 0 factory default Beep Sound Enable Code Setting LJ IMPORTANT Changing Company code may disable all registered smart card Company Code 4 char RER Web Cam Setting IP 0 Dm LSU ga BSE TSS 4 v
25. above example Quick Access is available from 8 00AM until 6 30PM Monday through Friday and never on Sunday Saturday and other specified company holidays Administration This section will cover the settings and options for system configuration and maintenance Terminal Status This is the iGuard homepage and the first page that will appear when accessing the unit with the Web Browser The following is a typical Terminal Status page 3 iGuard Fingerprint Security System Microsoft Internet Explorer j loj xj File Edt View Favorites Tools Help g Back 2 a 12 11 Search Favortes 7 Address JE hetp 192 168 0 100 Admins index html Es E iGuardm Security System gt 8 iGuard Security Access Control System Terminal Information Terminal ID A123 MASTER Descriptions liGuard Security System Firmware Version 3 6 85835 ROM 04040 Jul 25 2007 HW1203EC 153 K20580 Other Feature Remote Door Relay Support SSL Disable Authenticated Master Slave Model LM 520 SC 1 000 Employees Version Smart Card Registered Employees Total 86 Registered Automatch he Users 20 max IP Address 192 168 0 100 iGuard s 3 Terminal s Your IP Address 192 168 0 139 Start Time Wed 25 Jul 2007 22 06 17 Last Sync Time Disabled Location Time Zone GMT 08 00 Beijing Hong Kong Up Time 000 days 08 hours 25 mins 22 secs CPU 4 Hit Count 318 Serial No VK 9940 0112 10D0
26. be changed in the employee webpage later on Security to Low Yes No 1 2 _ scrolling message gt Here are some other general factors that may influence the enrollment Finger Position Always align the center of the fingerprint with the center of the fingerprint sensor Do not use the tip of the finger and do not place the finger too much to the left or to the right Otherwise false reject may occur Finger area It is best to cover the sensor area completely with the fingerprint to ensure the maximum fingerprint surface contact area A common mistake is to touch the sensor with the tip of the finger which contains too few minutiae points It is also best to use the thumbs rather than other fingers Finger rotation Keep fingerprint rotation minimal during the enrollment The rotation should be within 10 degrees during enrollment Finger pressure Use medium pressure Excessive pressure may distort the image and may adhere ridges together Too little pressure will lead to a small fingerprint area or dry fingerprint Also to avoid reading a blurry and smeared image do not slide your finger across the sensor as illustrated in the following diagram 73 iGuard LM Series Operation Manual Version 3 6 iServer iServer is a Windows based program that runs on PC for permanently storing the access log in the PC in a real time manner It can be downloaded free of charge at the manufacturer s website Du
27. for groups of employees In a typical setting the Executive and Accounting departments may be the only employees with access to the accounting file room during normal business hours and your Tech department might contain anyone authorized to enter the server room at any time while everyone in the company can come and go through the front door at any time except weekends and company holidays The system default department is EVERYONE and it cannot be deleted By default each new employee created will automatically be added to the EVERYONE department A maximum of 32 departments is allowed in the unit including the default department EVERYONE The maximum length of the Department ID is 8 characters 38 iGuard LM Series Operation Manual Version 3 6 Department List This page shows all the departments currently assigned to the system iGuard Fingerprint Security System Microsoft Internet Explorer File Edit view Favorites Tools Help Q Back O B HP Search Favorites gt Address e http 192 168 0 Deen html sl E a Go iGuardm Security System Department List First Next Last Department ID Descriptions EVERYONE System Default Department FACT Factory ICOM i Comm Motivity CN IT Department Computer Knitting Dept Marketing Department Lucky Technology Total 7 Record s BE BEZ Selected Department Last Updated Thu 26 Jul 2007 04 22 19 1999 Lucky Technology Lid
28. fullest possible image cuticle The Core The Tip The core of the fingerprint containing the most minutia points is usually located opposite the cuticle Center the cuticle in the sensor window to maximize the number of minutia points IMPORTANT During the enrollment process position the center of the fingerprint of the thumb to the center of the fingerprint sensor The center of the fingerprint contains the most minutia points from which the fingerprint sensor can extract A good fingerprint image captured during the enrollment process can significantly reduce the false reject rate during later verification Adding New User with Fingerprint The following steps will show how to register the user s fingerprint data Description LCD Display 1 While in Standby Mode press the Func key to enter the By Finger Passwd Function Menu Enter the System Administrator Password EE 2 default 123 and press Func key then press 1 to select Add Update ID menu 2 Press 1 to select By Finger then you will be asked to enter Enter ID and the user ID scan 1st Finger 3 Enter the user ID e g A02 The ID can be of any length Enter ID and from 1 to 10 characters A02_ 11 iGuard LM Series Operation Manual Description 4 Press the Func key to confirm the ID The device now begins to capture the 1 image of the primary finger The horizontal bar on the second line indicates the qu
29. log each clock event iGuard assigns the access status to each access log entry such as IN amp OUT The default access status is shown on the iGuard LCD display in Standby Mode The available options are Always IN Always OUT Follow In Out Trigger Don t Show F1 F2 F3 8 F4 Except for the 3 d option Follow IN OUT Trigger all the access log entries afterwards will be logged as the corresponding access status The Follow IN OUT Trigger option allows the system to automatically update the default IN OUT status depending on the settings configured in the In Out Trigger page which will be discussed later in this section In this option one can still change the default access status in an ad hoc basis by pressing the Backspace key on the keypad a few times to toggle the IN OUT status until the desired access status is shown on the LCD display Disable Key In ID This is to disable the ability to use the keypad to enter user ID This achieves a higher security level If this option is set the user must use his Smartcard or use the AutoMatch approach for verification because he can no longer use the keypad to enter his ID for verification Quick Access By Key In ID If this option is enabled and it is within the Quick Access period one can authenticate by entering the user ID without any means of verification The user ID must be a valid ID found in the user database This feature is mainly for convenience when the unit is
30. read this manual carefully before using the product Keep this manual in a handy place for quick reference Notes e Some illustrations in this manual might be slightly different from the product e Certain options might not be available in some countries For details please contact your local dealer Important Contents of this manual are subject to change without prior notice In no event will the company be liable for direct indirect special incidental or consequential damages as a result of handling or operating the product No part of this manual may be reproduced transmitted transcribed stored in a retrieval system or translated into any language in any form or by any means without the written permission of Lucky Technology Ltd Trademarks e iGuard is registered trademark of Lucky Technology Ltd Microsoft and Windows are registered trademarks of Microsoft Corporation e Other product names used herein are for identification purposes only and might be trademarks of their respective companies We disclaim any and all rights to those marks iGuard LM Series Operation Manual Version 3 6 Table of Content INSTALLATION u A dada AER a iria 1 PRE INSTALLATION NOTES csi id idas 1 INSTALLATION EE 1 Power Requirements amp Back EMF ISSUE 22 ccccccceeeeeeeneceteeeeeteeacaeeeseceseseeaeaeceseeeteseesisaeeeeeens 2 When deciding Where BE E 2 Connect the Power amp External Controls u n u 2 Connect
31. the Electric Door Strike L nn 4 Connect the NetlWo Nt 4 POWER UP g ien nia anqa EENS d e REES Eed Addad EES lest lisa ta 5 CONFIGURATION rarei apadu ad inania suncdudasanascananedacdavadastussaaccdeasanadecannadcacavanuddanraaceddssanaccaarnedaveseas 5 Setting the date and me 5 Network SettidgS coccion ra 6 Verifying the Network Connections n 7 GETTING STARTED RTE 9 ADDING AND VERIFYING USER WITH SMARTCARD pp 9 Adding New User with Smart Card oooocociccnnnciciconocccccononnccnnnannnc cnn nn cnn rca rra 9 Verification with SrmartCard AA 10 ADDING amp VERIFYING USER WITH FINGERPRINT OPTIONAL pp 10 Adding New User with Eimgerpogt uuu skua sssayasakintan pankata appkiaaaapaakayaaaskisawansakayaqphakassayaaa 11 VONITICQUON EE 12 ADDING AND VERIFYING USER WITH PERSONAL PASSWORD pp 13 Adding User with Personal Password 13 Verification with Personal Dasswornd u a 14 CHECKING THE ACCESS LOG viiiceissessszarsanttexssataucasanndsensved cagevaiecdeasyed caianaaaldeas ved apa ask sl cous read odia 14 MASTER AND SLAVE MODE cites sescersccsveccanscteretecpsnseensececatecssnseuncacetedtavavcbense asan iarna ni iiaii 16 BASIC MASTER SLAVE CONFIGURATION pp 17 KEY PAD OPERATION u l uuu aba 19 THE FUNCION MENU sii Eet 19 Function 1 Add Update User 19 Function 2 Inactivate D 19 Function 3 Activate ID aassssannnnneneennnnnnnneneennnnnnrnrrernnrrnn
32. the smartcard to the unit and if the user has the access right to the unit he will get authenticated instantly The Quick Access Mode is defined in the Web Interface which will be discussed in the next chapter The 2 method Smartcard Fingerprint and the 3 method Smartcard Personal Password are used when the unit is not in the Quick Access Mode and the user has previously enrolled his fingerprint or assigned his Personal Password Follow these steps to authenticate users using Smartcard Fingerprint or Smartcard Personal Password Description LCD Display 1 While in Standby Mode present the smart card near the A02 keypad The unit will read the data stored in the card If the Waiting Finger P card is valid the unit will ask for the Fingerprint Image or the Personal Password to continue A02 i Password Wait scrolling message gt 2 To authenticate using fingerprint lift the shutter and place Scanning either your primary finger or your secondary finger on the 1111111 sensor To authenticate using Personal Password simply or enter the Personal Password and press Func to confirm Your Password 3 If the Fingerprint or the Personal Password matches the A02 record the user will be authenticated and the unit will return Authorized to the Standby Mode e Thu Aug 30 13 50 ID _ IN This Function 9 can also be used to import register an existing smart
33. this record Steng The above page indicates that the authorized time period for the Marketing Department is from 7 00am am to 6 59 pm Monday to Friday and from 7 00am to 13 59pm on Saturday All the members of this department can only access the unit during this authorized period The bottom part of the page Terminals specifies the doors to which this department has the access rights This is only applicable when multiple iGuards are connected together and form a Master Slave network If there is only one iGuard or the iGuard is not connected to any Master Slave network there will only be one item in this Terminals section which is the Terminal ID of the iGuard itself Check the checkbox Any Terminal to allow the department members to access any iGuard unit in the network The authorized time of a particular day Monday for example can be edited by clicking on the Monday button and the following web page will appear 40 iGuard LM Series Operation Manual Version 3 6 3 iGuard Fingerprint Security System Microsoft Internet Explorer ioj x File Edit View Favorites Tools Help Sp Q Back x 22 A Search e Favorites Address http 192 168 0 100 Adminsfindex html SE E iGuard Security System y Time Restriction Setup First Previous Next Last Acc Log Help Department Record Record Department Record s Time Restriction Control
34. together to form a Master Slave network inclusively If there is only one iGuard in the network this number will be 1 Your IP Address refers to the IP address of the PC being used to browse the unit Start Time records the start time when the unit was first start up Last Sync Time is used to indicate the last time the unit synchronized its internal clock with the SNTP Time Server via the Internet A SNTP Time Server can be specified in the Terminal Setup page which will be discussed later to allow the iGuard to synchronize the clock with Location Time Zone indicates the time zone the unit is in It is for the time zone adjustment when synchronizing the internal clock with the SNTP Timer Server Up Time records the elapsed time when the unit was first powered on Serial No This is the Serial Number of the unit The information is necessary should technical support is required in the future Password Setup Use this page to set up the System Administrator Password User Administrator Password and the Door Access Password 44 iGuard LM Series Operation Manual Version 3 6 3 Guard Fingerprint Security System Microsoft Internet Explorer Je lol xj File Edit View Favorites Tools Help Ay Q Back S el e C J Search Favorites gt Address a http 192 168 0 100 Adminsfindex html so lt B iGuardm Security System System Configuration System Passwords Sett
35. which is used for the Quick Access purpose please refer to the Quick Access section earlier in this chapter in how to set up the Quick Access period The following steps illustrate how to use the Quick Access Password to gain access Description LCD Display 1 While in Standby Mode press the Func key The unit will Enter Password prompt you for the password 45 iGuard LM Series Operation Manual Version 3 6 Description LCD Display 2 Enter the Quick Access Password Enter Password k lt lt 3 Press Func key to confirm If it is within the Quick Access Period and this particular iSuard has been enabled for the Authorized Quick Access the user will be authorized The unit will return to Standby Mode Thu Aug 30 15 02 ID IN Unlike the other two administrator passwords the Door Access Password can be configured as system wise or unit wise by checking or clearing the checkbox of the Synchronize door access password with master option on the webpage If it is configured as unit wise each slave can independently have its own Door Access Password Terminal Setup Use this page to setup and configure the system The following is a typical example of the Terminal Setup page Y iGuard Fingerprint Security System Microsoft Internet Explorer File Edit View Favorites Tools Help Q pack x 2 Search Favorites gt Address ES http 19
36. will be asked to enter the System Administrator Password 2 Enter the System Administrator Password default 123 Enter Password kkk 3 Press the Func key to continue The function menu will scroll Press 1 down slowly as shown Add Update ID Press 5 System Configuration 4 Enter 5 to select the System Configuration menu The Date M D Y current date is displayed as shown If necessary enter the 08 30 2000 new date and then press the Func key to continue 5 After pressing the Func key the current time is displayed Time H M S Enter the new time then press the Func key to continue 13 24 43 iGuard LM Series Operation Manual Description The system will then ask for the Terminal ID which is used to identify the Guard in your network The default ID is Guard Version 3 6 LCD Display Terminal ID This ID is important especially if you have more than one unit installed Note Guard can keep the date amp time running without power for approximately one day There is a software tool for users to synchronize the clock of the Guard with the desktop PC iSetClock exe which can be downloaded free of charge in the manufacturer s website Network Settings To connect Guard directly to your corporate network a device name 8 an IP address are required It is possible to use the DHCP server in the network to dynamically assign the IP
37. 0 Rar Click to add date to holiday list Click to remove date from holiday list Last Updated Sun 29 Jul 2007 02 49 53 1999 Lucky Technology Ltd All rights reserved US Patent Mo 6 643 779 El E cikk to add date to haidayit o Wed 2 In the above example the dates 07 01 2007 07 04 2007 10 01 2007 10 10 2007 8 12 25 2007 are set as holidays On these days the authorized time period will follow the settings for the date Holiday as shown in the following 61 iGuard LM Series Operation Manual Version 3 6 3 Guard Fingerprint Security System Microsoft Internet Explorer AE xj File Edit View Favorites Tools Help ay 2 Search gt gt Favorites al Address http 192 168 0 100 Adminsfindex html y Go iGuard Security System Department Record y First 7 Previous Next Last Acc Log Department Record Notes You cannot delete or alter the ID of EVERYONE Department Department Data Department ID EVERYONE 8 Char Max Description System Default Department 30 Char Max Time Restrictions Click Monday Sunday to edit the time restriction DO 01 02 03 04 05 06 07 08 09 10 11 12 13 14 15 16 17 18 19 20 21 22 23 AAN E EEN A CO VV YY Y YY YY Y AA EA AAA A A A AA A ete SE nen dy ed y seh EE E e SY e e o A dE E OPY ARP ora e YC Y OY Ye O EE di DE A A E A YY YY YY YY YY YY Y Terminals F Any Terminal IT A123 iV We2 1
38. 2 168 0 100 Adminsfindex html y gt co B iGuardm Security System 3 Terminal Configuration Terminal Setting Network Setting e Terminal ID 4323 Description liGuard Security System Master Slave Unit master Unit Disable password authentication for slave with firmware earlier than 3 6 85834 C Slave Unit Master Unit IP J Port J IP Address Use DHCP Static IP 192 168 0 100 Port Default 80 C Others ESCH 1 65535 Subnet Mask 255 255 255 D DNS Server IP 503 80 96 10 203 80 96 9 Default Gateway IP 192 168 0 254 Internet SNTP Time Server time synchronization Lt SNTP Time Server URL Te awhe OSC e Internet There are eleven sections in this page These are Network Setting Internet SNTP Time Server Other Options Web Server Options iServer Fingerprint Matcher Setting Door Relay and Beep Setting Code Setting Web Cam Setting Weigand Setup and Remote Door Relay Setup 46 iGuard LM Series Operation Manual Version 3 6 Network Setting Terminal ID Assign an ID to the unit In a Master Slave configuration this Terminal ID is used to identify each slave unit in the network Identical ID can be assigned to different iGuards However it is suggested to assign unique ID to each iGuard in a Master Slave configuration to avoid confusion when assigning departments access right in which the Terminal ID is used to identify which iGuard i
39. 206 1 Browse Department EVERYONE FT In the above example no one would have the access right during the 5 holidays specified above To remove a holiday from the list simply click the blue date in the Company Holiday list Terminal List This page shows the current slave units in the master slave network 62 iGuard LM Series Operation Manual Version 3 6 ard Fingerp e e oso ernet Explore MaE Fie Edit View Favorites Tools Help e Q bak sl z J Search Favorites gt Address ez http 192 168 D ee html YE a Go iGuard Security System Terminals List First Previous Next Last Help Terminal Descriptions IP Address Status Unlock Door Restart 4123 3 6 8586 Guard Security System 192 168 000 100 80 Unlock 4123 Restart 4123 A176 3 6 8566 Guard Security System 192 168 000 176 80 Ready Unlock A176 Restart A176 4178 3 6 8586 Guard Security System 192 168 000 178 80 Offline Unlock A178 Restart A178 Total 3 Terminal s Remarks 1 The first item is MASTER M unit 2 Sa ie with S is the Computer Server at for firmware update if version no in RED et will be fully rebuilt in approx 3 minutes Last Updated Sun 29 Jul 2007 03 30 49 01999 Lucky Technology Ltd All rights reserved US Patent No 6 643 779 E http 1192 168 0 100 Adminsfinfo vtml a Internet In the above example the device A123 is the master unit and it has two sl
40. 45 cabling By connecting it to the network one can manage amp monitor the unit via any standard web browser such as Microsoft Internet Explorer amp Mozilla Firefox The connection is very straightforward as shown in the following picture Make sure the computer has installed and has been configured with the TCP IP Protocols iGuard can also be connected directly to the PC via crossover RJ 45 cable Note Please contact iGuard Technical Support at 800 441 6798 US Only or email to info lucky com hk international iGuard LM Series Operation Manual Version 3 6 Power up During power up iGuard will perform a self test then it will enter the standby mode as shown below Description LCD Display 1 Power Up when Guard is powering up it will perform a self test Initializing 2 After about 10 sec the device will load the system program iGuard Security Loading 3 After loading the system program iGuard will enter the Thu Aug 30 12 00 Standby Mode and is now ready to set the date time amp the ID _ IN network settings CONFIGURATION Setting the date and time The date and time must be properly set up so that iGuard can time stamp all the access amp time attendance records Follow these steps to set the system date and time Description LCD Display 1 While in Standby Mode press the Func key to enter the Enter Password Function Menu You
41. 5 iGuard LM Series Operation Manual Description 8 Press Func key to continue You will be asked if the device is a Master or Slave device This is useful in a multi device environment where more than one iGuard are connected to each other Refer to the section Master amp Slave Mode for more detail 9 Press 1 to select Master for now When asked if you would accept the changes press 1 to select Yes The system may then reset itself and return to Standby Mode Version 3 6 LCD Display Master Slave 1 2 Master OK to Accept Y N 1 2 Yes Thu Aug 30 13 25 ID IN Warning The IP address of the Guard unit must be unique as in all other network devices Otherwise it will cause a network error and the iGuard will not function properly Note The Terminal ID is NOT required to be unique but a unique ID is recommended if multiple devices are installed in the same computer network such as in a Master Slave configuration Verifying the Network Connections One can test the above network settings by using a PC to ping the iGuard unit as follows e Open the Command Prompt on the PC To open Command Prompt click Start select Run type cmd and then click OK e Type ipconfig to check the IP address of the PC and make sure it is in the same network as Guard i e the same subnet mask e While still in the Command Prompt use the ping command to ping the IP ad
42. Department Holiday and In Out Trigger Database s data for backup purpose Click Save button to save the database s backup file E Employees Database Only 84 kb Access Log Database Only 482 kb All Databases 567 kb Save Last Updated Tue 31 Jul 2007 03 42 33 1999 Lucky Technology Ltd AR rights reserved US Patent No 6 643 779 E Wi A Wee One can select to backup either the user database or the access log or both The size of each one is shown beside it in parentheses Press the Save button to proceed The following screen will appear opening ster You have chosen to open ig070815 idb which is a Intermediate file From http 203 80 236 61 What should Firefox do with this file Open with ER default y Press the OK button to save the database file The default filename of the backup file is y Y YMMDD idb where YY MM amp DD are the year month and day of the backup date respectively for easy reference If the All Databases option is selected both the user database and the access log will be included in this single file Restore Use this page to restore the data from the backup file when it is necessary for example a new device has been installed or to restore the exported file created in the Export Employee page discussed earlier 69 iGuard LM Series Operation Manual Version 3 6 3 iGuard Fingerprint Security System Microsoft Internet Explorer File Edit View Favorit
43. Guard unit to which it is attached The use of the relay is recommended for all access control installations and is required when controlling a 12VDC electric door strike or magnetic lock with a current rating above 1Amp Configuration Before installing the relay set the Remote Relay ID with the 8 Bit Jumper switches on the relay circled in red in the above picture The chart below explains how to calculate the value that the switches are set to Add the Numeric Value of each switch you turn to the On position This total will be the ID value of the Relay Switch Number Numeric Value 1 1 2 4 8 16 32 64 128 INIIAI AJOJN For Example if the switches 3 and 7 are turned to ON the value is 68 i e 4 64 68 If all switches are turned to ON the value is 255 The same ID must also be specified in the webpage as shown in the screen shot below and the Output Enable checkbox must also be checked 76 iGuard LM Series Operation Manual Version 3 6 3 iGuard Fingerprint Security System Microsoft Internet Explorer File Edit View Favorites Tools Help Q Back 0 12 2 search Favorites Address http 192 168 0 100 Admins index html sl E so Wiegand Setup Output Disable Enable C Enable Local Records Only Site Code y Note Only last 4 digit of Employee ID will be used as tr no Wiegand 26bit format Door Relay Setup Output
44. In Ng Luk Mui Mui 07 25 2007 09 18 32 002 In Wong Kit Ching 07 25 2007 09 17 54 Main In Mo Lee Fong 07 25 2007 09 16 08 office In Lau Ester 07 25 2007 09 15 46 office In Li Johnny 07 25 2007 09 14 31 office In Chow Man Keung 07 25 2007 09 13 27 Main In Chan Kin Wai 07 25 2007 09 10 53 Main In Yu Venus RES 07 25 2007 09 09 00 office In Li Wan Hei 07 25 2007 09 05 37 Main In Chau Siu Ling 07 25 2007 09 01 22 Main In Liu Joseph 07 25 2007 09 01 08 office In Ng Raymond 07 25 2007 08 41 18 Main In Leung Kam Ling pet ty 07 25 2007 08 30 33 Main In Chu Kin Man FER 07 25 2007 08 28 49 Main In III egy internet GE E This page shows the employees Access Log Guard keeps the most recent 10 000 access log records in the internal memory based on the First IN First OUT rule When the number of access log records exceeds 10 000 iGuard will delete the oldest record automatically to make room for the new one To show the records of a particular person only e g BB12 enter his ID in the Employee ID text box and press the Go button and only the records of this person will be shown Specify the Department and only the particular department members will be shown The Time Period may be specified such as displaying only today s records last week records last month records etc or specify the Time Period by choosing the Range selection and entering directly to the From To fields Press the Nex
45. Thu 18 04 07 20 2007 Fri 18 18 07 21 2007 Sat S 18 12 Ng Luk Mui Mui 07 16 2007 Mon E 18 01 07 17 2007 Tue H 18 01 07 18 2007 Wed 18 01 07 19 2007 Thu 18 03 07 20 2007 Fri 18 01 07 21 2007 Sat z 18 01 Chow Man Keung 07 16 2007 Mon 18 17 EE 33 iGuard LM Series Operation Manual Version 3 6 The Attendance Report is particularly useful for payroll purpose And similar to the Access Log Report above the employee s ID and or the Time Period of the Attendance Report can be specified Daily In Out The Daily In Out Report is very much the same as the Attendance Report discussed above except that it only shows the first IN time and the last OUT time for the day as shown below E iGuard Fingerprint Security System Microsoft Internet Explorer File Edit View Favorites Tools Help ae Q Back O x 12 A A Search lt te Favorites Address http 192 168 0 100 Adminssindex html zl E so B Guard Security System Daily First In Last Out Report First Previous Next Last Help Employee ID Department Period From To MM DD YYYY fall Departments SI Last Week san 5 2007 07 21 2007 Name Date First In Last Out More z a Wong Kit Ching 07 16 2007 Mon Details 07 17 2007 Tue Details 07 18 2007 Wed E Details 07 19 2007 Thu Details 07 20 2007 Fri t Details 07 21 2007 Sat E Details Chan Kin Wai 07 16 2007 Mon S Det
46. YY DD MM YYYY and more Show Department Description in Employee Record This is to include the Department Description field in the Department List in the Employee Record page The maximum length of the Department ID is only 8 characters long so in some cases it would be helpful to also include the description for clarity purpose iServer This is to configure iGuard to work with the iServer program 52 iGuard LM Series Operation Manual Version 3 6 e Guard Fingerprint Security System Microsoft Internet Explorer File Edit View Favorites Tools Help J Search 7 Favorites Type i Auto Mode Default IP Address 0 0 0 0 Port O Server over SSL Enable ignored if SSL not enabled Send Retry Delay lo Sec 0 30 3600 No Retry if zero Fingerprints Matcher Setting Security Level Standard gt Default Standard Automatch Security Level Maximum Default Maximum Door Relay and Beep Setting Door Switch I Disable Door Relay Control for In Enable C Disable Door Relay Control for Out Enable C Disable Door Relay Control for F1 F4 C Enable Disable Door Relay Delay Timer g Sec afan sime EE for door relay from on to off 1 10 0 f Ua el 4 h WI o internet Once enabled iGuard will send all the access log records to the PC running the iServer program and all the records will be saved in the PC hard disk permanently
47. able iServer Lo Type Auto Mode Default TP Address 9 0 9 9 Part N 49 Internet Access Restrictions This setting allows you to specify a specific IP address or a range of IP addresses that is authorized to access the iGuard unit Select the default No P Address Restriction to allow any IP address to access the system To restrict a specified range of authorized IP address select the 2 one Specified IP Address Range and enter the range to the box next to it The 2 option Rejected address can access after Authenticate is for allowing a rejected IP address to access the iGuard s via web browser by providing the System Administrator Password The 3 option Must Authenticate before Access is to force the Guard to ask for System or User Administrator Password for all web access including the Access Log and other reports even if the IP address of the PC is within the IP range specified above by default password is not necessary to access the Access Log and other reports SSL Options This option is not available in standard iGuard Please contact the dealer or the manufacturer if this option is needed Web Page Language This is to select the webpage language from the list Please contact the dealer or the manufacturer if the desired language is not on the list Report Date Format Select the desired date format from the list Available date formats are MM DD YYYY MM DD YY
48. address but it is suggested that a static IP address be used The following procedures describe how to assign the name i e the Terminal ID the IP addresses and other related network settings Before proceeding the correct settings should already be obtained from the network administrator Description continue from step 6 above Enter the name of the device e g A123 A more meaningful amp descriptive name such as front door or sidedoor can be assigned through the setup pages of the Web Interface described in later sections Press Func key to continue and then press 2 to select Static IP instead of DHCP for now Press Func key to continue You will then be asked to enter the IP address of the device The default is 192 168 0 100 Change this default value if necessary Press Func key and then you will be asked to enter the port number Use the default value 80 for now Press Func key to continue Enter the subnet mask here e g 255 255 255 0 Press Func key to continue Enter the address of the Default Gateway e g 192 168 0 200 Press Func key to continue Enter the address of the Domain Name Server e g 203 80 96 15 LCD Display Terminal ID A123 _ DHCP Static IP 1 2 Static IP Address 192 168 000 100 Port Number 80_ Subnetmask 255 255 255 000 DefaultGateway 192 168 000 200 DNS 203 080 096 01
49. ails H y Details Details Details y Details D7 21 2007 Sat Details Chan KC 07 16 2007 Mon e S Details 07 18 2007 wed Details 07 19 2007 Thu S Details 07 20 2007 Fri Details 07 21 2007 Sat i Details Ng Luk Mui Mui 07 16 2007 Mon y Details 07 17 2007 Tue i Details 07 18 2007 wed Details 07 19 2007 Thu S Details 07 20 2007 Fri gt E 07 21 2007 Sat Chaw han Varuna AFITEIONNF Man EE Employee List The maximum number of registered users is 1 000 and they are shown in the Employee List page Each individual user may also be managed in this page using the browser The System Administrator Password is required for these operations The Web Browser will prompt for the User Name and Password when accessing the employee functions The default User Name is admin and the default Password is 123 as shown in the figure below 34 iGuard LM Series Operation Manual Version 3 6 Connect to 192 168 0 100 iGuard System User name la admin Password Remember my password co List The Employee List shows all the registered employees as shown below a iGuard Fingerprint Security System Microsoft Internet Explorer Edit View Favorites Tools Help aa O 3 2 G al J Search gt Favorites Si Address http 192 168 0 D html sl E gt so B iGuard Security System ee EE EN Employee List
50. ality of the image Lift the sensor shutter with your right hand thumb and place it firmly on the sensor until the quality bar reaches the right end You may need to move and rotate the thumb a little bit to achieve the required quality 5 After the quality bar reaches the right end you will be asked to remove the finger from the sensor 6 When the device detects that you have removed the finger it will ask you to place it back again for the 2 image of the same primary finger 7 Press the Func key and repeat the same procedure and you will be asked to scan the 3 time of the same primary finger 8 Press the Func key again and repeat the procedure for the third time You will then be asked to scan the secondary finger 9 Press the Func key and repeat the above steps to scan the left hand thumb three times again If all the images are OK you will see the acknowledge message momentary as shown then the device is ready for the next enrollment 10 Press the Backspace to return to the Standby mode Version 3 6 LCD Display Scanning 1 of 3 Scanning 1 of 3 Analyzing Pls Remove Finger Press Func to Scan 2 of 3 Press Func to Scan 3 of 3 Press Func to Scan 2nd Finger ID A02 Added OK Enter ID and Scan lst Finger Thu Aug 30 13 34 ID _ IN Note If the user ID A02 already exists Guard will prompt and ask if to overwrit
51. ank 10 0344444 42 i i 16 33 i Late min 14 08 43 i Hourly Rate 8 50 46 1 Total hourly paid 51 547 04 49 i 50 E 22 3 29 2002 blank 8 37 32 AM 6 42 53 PM 1 545 05 9 763611111 H M 23 3 30 2002 blank 3 Total hrs 182 01 LO co co t Kal nN TEE Sophisticated graphical representation of the data for each user can then be generated as follows using the built in Microsoft Excel s graphic functions 66 iGuard LM Series Operation Manual Version 3 6 El Microsoft Excel july2002 xIs ioj xj SCH File Edit View Insert Format Tools Chart Window Help Type a question for help X SET IERCH ECKE E EH z l 2 E Je uj B Y f Name Chan KC y Analysis Date gt Department y M 4 gt mi export Link Chart1 Report Instruction Ready Note Macro Programming is required in generating the above Microsoft Excel Reports An example is available for download in the manufacturer s website july2002 xls Please consult the Microsoft Excel Operation Manual for more information Exports TXT The TEXT file is useful for exporting to existing payroll programs used in the company The format of the text file is as follows Item Employee ID Name Other Name Date Time Terminal In Out A1155 Shek Ying Kuen 0 Av 09 30 1999 20 02 04 F1103 Out 2
52. anner smart card reader with embedded Web Server 1 000 users Master only cannot be configured as slave LM FSC SAM Demo Unit Not for resale Finger print scanner and smart card reader with merged database 1 000 users Power supply included LM SM SAM Demo Unit Not for resale Super Master unit licensed for up to 5 000 users Stores 10 000 finger print templates and 20 000 transaction records Power supply included Smart Cards CSC 1K Mifare 1k Classic smart card formatted for use with iGuard IG PWR 12VDC switching power supply with DC plug for use only with iGuard IG PWR CAB Power supply cable with DC plug for use only with Guarde IG ER 01 Remote Door Rela Replacement Parts LM520 FP RD Daughter board for LM520 FSC complete with sensor LCD and casing LM520 RD Daughter board for LM520 SC with LCD and casing LM520 C Casing for LM Series iGuard units with shutter and spring LM520 K Keypad for LM Series iGuard units 82 iGuard LM Series Operation Manual Version 3 6 Contact Information Lucky Technology Inc America Address Telephone Fax Email 5 Floor 7380 Sand Lake Road Orlando FL 32819 800 410 6798 Sales 800 441 6798 Technical Support 800 486 6798 sales lucky tech com Sales tech lucky tech com Technical Support Lucky Technology Ltd Eurpoe Address Telephone Fax Email Levels 2 3 amp 4 Edouard VII 17 a
53. are version 38 1203EC 153 K20580 Other Feature Remote Door Relay Support SSL Disable Authenticated A Model EME EE iB 1 000 Employees version Smart Card P ss Total 1 Bae m 0 Users 20 max IP Address 192 168 0 100 iGuard s i Terminal s Your IP Address 192 168 0 139 Start Time Thu 30 Aug 2001 13 37 08 Last Sync Time Disabled Location Time Zone GMT 08 00 Beijing Hong Kong Up Time ooo days 00 hours 16 mins 41 secs CPU 5 Hit Count 192 Serial No VK 9940 0112 10D0 D zi Oe TT At this stage basic configuration is complete and iGuard is now ready to use Note All the system and network settings as well as all the user data and access log are saved in the non volatile memory of the unit and will be retained even if the power is off iGuard LM Series Operation Manual Version 3 6 Getting Started iGuard is a self contained platform independent access control and time attendance solution Most of the basic operations such as user registration and verification can be directly performed using the keypad of the unit itself without the computer and the web browser There are three methods for user authentication These are the Contactless Smartcard the Fingerprint optional and the Personal Password This section discusses the basic operations of these three approaches Adding and Verifying User with Smartcard iGuard comes standard with built in contactless smartcard reader Th
54. assword Authentication item Then you will be asked if you want to disable the slave units that run on old firmware release scrolling message gt Press 1 to select YES This Master unit will now reject any slave unit that runs on firmware version earlier than 3 6 8583 The unit will then return to Standby Mode 27 LCD Display Configure Master Yes No 1 2 _ Authentication Yes No 1 2 _ Disable for Slav Yes No 1 2 _ than 3 6 8583 Yes No 1 2 _ Thu Aug 30 13 59 ID IN iGuard LM Series Operation Manual Version 3 6 5 Trigger Alarm When Unauthorized This option allows the iGuard unit to turn on the Alarm for all unauthorized access This includes the unauthorized access such as Invalid ID No Access Right ID Suspended etc When enabled if an unauthorized access occurred the terminals 10 amp 11 at the back of the unit will close the circuit for approximately five seconds If an alarm is properly connected to these two terminals the alarm will sound Follow these steps to enable this option Description LCD Display 1 While in Function Menu press 0 to select Advanced Trigger Alarm Wh Feature then press 2 two times to skip the other items until Yes No 1 2 _ you get to the item Trigger Alarm When Unauthorized i Unauthorized scrolling message gt Yes No 1 2 _ 2 Press 1 to select YES t
55. ave units with terminal ID A176 amp A178 The corresponding Firmware Version IP address amp the Port number are also shown The Network Status column indicates the network connection status In the above example the slave unit A178 is offline As a convenient feature one can remotely unlock the doors of the slave unit or reset the slave unit by clicking the Unlock amp Restart links respectively To clear the terminal list click on the link at the remark 4 circled in red above for easy reference Each slave unit will regularly send an acknowledge signal to the master unit Once this acknowledged signal is received the master unit will add the slave unit to the list again One can test the network connection against all the slave units by pressing the Refresh button at the bottom of the page The unit will then try to ping each slave unit one by one and if the network connection with a slave unit is lost this slave unit will be cleared from the list This operation may take a long time if there are a lot of slaves in the list under slow network connections Add Access Log Use this page to manually add an access log entry 638 iGuard LM Series Operation Manual Version 3 6 3 iGuard Fingerprint Security System Microsoft Internet Explorer E e File Edit View Favorites Tools Help Q Back H ei e J Search Favorites Address E http 192 168 0 ee ry E eg F iGuard
56. ays 00 hours 16 mins 41 secs CPU 5 SL ea ara Hit Count 192 Serial No VK 9940 0112 10D0 Wi II 31 iGuard LM Series Operation Manual Version 3 6 The above iGuard s home page is divided into left amp right panels Select different items in the left panel and the right panel will display the corresponding pages This chapter will discuss each of these items in detail Reports There are three types of reports Access Log Attendance and Daily In Out Access Log Click on the link Access Log in the left panel and something similar to the following will appear E Guard Fingerprint Security System Microsoft Internet Explorer File Edit View Favorites Tools Help ay Q Back r x el Le J Search Favorites Si Address le http 192 168 0 100 Adminsfindex htrl y Ho First Previous Next Last Help Employee ID Terminal ID Department Status Period From To MM DD YYYY an Departments E ET y Name Date Time Terminal In Out E ting fung cheung Manager 07 25 2007 12 49 54 Main Out Shek Ying Kuen BRE 07 25 2007 11 00 38 Main In Leung Brian ESCH 07 25 2007 09 53 53 Main In Tso Chung Ling Sites 07 25 2007 09 50 27 Main In Wong Candy TEM 07 25 2007 09 46 56 office In Lau Jacky Engineer 07 25 2007 09 35 34 Main In Chan Jessie Rss 07 25 2007 09 29 35 office In Grace Chan Engineer 07 25 2007 09 27 48 Main In Chong Eva HERE 07 25 2007 09 22 33 office
57. card user to another iGuard unit 24 iGuard LM Series Operation Manual Version 3 6 This is useful if there are remote locations that are not tied into the master unit via a WAN of some kind users of these remote locations can register to the master unit by importing their existing smartcards rather than registering the fingerprint and other information to the unit once again since all the information is already available in the smartcards Follow these steps to register an existing Smartcard user with the smartcard Description LCD Display 1 While in Function Menu press 9 to select Issue Import Issue Import Card Card 1 2 _ 2 Press 2 to select Import Card then you will be prompted to Waiting for present the user s existing Smartcard SmartCard 3 If the Smartcard is valid the information stored in the ID A02 Smartcard including the user name fingerprint template Added OK access right etc will be read and saved in the unit The unit a will then wait for the next Smartcard Waiting for SmartCard 4 Press Backspace to return to the Standby Mode Thu Aug 30 13 55 ID IN Please note that the administrator may still need to grant the user s access rights by assigning the departments the user belongs to Note Department is used for assigning access rights to different users at different time 8 terminals Please refer to the section
58. ch M Series Operation Manual Version 3 6 Federal Communications Commission FCC Statement This Equipment has been tested and found to comply with the limits for a Class A digital device pursuant to Part 15 of the FCC rules These limits are designed to provide reasonable protection against harmful interference in a residential installation This equipment generates uses and can radiate radio frequency energy and if not installed and used in accordance with the instructions may cause harmful interference to radio communications However there is no guarantee that interference will not occur in a particular installation If this equipment does cause harmful interference to radio or television reception which can be determined by turning the equipment off and on the user is encouraged to try to correct the interference by one or more of the following measures Reorient or relocate the receiving antenna Increase the separation between the equipment and receiver Connect the equipment into an outlet on a circuit different from that to which the receiver is connected Consult the dealer or an experienced radio TV technician for help CE EMC DIRECTIVE 89 336 EEC EN55022 EN55024 Trade Name Guard Model No FPS110 LM CEFE iGuard LM Series Operation Manual Version 3 6 User s Notice This manual contains detailed instructions and notes on the operation and use of the product For your safety and benefit
59. d LM Series Operation Manual Remote Relay vOBZ B1 9 Bl ny Lo 1 Beq 3uaw3q edag Bug weubetq uor3S uuop puenyt p37 AboTouyss ong O WA ISuajgo3l3xg Spot Uu017097044 JW 19eg SAVYS oog 91430813 0O 3143S 400 403 A dans uemog WUE TH IEN S WAP E IEUAGINZ penueseaa penueseaa uosues AOO S WAP Y TeEuUe3x uosues AOO JOSUSS oo ON elT 3S uoo WOD 91418 4001 ON 897435 4007 ADC wenocd 20 puengt Q 9 yog img oog DO OO OO Bnid emcd 20 vencd 30 AZI 398198 QI HBTS SOY pens 81 iGuard LM Series Operation Manual Version 3 6 iGuard Part List LM Series Readers LM520 SC Smart Card reader with Embedded Web Server 1 000 users LM520 FSC Finger print scanner smart card reader with embedded Web Server 1 000 users LM Series Super Master Master Only LM SM 5000 Super Master unit licensed for up to 5 000 users Stores 10 000 finger print templates and 20 000 transaction records LM SM 10000 Super Master unit licensed for up to 10 000 users Stores 20 000 finger print templates and 20 000 transaction records LM SM 20000 Super Master unit licensed for up to 20 000 users Stores 40 000 finger print templates and 20 000 transaction records Special Promotions LM520 FSC SP Finger print sc
60. d Fingerprint Security System Microsoft Internet Explorer File Edit View Favorites Tools Help ay Q Back Q B Lei J Search gt Favorites gt Address a http 192 168 0 100 Adminsfindex html y Go a jr Sekday Start 0 Sunday 1 Monday 6 Saturday Default In Out Follow In Out Trigger y Disable Key In ID J yes Quick Access By Key In ID yes cannot use with Disable Key In ID SC Quick Access If No FP And psw N Yes Normal Working Hour gt HH MM SS For Daily InfOut and Time Card Report Enroll only one finger TC yes Disable Enrollment Overwrite M ves Clear FP If SmartCard Issued yes Extended In Out Status Y pi FZ Fo M F3 N F4 Remap Key A B aja d eje x Show Chinese on Terminal Enable Language Shown on Terminal English Show only ID when Authorized Enable if enabled only Employee ID will be shown when authorized Log Unauthorized Access M Enable Log Retry J Enable Notes Must enable with Log Unauthorized Access Log Administration event Enable if enabled administration event i e issue card fp enrollment will be added to log Internet Weekday Start Use this to change the 1 day of the week from the default Sunday to others useful for some Muslim countries and Hispanic Default In Out This is to define the default user access status i e how the Guard will
61. dress of the iGuard unit as shown below which is 192 168 0 100 in the above example e Ifthe ping responds the following the IP is set properly and the unit is ready Microsoft Windows XP Version 5 1 2600 C egene uelle LEE SIE tee Cola C gt ping 192 168 0 100 Binga L92 GeO 100 wichan 32 byrces et cercas Reply from 192 168 0 100 bytes 32 time 2ms TTL 128 Reply from 192 168 0 100 bytes 32 time lms TTL 128 Reply from 192 168 0 100 bytes 32 time lms TTL 128 Reply from 192 168 0 100 bytes 32 time lms TTL 128 Ping Staitisicles ez 192 168 0 100 Packets Sent 4 Received 4 Lost 0 0 loss Approximate round trip times in milli seconds Minimum lms Maximum 2ms Average 1ms ES iGuard LM Series Operation Manual Version 3 6 Next launch the PC web browser e g Microsoft Internet Explorer and enter the IP address http 192 168 0 100 i e the IP Address of the iGuard and the following iGuard web interface will be shown in the browser window A Guard Fingerprint Security System Microsoft Internet Explorer File Edit View Favorites Tools Help Q Back 0 gt x 12 Search Favorites gt address E http 192 168 0 la html JE do E iGuardm Security System iGuard Security Access Control System Terminal Information Terminal ID la123 MASTER Descriptions Guard Security System Firmware Version _8 6 85835 ROM 04040 Jul 25 2007 Firmware Version Firmw
62. e System Administrator can use smartcard to create a new user or to assign a smartcard to an existing user iGuard uses the standard Philips 1K Mifare Classic 13 56MHz Contactless Smartcard It allows almost instant verification for users and it comes in handy when the device is used during the high traffic period for example at the beginning of the day when everyone gets to the office at around the same time Adding New User with Smartcard The following steps will show how to create a new user by issuing a new smartcard to the user Description LCD Display While in Standby Mode press the Func key to enter the Issue Import Function Menu Enter the System Administrator Password default 123 and press Func key then press 9 to select the item Issue Smartcard Enter 1 to select Issue Card You will then be asked to enter the User ID Enter the user ID e g A01 The ID can be of any length from 1 to 10 characters including the letters A amp B If the ID does not exist you will be asked to confirm to create this new ID Press 1 to select Yes then the unit will prompt you to present the Smartcard Card 1 2 _ Enter ID Enter ID A01_ Create new ID Yes No 1 2 _ Waiting for SmartCard iGuard LM Series Operation Manual Version 3 6 Description LCD Display 6 Place anew Smartcard near the Keypad Once the device has detec
63. e the existing fingerprint information or not In case of poor fingerprint for example if the skin of a user is too dry or too wet the user may experience difficulty when registering the fingerprint image and the LCD display may show a message indicating a dry or wet fingerprint problem Please refer to the Fingerprint Enrollment section in the Appendix for more information Verification iGuard uses the enrolled fingerprint information to identify the person The verification process is very straightforward and is illustrated in the following steps 12 iGuard LM Series Operation Manual Description 1 While in Standby Mode key in the user ID number e g A02 2 Lift the shutter and place either your primary finger right hand thumb or your secondary finger left hand thumb on the sensor You should place the finger the same way that you did during the enrollment procedure The device will automatically start scanning after the sensor shutter has been lifted all the way up 3 If you are authenticated the authorized message will be shown and the unit will return to the Standby Mode Version 3 6 LCD Display Thu Aug 30 13 36 A02_ IN Scanning A02_ Verifying Authorized Thu Aug 30 13 36 ID _ IN Note There is another feature called Auto Match which allows the user to access the device without the need to enter his ID first This f
64. e to the limited memory iGuard only keeps the most recent 10 000 access log entries only in its internal memory using the First IN First Out FIFO rule By using iServer all the access log entries can be saved permanently in the PC and it is only limited by the available hard disk space of the PC The following is the iServer program running on a PC 74 iGuard LM Series Operation Manual Y Guard Server File View Server Terminals Tools Help o x B 4 Q Server Add EView Hide Setting About Exit Unlock Hm Employee ID Date Time Terminal E Guard Server In Out S Guard Terminals 48400325 08 11 2007 22 32 45 100 RH 100 amp BA00136 08 11 2007 22 32 38 126 ABA00715 08 11 2007 22 32 33 125 ABA00000 8 11 2007 22 32 38 130 0 ABA00763 08 11 2007 22 32 38 135 ABA00572 08 11 2007 22 32 37 113 08 11 2007 22 32 37 09 8 11 2007 22 32 38 121 0 ABA00268 08 11 2007 22 32 37 105 ABA00038 08 11 2007 22 32 38 116 ABA00068 08 11 2007 22 32 37 117 ABA00373 08 11 2007 22 32 38 127 ABADODOD 08 11 2007 22 32 37 18 ABA00678 08 11 2007 22 32 37 113 08 11 2007 22 32 38 137 08 11 2007 22 32 38 138 SPATZ 0871122007 32 27 38 134 154 Records Received Since Server Start Server iGuards ke Employee Reports Access Log All Event Log TERM 1 Version 3 6 The left panel shows the iGuards
65. eature will be discussed later in the Keypad Operation section Adding and Verifying user with Personal Password In additional to Fingerprint and Smartcard the user can also use the personal password for verification The personal password is useful for the user who is not able to use fingerprint for verification such as having skin problems and does not want to use Smartcard Adding User with Personal Password The following steps demonstrate how to add a new user with personal password Description 1 While in Standby Mode press the Func key to enter the Function Menu Enter the System Administrator Password default 123 and press Func key then press 1 to select Add Update ID menu 2 Press 2 to select By Password then you will be asked to enter the user ID 3 Enter the ID e g A03 13 LCD Display By Finger Passwd 1 2 _ Enter ID Enter ID A03_ iGuard LM Series Operation Manual Description 4 Press the Func to confirm Then enter the Personal Password for user A03 The password length can be up to 8 characters including the characters A amp B e g 1234AB 5 Press Func to confirm This new user has been added to the unit The unit will then ask for the next ID to add 6 Press Backspace to return to Standby Mode Verification with Personal Password Version 3 6 LCD Display User Password KkKKKK
66. es Tools Help Q Back 9 ll J Search Favorites iGuard Security System Restore File Select a File to Restore Import DAiGuard iGuardDByig070809 idb Browse J Restore Options Ignored when importing employee records V Employee Database M Access Database Go It may takes few minutes to restore the database Last Updated Tue 31 Jul 2007 03 34 10 01999 Lucky Technology Ltd All rights reserved US Patent No 6 643 779 A O E One can choose to restore the user database only the access log only or both by checking the corresponding checkboxes Web Camera If the optional Web Camera is available to the network Guard can redirect the web camera s image to the browser as shown below 70 iGuard LM Series Operation Manual Version 3 6 E Guard iGuard Fingerprint Secu Security System Microsoft Internet m Microsoft Internet Explorer E Thu 9 Aug 2007 19 06 a ast Updated study Technology Ltd All rights reserved US Patent No 6 643 779 EERITSZ TBE 0 252 Admins webcamd axis cgi mjpgj video cgi motion 0 EISE u Please refer to the Administration gt Terminal Setup page for more detail in setting up the web cameras 71 iGuard LM Series Operation Manual Version 3 6 APPENDIX Fingerprint Enrollment Fingerprint Enrollment is the process of registering the fingerprint template for later recognition A good enrollment is crucial
67. feature is enabled for the particular user If enabled during fingerprint authentication the user can simply lift the shutter and place the finger on the sensor for authentication without the need to enter his ID first The last column is the n Out monitor for each employee which shows the time and the access status of the corresponding last access entry The information is reset daily at midnight by default and this default time can be changed in the Terminal Setup page of the web interface The text boxes at the top allow you to search and filter these results by First Name Last Name Status and Department Scroll down to the bottom of the right panel and the three buttons Activate Deactivate amp Delete will appear One can Activate Deactivate amp Delete a single employee or a group of employees by first checking the checkbox and then pressing the corresponding button Note Once the user ID is deleted all the information associated with the user including the fingerprint data name and the access right will also be permanently deleted The user must be re registered to regain access rights However access log data will be retained Press the employee ID hyperlink to edit the information of each employee as shown in the following figure A iGuard Fingerprint Security System Microsoft Internet Explorer 3 Dj xj File Edit View Favorites Tools Help ay Q Back O x 2 Search Favorites
68. for all fingerprint recognition systems in the market including iGuard A good fingerprint image captured during the enrollment process will significantly reduce the false reject rate during later verification iGuard takes advantage of the advanced DFX Difficult Fingerprint Extraction technology which works accurately with most people s fingerprint images and iGuard can achieve an exceptionally low false rejection rate of less than 1 However as individuals our hands may have different levels of moisture In some cases iGuard may have difficulty in recognizing some users fingerprint images mostly the people with dry skin problems The problem is more noticeable during the enrollment process since the device requires a more accurate and higher quality fingerprint image than the normal verification process The easiest way to get around the dry skin problem is to apply a small amount of moisturizing lotion on the dry skin during the enrollment process This step is only required in the enrollment stage and will not be needed in the daily routine verification process For users with wet skin problems simply wipe the finger with cloth or paper towel before having any contact with the fingerprint sensor Please note that excessive sweat will reduce the normal life time of the fingerprint sensor The image quality can be improved tremendously by taking care of the dry and wet skin condition discussed above It is important that the user st
69. g If this option is enabled the access log will include these retry events This is useful for identifying users who are consistently getting fingerprint false rejections and have to attempt access multiple times These people may have fingerprints which are difficult to read or may not have been enrolled properly Log Administration Events If enabled the access log will includes all the administration events such as adding modifying and deleting users Web Server Options This is to set various web server related options 51 iGuard LM Series Operation Manual Version 3 6 3 Guard Fingerprint Security System Microsoft Internet Explorer lol xj File Edit View Favorites Tools Help Ay Q Back x 2 O Search Favorites gt Address http J 192 168 0 100 Adminsfindex html EI e E Web Server Options SIY dccessRestrictions No IP Address Restrictions C specified IP Address Range Example 192 168 0 0 192 168 0 100 M Rejected address can access after Authenticate System Administration User Administration Password Must Authenticate before Access Web Page Language English Note Your browser may need to restart if Language of Web SSL Options M Enable page changed Report Date Format MM DD YY Y Y Y y Select date display format for reports Show Department Description in Employee Record Enable Show Hijri Date in Reports CC En
70. h option between on and off for a user AutoMatch enables the device to identify a person without requiring the user to first specify his user ID This is also called 1 to Many matching Following these steps to set the AutoMatch option for a user Description LCD Display 1 While in Function Menu press 8 to select AutoMatch You Enter ID will be asked to enter the user ID 2 Enter the user ID e g A01 Enter ID A01_ 3 Press Func to confirm You will see the acknowledge ID A01 message and then the unit will return to Standby Mode AutoMatch Set Thu Aug 30 13 50 ID IN After setting the AutoMatch option the user no longer needs to enter his ID every time when accessing the device The user can simply lift the shutter and place the finger on the sensor The device will then automatically capture the image of the finger and will try to match the captured image against the fingerprint information of ALL the AutoMatch enabled users The device will try to match the primary fingers first and then the secondary fingers This feature can be assigned to any user however the maximum number of users is 30 This limitation is necessary for limiting the time the unit may take to match the image against all the AutoMatch enabled users It is therefore recommended that the AutoMatch feature is assigned to only the top management for convenience purpose The rest of staff can use ID plus Fingerpri
71. in BB13 07 30 2007 08 25 22 Main B1214 Ng Hang Kay ag 07 30 2007 08 24 25 002 Bl214 Ng Hang Kay i 07 30 2007 08 18 47 office 41216 Leung Kam Ling 07 30 2007 08 00 22 Main 41189 Chau Siu Ling 07 29 2007 20 30 16 Main 41216 Leung Kam Ling D7 29 2007 19 59 38 Main B1109 Yu Venus 07 29 2007 ES office GE Liu E IS 07 29 2007 HES office 07 29 2007 LOS H O rg Leung BASA 07 29 2007 00 Manual Out Al155 Shek YinD_KefE 07 29 2007 Pasaia BE Ester El D7 29 2007 Y A1154 Chow Man Keung 07 29 2007 B1109 Yu Venus ES 07 29 2007 41155 Shek Ying Kuen 07 29 2007 D1017 Lia Incanh D Zionionnz nnh 27 2 AAA EE ae Access logs which have been added manually will have a check box next to them and will be shown in purple They will also say Manual in the Terminal column of the record These are the only records which can be deleted from the system To delete these records select them by checking on the check boxes and press the Delete button at the bottom of the page Note Only manually added records can be deleted All other records are irrevocable Tools This section is for backing up and exporting the data to PC Exports XLS The built in reports including the Access Report Attendance Report amp the Daily IN OUT Report can be exported to PC directly in the popular XLS format which enables smooth integration with office suite applications such as Microsoft EXCEL Various reports can the
72. in Ng Raymond Engineer 06 20 2007 08 20 31 Main Ng Raymond Engineer 06 18 2007 18 22 41 Main Ng Raymond Engineer 06 18 2007 08 23 42 Main Ng Raymond Engineer 06 15 2007 18 17 20 Main Ng Raymond Engineer 06 15 2007 08 24 21 Main Ng Raymond Engineer 06 14 2007 18 05 13 Main Ng Raymond Engineer 06 14 2007 08 25 31 Main Ng Raymond Engineer 06 13 2007 18 15 41 Main Ng Raymond Engineer 06 13 2007 08 21 04 Main CTT TC E Attendance The attendance reports provide a consolidated access records of each person as follows E Guard Fingerprint Security System Microsoft Internet Explorer File Edit view Favorites Tools Help Q Back x 2 Search Favorites gt address le http 192 168 0 100 Admins index html y EJ o B iGuardm Security System Attendance Report First Previous Next Last Help Employee ID Department Period From To MM DD YYYY all Departments gt Lestweek DR 07 15 2007 07 21 2007 ID Name Date Out In Out In z S 41002 Wong Kit Ching 07 16 2007 Mon I 18 04 i 1 07 17 2007 Tue 18 32 lt 07 18 2007 Wed 18 04 07 19 2007 Thu y 18 06 07 20 2007 Fri S 18 01 EE 07 21 2007 Sat 18 01 Chan Kin Wai 07 16 2007 Mon 2 18 04 07 17 2007 Tue A 18 01 07 18 2007 Wed 18 01 07 19 2007 Thu 18 04 07 20 2007 Fri 18 00 07 21 2007 Sat E 18 01 Chan KC 07 16 2007 Mon H 18 29 07 18 2007 Wed 18 34 07 19 2007
73. ing System Administration User Name System Administration Password User Administration User Name User Administration Password Door Access Password Synchronize all slaves door access password with master Serial No vk 9940 0112 10D0 Remarks sie reunie reason System Administartion User Name and Password cannot leave ank 2 Leave blank in User Administration User Name amp password will disable User Administration Account 3 Leave blank in Door Access Password will disable Door Access Password Access Log E aT ert Z The first entry is the System Administrator s User Name 8 Password which are required when accessing and modifying user information and system configuration The valid characters for the password are 0 9 A 4 B i e the characters one can enter using the iGuard keypad A Note on Master Slave Configuration The System Administrator Password of the Slave unit must be the same as the Master unit Otherwise the Master unit will reject the slave unit In this case an error message will be shown on the LCD display of the slave unit The second entry is the User Administrator s User Name 8 Password This is for accessing and modifying the user information e g to add and delete users and to assign amp modify departments However it cannot be used to access and modify any system related configuration e g to change the IP address of the unit The last entry is the Door Access Password
74. iod by specifying the time dates and the terminals There are three ways to utilize this feature e Quick Access Password This password can be given to Emergency Medical Services building maintenance or your mail carrier This can be useful if it is 41 iGuard LM Series Operation Manual Version 3 6 necessary to keep the facility locked but without the need to record the individuals who are coming and going during business hours e Smartcards For users with smartcards this Quick Access will let them enter and exit with the smartcard and will not ask for fingerprint or personal password e Quick Access By Key In ID If this option is enabled the user can perform this Quick Access function by simply entering his user ID This option is found in the webpage under Terminal Setup gt Others Options gt Quick Access By Key In ID which will be discussed in later section In a typical setting one can enable this Quick Access period during the normal office hour when the traffic is high and the security requirement is low and disable the Quick Access otherwise In this setting users only need to present their Smartcards to get authenticated to speed up the authentication process But they need to use both Smartcards and Fingerprint or Personal Password during the other time that requires higher security level This section will illustrate how to configure this Quick Access period Quick Access Use this page
75. ion Reset Terminal This is for restoring all the device settings to factory default and to reset the user amp and access log database This is analogous to the Function 7 Shutdown Reset in the keypad function menu discussed earlier System Clock Setup Use this page to update the system clock 58 iGuard LM Series Operation Manual Version 3 6 3 Guard Fingerprint Security System Microsoft Internet Explorer File Edit View Favorites Tools Help Q Back O x 2 val J Search 7 Favorites gt Address 4 http 192 168 0 100 Adminsfindex html S iGuard Security System System Clock Setup Help Clock Adjustment New Date 87212007 MM DD YYYY New Time 18 32 54 HH MM SS Auto Date Time Value on C off Values shows the time on your PC Click OFF to stop clock and enter value manually Location Time Zone GMT 08 00 Beijing Hong Kong y Serial No vk 9940 01 12 10D0 ei Done 4 Internet Ui New Date Time Enter the new date and time here This page uses the current time in the PC as the default date and time values and the time is continuously being updated Simply press the Save button to accept the default time To manually input the date and the time check the Off checkbox to stop the update and then enter the new date and time manually Auto Date Time Value This is to continuously update the two Date amp Time fields above To manuall
76. is because the potential back EMF Electromotive Force generated by the door strike may affect the iGuard If it is necessary to share it with the door strike a protection diode 1N4004 type must be installed across the 12V power lines to the iGuard Refer to the Connection Diagram in the Appendix for more information Warning Use ONLY the power supply provided Do not use other power supplies since this may lead to system failure and poor or unreliable operation When deciding where to install iGuard is a wall mounted unit with a miniscule footprint and can be conveniently installed anywhere However for access control applications it is recommended that the iGuard should be installed as close to the door as possible so that the user can open the door within the timeout period which is 5 seconds by default Also note the following points e Make sure that air can circulate freely through the ventilation slots e Do not install the product next to heat emitting sources or in a place subject to direct sunlight and excessive dust e f fingerprint sensor is used the Metal Back Panel must be grounded as shown in the following figure Important Mounting the Metal Back Panel for iGuard with the optional fingerprint sensor The iGuard comes with a metal panel for mounting on the wall The panel must be grounded By doing so the static electricity that users emit can be discharged directly to the ground This will improve the fi
77. just press these keys instead of pressing the backspace key numerous times to select the desired access status However please note that once assigned to the access status these two keys can no longer be used to enter any normal user ID 50 iGuard LM Series Operation Manual Version 3 6 Show Chinese on Terminal Reserved Do not enable this option not available in US models Language Shown on Terminal Reserved Do not change this option not available in US models Show only ID when Authorized If enabled the user ID instead of user name will be shown on the 1 line of the LCD display when authorized to avoid disclosing the user name to others standing in the line Log Unauthorized Access By default the access log only records the successful authentication If this option is enabled the system will also record all the unsuccessful attempts and store these records in the access log These unsuccessful attempts include events like using the wrong finger attempting to access a unit which he does not have permission to access an inactive user attempting to access the unit and others But this will not log activity for non users such as the Invalid ID attempt Log Retry During the fingerprint verification if the submitted fingerprint does not match the fingerprint template the user will be asked to resubmit his fingerprint Again by default this incident will not be recorded in the access lo
78. k without the need for any dedicated PC or any special software package If the iGuard is connected to the Internet it can even be accessed from anywhere in the world via the Internet iGuard is platform independent It can be a Windows based machine running Microsoft Windows Vista a Linux machine or an Apple iMac machine as long as it runs the standard web browser Once connected to the corporate computer network the unit may be accessed by specifying the IP address in the Web Browser e g http 192 168 0 100 This is the IP address assigned to the iGuard during the setup procedure previously discussed The following will appear in the browser 3 Guard Fingerprint Security System Microsoft Internet Explorer File Edit View Favorites Tools Help Q Back x 2 Search gt Favorites E iGuard Security sys iGuard Security Access Control System Terminal Information Terminal ID la123 MASTER Descriptions jiGuard Security System Firmware version 2 6 85835 ROM 04040 Jul 25 2007 Firmware Version Firmware Version _ 2 6 95835 ROM 04040 Other Feature Remote Door Relay Support SSL Disable Authenticated ange edel ELE fa 1 000 Employees Version Smart Card SE otal Gesi o Users 20 max BEE EE liguard s B Terminal s Your IP Address 192 168 0 139 Start Time Thu 30 Aug 2001 13 37 08 Last Sync Time Disabled Location Time Zone GMT 08 00 Beijing Hong Kong Up Time ooo d
79. k in and Clock out records created in any of these units are collectively saved in the Master unit allowing the administrator to retrieve the access log records for all devices from a single location Different access rights can be assigned to each individual iGuard unit The master unit can optionally synchronize its clock with all the slave units time zone adjusted The following is a typical Master Slave setup Slave Unit 2 Master Unit Paris New York Headerquarters IP 137 25 147 58 IP 192 168 0 100 s Internet Slave Unit 3 Beijing L IP 186 237 241 12 AAA Slave Unit 4 Ze London IP 25 247 21 9 Slave Unit 1 New York Headerquarters IP 192 168 0 101 In the above example the Master unit is located in the New York Headquarters and the other Slave units are installed in various places connected via the Internet All the user information is replicated to all these units and all the access log records of all these units are centrally saved in the Master unit 16 iGuard LM Series Operation Manual Version 3 6 Note All units will still work even if the network connection is lost And any new and modified user data or new access log records will be replicated automatically once the network connection is established again Basic Master Slave configuration The iGuard unit is configured as Master by default Follow these steps to configure the unit as a Slave unit Description
80. mp 23 Square Paris 75009 France 33 1 5343 5172 33 1 5343 9292 sales lucky com hk Lucky Technology Ltd China Address Telephone Fax Email Level 6 Tower W2 Oriental Plaza 1 East Chang An Avenue Dong Cheng District Beijing 100738 PRC China 86 10 8520 0386 86 10 6251 2009 saleschina lucky com hk Lucky Technology Ltd International Address Telephone Fax Email Website 2 F Flat A D Wah Hing Industrial Mansion 36 Tai Yau Street San Po Kong Kowloon Hong Kong 852 3176 6056 852 3012 1980 sales lucky com hk www lucky tech com HHHH 83 iGuard LM Series Operation Manual Version 3 6 Notes 84 iGuard LM Series Operation Manual Version 3 6 Notes 85 Technology Ltd Lucky Technology Ltd iGuard is registered trademark of Lucky Technology Ltd Copyright 1999 Lucky Technology Ltd All Rights Reserved www lucky tech com
81. mp Re Index Database This is to re index and compact both the user database and the access log saved in the internal Flash Memory Normally it is not necessary to perform this function since the Guard is designed to periodically perform the function in the background automatically without user interference However in the very unlikely event should there be something wrong with the Database e g some of the existing users or some of the access log entries are missing follow these steps to re index the databases Description LCD Display 1 While in Function Menu press 0 to select Advanced Pack DBase Feature then press 2 a few times to skip the other items until Yes No 1 2 _ you get to the item Pack Database 2 Press 1 to select YES to re index and compact the Packing Users Databases Guard will first re index and compact the user PITTI database followed by the access log database After the i operation has completed the unit will return to Standby Mode TD Thu Aug 30 14 15 ID _ IN Function A Test Mode Toggle By default Guard records all the user access in the Access Log The device can be set to the Test Mode and it will temporarily stop recording the transactions This feature comes in handy when for example someone wants to practice with or test the device by clocking in and out with the fingerprint but does not want to include these records in the
82. n O to 9 A 8 B They can be selected by pressing the corresponding key in the Function Menu The Function Menu Function 1 Add Update User Function 7 System Shutdown Reset Function 2 Inactivate User Function 8 Set Reset AutoMatch Function 3 Activate User Function 9 Issue Import Smartcard Function 4 Delete User Fingerprint ID Function 0 Advanced Feature Function 5 System Configuration Function A Toggle Test Mode Function 6 Set System Password Function B Open Door Function 1 Add Update User This function is for adding a new user or updating an existing user by Fingerprint or Personal Password as already discussed in the last section Getting Started Function 2 Inactivate ID A user ID can be temporarily suspended This is useful if it is required to temporary remove a person s access to the facility but might allow him to access again in the future This is done via the function Inactivate ID in the function menu and it is illustrated in the following steps Description LCD Display 1 While in the Function Menu press 2 to select Inactivate ID Enter ID menu 2 Enter the ID you want to suspend e g A01 Enter ID A01 19 iGuard LM Series Operation Manual Description Press the Func key to confirm The ID is suspended and the user can no longer be authenticated Press Backspace to ret
83. n be easily generated using the built in features of the office suite application In this way Companies can design their own report formats that are best suitable to their existing operations 65 iGuard LM Series Operation Manual Version 3 6 3 iGuard Fingerprint Security System Microsoft Internet Explorer File Edit View Favorites Tools Help Q Back x 2 Cb search e Favorites gt Address a http 192 168 0 100 Adminsfindex html gt on B iGuard Security System KE Export Access Log Attendance Report XLS Format Employee ID Terminal ID Department Period From To MM DD YYYY fall Departments Last Month 06 01 2007 08 30 2007 Em Options Access Log C Attendance Report C Daily In Out Report Include Heading Include Other Name Last Updated Tue 33 Jul 2007 02 37 10 1999 Lucky Technology Ltd All rights reserved d US Patent No 6 643 779 ed File Edit View Insert Format Tools Data Window Help Type a question For help iqu adana 20 4 am 292 C z 2 1 io Bw 10 B u s 012 e 2 Name Chan KC y Cn O Update 5 Date w Department w Total Hrs Jm Out Late min Total Hrs 6 3 11 2002 blank 10 50916667 6 37 46 AM 7 08 19 PM 0 E 8 38 19 AM 6 48 33 PM E Name 9 83694444 E 43 56 Total of Days Weekday 182 10 2591666 E 52 i Total of Days Sunday 9 40916666 00 E Total of Days 182 j E 13 3119 2002 tbl
84. n the network is accessible by the department s members Description Assign a descriptive name to the unit for displaying in the Terminal List page Master Slave Unit Each Guard can be configured as a Master unit or a Slave unit by checking the corresponding checkbox here For Master Unit if there are slave units in the network that still run on firmware version older than 3 6 8583 the checkbox Disable password authentication for slave with firmware earlier than 3 6 8583 must be unchecked This is for backward compatibility purpose Otherwise the master unit will reject all these slave units running on the old firmware since these old slave units never notify the Master unit their System Administrator Passwords For Slave unit the IP address and the Port number of the Master unit must be specified here IP Address Port Subnet Mask DNS Server amp Default Gateway Specify the network settings of the unit One can specify two IP addresses for the DNS server separated by comma as shown in the figure above Internet SNTP Time Server SNTP stands for Simple Network Time Protocol This allows the iGuard if connected to the Internet to synchronize it internal clock with one of the many atomic clocks on the internet to ensure that the internal clock is always the most accurate 47 iGuard LM Series Operation Manual Version 3 6 3 Guard Fingerprint Security System Microsoft Internet Explorer
85. nector outputs the user ID to another Wiegand device in the standard 26 bit format iGuard LM Series Operation Manual Version 3 6 Connect the Electric Door Strike Connect the Electric Door Strike to the Terminal Pair 3 amp 4 for normal open type or the pair 4 amp 5 for normal close type Internally these terminals 3 4 amp 5 are connected directly to the internal relay rating at 12V 1Amp If the door strike is within this current limit it can be directly connected to these terminals If the current rating is above 1 Amp the Remote Relay must be used to be discussed in the Appendix More details about the door strike connection are given in the connection diagrams in the Appendix The administrator should examine each door that is to be controlled and determine the type of door wood glass or metal the direction it swings the desired direction to be controlled unless the unit will authenticate both directions and the type of frame wood or metal This information will be helpful for determining the type of lock that is to be used with the iGuard Please consult the dealer for more information about magnetic locks electric strikes and other door hardware If the system is used solely for Time Attendance purposes these terminals can be left disconnected Connect the Network iGuard is designed to be directly connected to the corporate computer network and to the Internet via the standard RJ
86. ngerprint images of users Connect the Power amp External Controls iGuard provides easy access terminals for connections to external controls including Door Strikes Door Sensor Door Open Switch and External Alarm iGuard LM Series Operation Manual Version 3 6 _Terminals Description 1 amp 2 Power 12V DC The power requirement is 12V DC 150mA idle 500mA peak Connect it to the power supply provided 3 4 amp 5 Door Strike Terminal 3 amp 4 are the normal open NO pair and terminal 4 amp 5 are the normal close NC pair Connect the door strike to either pair of these terminals according to the type of the electric door strike 6 amp 7 Door Sensor Optional This pair provides iGuard the current status of the door i e open close If the door is left open for over 10 seconds iGuard will generate beep sounds to alarm 8 amp 9 Reserved Reserved for future use 10 amp 11 External Alarm Optional This pair is for the optional external alarm In the case that the device is forced open and removed from the wall during operation an internal case switch will connect this terminal pair which can optionally sound an external alarm RS 485 Remote Relay Connector for Remote This is to connect the Guard to the optional Remote Relay unit Relay only Refer to the Appendix for more detail Wiegand Wiegand Connector iGuard can be used as an Wiegand Reader This Wiegand con
87. nreretrnrtnnnnertttrnnn nnne ttnn nnmnnn nnmnnn nnne neen 20 Function 4 Delete Fingerprint ID 20 Function 5 System Configuration nn narran 21 Function 6 Set Password 21 Function 7 Shutdown ReSet n n nu 22 Function 8 AutoMatch nn 23 Function 9 Issue Import Smartcard un 23 Function 0 Advanced Feature u n n una 25 Function A Test Mode Toggle u rra 29 Function B Opern EE 30 THE BACKSPACE KEY Ne 30 USING THE WEB BROWSER vn ccciciooconi ncnicnnancanniane olaaa ntc cana SEENEN EETEEEEAEEEEE REESEN 31 Ee KEEN 32 ACCOSS DO 32 AO AN CO aru est eo eer eendeiteg ee 33 DAV INE eegene ieee ee as estos aus eee ane eege 34 EMPLOYEE LIST cocinada tallada u Da uki aaa 34 SS 35 Aid EM plOY C6 2 i u u Sunius manku ulate cess eeh ee enee 37 DEPARTMENT otu did id a e a ere eene SE 38 Department st 39 Add Department 41 iGuard LM Series Operation Manual Version 3 6 ACCESS ene EE 41 QUICK ACCESS u uu k eegend Senden O E 42 ADMINISTRATION ua kau q atau saya ayy saka aQ umawa uq sak Ee ato 43 VOLUN ET 43 P asSSsword SOLU EE 44 FEINA SOUP EE 46 Terminal Reset S h OWN deeg a eseu SEENEN 57 OO 58 IOUN TING TODO EE 59 61 ET UE EE 62 AUT ACCISE GO 63 Kale 65 EXPOS XLS EE 65 Exports TXT TE 67 Export ee 67 BACKUP iiie i AE ge es AES as se ee Ee a lee 68 A aims EEN ee ed ed dE le 69 Web Came
88. nroll the user s fingerprint Clear FP If SmartCard Issued This is mainly for privacy purpose If enabled the user s fingerprint information stored in the internal memory of the unit will automatically be cleared after issuing a Smartcard to the user When issuing a Smartcard all the user information including the fingerprint information will be written and saved in the Smartcard By clearing the fingerprint information stored in the unit automatically the user s Smartcard would be the only media that contains the fingerprint information thus the privacy of the user can be protected During verification iGuard will read all the contents of the Smartcard first and then it will compare the fingerprint information saved in the Smartcard against the submitted fingerprint image Extended In Out Status Four additional access statuses F1 to F4 are available as well as the normal IN and OUT status Enable any one or all of these four additional access statuses by checking the corresponding checkboxes As an example assign F1 as Lunch Out and F2 as Lunch In so the employees can use F1 when they are out for lunch and use F2 when they are back from lunch Remap Key A B Normally the Backspace key on the keypad is used to scroll through all the possible access statuses i e IN OUT F1 etc and to select the desired one This option is for assigning the two shortcut keys A amp B to these access statuses so the user can
89. nt for access Also users with poor fingerprint quality should not use AutoMatch because this option requires a higher quality of fingerprint image Follow the same procedure to toggle off this AutoMatch feature for the user Function 9 Issue Import Smartcard This function is for issuing the optional smartcard to new amp existing users and for importing existing smartcards to a new iGuard iGuard comes standard with a built in contactless smartcard reader which reads and writes user information to and from the smartcards The information includes the user names access right fingerprint template and personal password Please refer to the procedure on how to issue a Smartcard to new or existing users discussed in the section Getting Started 23 iGuard LM Series Operation Manual Version 3 6 Note When issuing a smartcard to an existing user with fingerprint information only the primary fingerprint is written to the smartcard This is due to the limited smartcard memory There are three possible ways to authenticate a user using Smartcard These are e Smartcard Alone e Smartcard Fingerprint e Smartcard Personal Password The first method Smartcard Alone is already discussed in the chapter Getting Started earlier It is applicable when the unit is in the Quick Access mode or when there is no fingerprint or Personal Password assigned to the smartcard owner In this method all the user needs to do is to present
90. o turn on the option Now the iGuard Thu Aug 30 14 02 will close the terminals 10 amp 11 at the back for ID _ IN approximately 5 seconds when there is unauthorized access The unit will then return to the Standby Mode 6 Set Quick Enroll for units equipped with Fingerprint Sensor only Reserved for backward compatibility Do not enable this option 7 Reset User In Out Status for Master Mode only iGuard keeps a list of all users IN OUT status and the corresponding date amp time information This can be viewed on the Employee List webpage which will be discussed in the next chapter This option is to clear the information Follow these steps to reset the User In Out Status Description LCD Display 1 While in Function Menu press 0 to select Advanced Reset User In Ou Feature then press 2 four times to skip the other items until Yes No 1 2 _ you get to the item Reset User In Out Status In Out Status Yes No 1 2 _ scrolling message gt 2 Press 1 to select YES to reset the user status Now the Thu Aug 30 14 08 Guard will clear all the existing users In Out status The Tp H IN unit will then return to the Standby Mode Note By default the User Status information is automatically reset daily at 12 00am This 28 iGuard LM Series Operation Manual Version 3 6 is user definable in the webpage discussed in next chapter 8 Pack a
91. only for testing the connection between Master and Slave units 2 Ping Test This test is analogous to the same test in PC It is different from the Connection Test in that it works with any network device not just iGuard It comes in handy when it is necessary to test the connection between the iGuard and a PC for example Description 1 While in Function Menu press 0 to select Advanced Feature Then you will be asked if you want to perform a Connection Test 2 Press 2 to select NO to skip the Connection Test then you will be asked if you want to perform a Ping Test 3 Press 1 to select YES then you will be asked to enter the IP address of the target device Enter the IP address of the target device 4 Press Func to confirm The unit will try to ping the target device and display the result as shown 26 LCD Display Connection Test Yes No 1 2 _ Ping Test Yes No 1 2 _ IP Address 192 168 000 123 192 168 000 123 Ping t1 5ms 192 168 000 123 Ping 3 ms iGuard LM Series Operation Manual Version 3 6 Description LCD Display 5 Press Backspace to return to the Standby Mode Thu Aug 30 13 57 ID IN 3 Configure iServer for Master Mode only This is for configuring the iGuard to work with the iServer exe which is a Windows based program that runs on PC to allow using the PC to store all the Access Log permanently
92. ores a high quality image during enrollment because this is the fingerprint image that the device will use to compare against the submitted fingerprint images in all the verifications later on If the users enrolled fingerprint image is of low quality the user may get unexpected results during the verification stage later on In the case of poor fingerprint quality or dry finger iGuard will ask to lower the matching security for the particular user A low security level can be more convenient to the user by reducing the false rejection rate but it comes with a minor reduction in security level Therefore we recommend choosing low security level only for time attendance applications These are some of the error messages that may appear during fingerprint enrollment 72 iGuard LM Series Operation Manual Version 3 6 Description LCD Display This message will appear during enrollment if the fingerprint is Scanning 1 of 1 too dry Try to lift up the finger and put it back on the sensor Too Dry again If the problem still exists consider applying some skin moisturizing lotion as discussed above This message will appear at the end of the fingerprint Set Security to enrollment process if the fingerprint quality is only marginally Yes No 1 2 _ acceptable and suggests setting the security level to low for this particular user Select YES to set it to Low This security level can also
93. port Card Adding amp Verifying user with Fingerprint optional This section is for iGuard with the optional fingerprint sensor only iGuard is optionally equipped with fingerprint sensor for fingerprint verification During the fingerprint enrollment process the unit will ask for two fingerprint images for each person and the information of the images is extracted and stored in the internal database for later verification Each person must register two fingers one as the primary and the other one as the secondary Therefore if the person s primary finger is 10 iGuard LM Series Operation Manual Version 3 6 temporarily not suitable such as when the finger is wounded he can still use his secondary finger for verification During the process each fingerprint image is captured three times for minutiae analysis and extraction Minutiae are the mathematical representation of the fingerprint image If the quality of any one of the three images is not good enough the user will be asked to re scan the three images again The two thumbs are suggested as the primary amp secondary fingers This is because the thumbs are usually bigger and can cover the scanner area better Hints for Capturing Fingerprint Images Place the thumb flat on the fingerprint sensor using the pad not the tip of the thumb The tip of the thumb contains the fewest minutia points so place the thumb as flat as possible on the sensor to generate the
94. ra EE 70 APPENDIX uu u aa ua asw auqa u qasa lis 72 FINGERPRINT ENROLEMENT uuu ul T Sada ayau B Paara AA Aa aT TEA iE 72 SERVER ta a A EE a 74 REMOTE DOOR RELAY aid sai 75 GONMTIQUIQUON EE 76 SUPERMASTER da 78 CONNECTION DIAGRAM EE 79 BASIC CONNEC CLONE sess peices GE EE IO IAS 79 Basic Connection Large oa 80 ele EE EN IGUARD PART ENS u a A cance eee u ee 82 CONTACT INFORMATION ee ZL Q li anda 83 iGuard LM Series Operation Manual Version 3 6 INSTALLATION Proper planning is the key to successful implementation of any technology project While the iGuard system is very easy to install and operate there are some things to consider before you begin installation Pre Installation Notes e iGuard is designed for indoor use If you plan to install it outdoors be aware that exposing it to water heat or other harsh conditions can damage the device and it may not operate properly e Do not install Guard next to heat sources or in direct sunlight e For iGuard units equipped with the optional fingerprint sensor make sure the iGuard s back metal panel is properly grounded to earth to prevent electrical impulses and shocks from affecting users and the iGuard units e To prevent electrical short circuits or overload power the iGuard independently with the power supply provided Do not share the power with other device such as the electric door strike e For security and safety purposes do not connect the door button to
95. ror message will be shown on the LCD display of the slave unit Function 7 Shutdown Reset Use this function to erase all the user and access log data stored in the internal memory and to reset all the device settings to the factory default such as setting the IP address to the default 192 168 0 100 and the terminal name to iGuard etc Follow these steps to reset and shut down the unit Description 1 While in Function Menu press 7 to select Shutdown Reset You will be asked whether to reset the User Database or not 2 Press 2 to select NO then you will be asked to reset the Access Log or not 3 Press 2 to select NO then you will be asked to reset all the settings to factory default or not 4 Press 2 to select NO then the unit will take a few seconds to prepare itself to shut down Then it will show the message and it is now safe to power off the unit LCD Display Reset User DBase Yes No 1 2 _ Reset Access Log Yes No 1 2 _ Factory Default Yes No 1 2 _ It is now Safe To Power Off Note When the User Database or the Access Log are reset all the data will be cleared when the unit is powered up again Note If it is not necessary to reset the data the device can be shut down safely by simply turning the power off 22 iGuard LM Series Operation Manual Version 3 6 Function 8 AutoMatch Use this function to toggle the AutoMatc
96. ssed in more detail in the next chapter under the section Quick Access and Password Setup Follow these steps to assign amp edit these passwords Description LCD Display 1 While in Function Menu press 6 to select Set Password System Admin kkk 2 Enter the new System Administrator Password e g AB456 System Admin Note that you do not need to press backspace to erase the SEER existing one 3 Press Func to confirm the new password iGuard will then User Admin ask for the User Administrator Password 21 iGuard LM Series Operation Manual Description 4 Enter the new User Administrator Password and then press Func to confirm Then you will be asked to enter the Door Access Password 5 Enter the new Door Access Password and then press Func to confirm The unit will save the new passwords and return to the Standby Mode Version 3 6 LCD Display Door Access Thu Aug 30 13 48 ID IN Note Both User Administrator Password amp Door Access Password are optional If it is not necessary to assign the password just press the Func key without entering anything to skip the step However the System Administrator Password is not optional and must be assigned The default is 123 Note The System Administrator Password of the Slave unit must be the same as the Master unit Otherwise the Master unit will reject the slave unit In this case an er
97. t Last Help First Previous Next 08 30 2001 13 36 43 4123 In Total 1 Record s Delete SELECTED Access Record s Manually added record s only Remarks authenticated by password Refresh every Disable JE Last Updated Thu 30 Aug 2001 13 36 47 1999 Lucky Technology Lid All rights reserved US Patent No 6 643 779 W s II em Note Additional functionality is available through the keypad operation and web interface which will be discussed in following chapters 15 iGuard LM Series Operation Manual Version 3 6 Master and Slave Mode Each iGuard can be configured as a Master unit or a S ave unit By default iGuard is configured as a Master unit In a multi device environment where more than one iGuard device is connected to the same corporate network or over the internet these devices can form a Master Slave network In this case one of these devices is assigned as the Master unit and all others are assigned as Slave units The advantages of forming a Master Slave network are The system automatically replicates all the users information to all devices in the master slave network Once a user registered in a unit either a Master or a Slave unit the information will automatically be replicated to all other devices and the user can get access to and be verified by any one of the devices in the network All access log records such as the Cloc
98. t button in the navigator bar at the top of the page to move on to the next page or jump to any particular page by clicking on the page number at the bottom 32 iGuard LM Series Operation Manual Version 3 6 The following example shows only the Last Month records of the employee ID BB12 erprint Security System Microsoft Internet Explorer File Edt View Favorites Tools Help Ok x 2 J Search gt gt Favorites gt Address la http 192 168 0 100 Admins index htrl sl E Ho E Guard Security System Access Log SR First Previous Next Last Help Employee ID Terminal ID Department Period From To MM DD Tat Departments em gt LastMontn 06 01 2007 fos 3o z007 E Name Date Time Terminal In Out Ng Raymond Engineer D6 29 2007 19 12 14 Main Ng Raymond Engineer 06 29 2007 08 19 19 Main Ng Raymond Engineer 06 28 2007 18 39 36 Main Ng Raymond Engineer 06 28 2007 08 20 03 Main Ng Raymond Engineer 06 27 2007 18 33 45 Main Ng Raymond Engineer 06 27 2007 08 26 16 Main Ng Raymond Engineer 06 26 2007 18 29 57 Main Ng Raymond Engineer 06 26 2007 08 24 15 Main Ng Raymond Engineer 06 25 2007 18 48 50 Main Ng Raymond Engineer 06 25 2007 08 22 44 Main Ng Raymond Engineer 06 22 2007 18 07 54 Main Ng Raymond Engineer 06 22 2007 08 16 35 Main Ng Raymond Engineer 06 21 2007 18 16 20 Main Ho Raymond Engineer 06 21 2007 08 20 48 Main Ng Raymond Engineer 06 20 2007 18 10 09 Ma
99. ted the Smartcard it will update the card by writing Writing the user information to the card Issue OK 7 Once it has finished updating the card the unit will ask forthe Thu Aug 30 13 28 next user ID for issuing another Smartcard Press ID _ IN backspace to return to Standby Mode All the available user information including the user name personal password access rights and the fingerprint information if any will be written to the Smartcard memory Note Only specifically formatted iGuard Smartcard can be used with the device Please contact the iGuard dealer or visit the manufacturer s website for more information about purchasing the Smartcard Verification with Smartcard Verification with Smartcard is simple and straight forward and is illustrated in the following steps Description LCD Display 1 While in Standby Mode present the smart card near the A01 keypad The unit will read the data stored in the card If the Authorized card is valid the user will be authorized as indicated in the display The unit will return to Standby Mode afterwards and it is ready for the next card ee ID e IN Note To achieve higher security level iGuard can be configured to ask for the fingerprint image or Personal Password after presenting the smartcard for verification It will be discussed in more detail in the next section under the heading Function 9 Issue Im
100. that are currently connected to the iServer program In the above example only one Guard ID 100 is connected and this Guard will send all the access log entries to the iServer program in real time Multiple iGuards can be connected to the same iServer program The right panel shows the recent access log entries in real time By default iServer stores the access log records in ODBC database format using Microsoft Access iServer also supports other ODBC compliant database other than Microsoft Access such as MS SQL mySQL and Oracle Please refer to the operation manual that comes with the iServer utility for installation and operation Remote Door Relay The iGuard capabilities can be enhanced by the use of the Remote Door Relay which is sold separately from the iGuard unit The Remote Relay assures that malicious damage to or tampering with the iGuard does not result in a release of the electric door strike or magnetic lock 75 iGuard LM Series Operation Manual Version 3 6 This device is to be physically installed inside the premises and it is connected to the iGuard s Remote Relay connector at the back of the unit through a special twisted pair cable When using the relay the electric door strike actions are controlled by the remote door relay rather than directly by the iGuard unit The remote relay will only release the strike lock when a properly addressed Release and Relock signal is received from the i
101. the iGuard terminals Instead connect it directly to the door strike to avoid failure in case of a power outage or other emergencies e To increase the security level in access control applications use the optional Remote Relay together with the iGuard unit This device is sold separately and it assures that malicious damage to or tampering with the iGuard does not result in a release of the electric door strike Please refer to the Appendix for more information e Make sure the Smartcard Company Code is properly set before assigning any smartcard to users This code is a configurable 4 character code which is to set your iGuard system apart from any other iGuard system Any smartcard with a code that does not match is not recognized by the system So once the smartcards have been assigned do not change this Company Code Please refer to the section Using the Web Browser gt Administration gt Terminal Setup gt Code Setting for more information Installation Determine the location s for installing iGuard external Remote Relay door strike and power supply line Fasten the rear metal panel at the location where the iGuard unit will be installed Connect the iGuard unit with the power supply provided iGuard LM Series Operation Manual Version 3 6 Power Requirements amp Back EMF issue iGuard requires DC 12V 500mA switching power supply Sharing power with other devices such as a door strike is NOT recommended This
102. to define the authorized Quick Access period and the corresponding iGuard units The default setting is NONE i e there are no authorized terminals or access times for Quick Access 3 iGuard Fingerprint Security System Microsoft Internet Explorer File Edit View Favorites Tools Help Ar Q Bak x 2 Cb Search e Favorites gt Address ES http 192 168 0 100 4dminsfindex html sl E so E iGuard Security System 3 Quick Door Access Control Configuration Help Quick Door Access Control Configuration Time Restrictions Click Monday Sunday to edit the time restriction 00 0102030405060708091011121314151617 181920212223 YY YY YY YY YY YY YY YY YY YY Y YY YY YY YY YY YY YY YY YY YY Y YY YY YY YY YY YY YY YY YY YY Y YY YY YY YY YY YY YY YY YY YY Y y YY YY YY YY YY YY YY YY YY YY Y Saturday Holiday as be ee pe ee mie deg no lani ae se s on a ne ee ee Terminals Any Terminal M A123 Check All Terminals Clear All Checked Terminals SE S a Wi i I TC Wee The procedure for setting the valid period for Quick Access is similar to the procedure for setting up the departments discussed above 42 iGuard LM Series Operation Manual Version 3 6 In the
103. up function instead 3 You can use this function to transfer a group of Employees to remote iGuard terminals 4 To select Employees from Employee list click Employee ID and select 5 To Import the saved Employees information select Restore function on command list Include Department Information dated Tue 31 Jul 2007 03 23 13 ast Up 01999 D Technology Ltd All rights reserved US Patent No 6 643 779 To include a particular user enter the user ID in the Employee D box and press the Add button Press the Export button to save the selected users information in the file in the PC This file can be later on restored to another iGuard in order to avoid requiring these users to re register The restore procedure will be discussed below Backup We recommend you backup the internal user data amp access log regularly to the desktop computer In the unlikely event that the system is to be replaced or the database file is corrupted the old data can be restored back to the device and the employees do not need to re register 68 iGuard LM Series Operation Manual Version 3 6 iGuard Fingerprint Security System Microsoft Internet Explorer 2 5 x File Edit View Favorites Tools Help a Q Back w i 2 Search e Favorites gt Address a http 192 168 0 100 Adminsfindex htrnl gt co iGuard Security System Backup Database Tips This command will export the Employee
104. urn to Standby mode Function 3 Activate ID Version 3 6 LCD Display ID A01 Inactivated Thu Aug 30 13 44 ID IN This is to resume an Inactivated ID and it follows the procedure similar to its counterpart function above Function 4 Delete Fingerprint ID Use this function to delete the fingerprint template of a user or to permanently delete a user from the internal memory Follow these steps to delete the fingerprint template of the user Description While in the Function Menu press 4 to select Delete Finger ID Enter 1 to select Finger Then you will be asked to enter the user ID that the fingerprint template is to be deleted Press the Func key to confirm The Fingerprint Template of the user is deleted and he can no longer use his fingerprint to get authenticated However he can still use his Smartcard or Personal Password if available Press Backspace to return to Standby mode LCD Display Del Finger ID 1 2 _ ID to Del Finger A01_ ID A01 Finger Deleted Thu Aug 30 13 50 ID IN Follow these steps to permanently delete a user from the internal memory 1 Description While in the Function Menu press 4 to select Delete Finger ID 2 Enter 2 to select ID Then you will be asked to enter the user ID to delete 20 LCD Display Del Finger ID 1 2 _ ID to Delete A01_
105. use the Backspace key to toggle the access status The default access status is IN as shown in the 2 line of the LCD display when the unit is in Standby Mode Follow the steps below to change the access status from the default IN to OUT Description LCD Display 1 In Standby Mode the default access status is shown in the Thu Aug 30 16 36 2 line of the display which is IN in this case ID _ IN 2 Press the Backspace key and the access status will be Thu Aug 30 16 36 changed to OUT Then follow the usual procedure to ID _ OUT continue e g enter the user ID and present the smartcard 3 If no key is pressed for approximately 5 seconds the unit will show the Time Out message and will return to the default Time Out access status Thu Aug 30 16 36 ID _ OUT Note The default access status can be set to either IN or OUT in the In Out Trigger page via the web browser 30 iGuard LM Series Operation Manual Version 3 6 USING THE WEB BROWSER iGuard has a built in web server which operates exactly like a hosted web site The web interface gives the system administrator a simple easy to use set of tools to configure and maintain the unit and the users Retrieve the access log records and other data with any standard web browser such as Microsoft Internet Explorer or Mozilla Firefox With this feature the unit may be accessed by any PC connected to the corporate networ
106. used in an application where no security is required Please 49 iGuard LM Series Operation Manual Version 3 6 refer to Quick Access in the previous section for more information in configuring this Quick Access period SC Quick Access If No FP And PSW If enabled user can authenticate by presenting the Smartcard if no fingerprint template or personal password have been assigned to the person However if the user has enrolled his fingerprint or has been assigned a personal password he still needs to submit the fingerprint image or enter the personal password for verification Normal Working Hour Use this to specify the normal working hour to allow the attendance report to show in red color the records that did not occur within this period Enroll only one finger Reserved for backward compatibility Do not enable this option Disable Enrollment Overwrite By default during the fingerprint enrollment procedure the newly submitted fingerprint information will overwrite any existing one after confirmed by the user This is to disable the overwrite capability Once the fingerprint is enrolled for a user the fingerprint information cannot be changed in any way later on The main purpose for this feature is to avoid accidentally overwriting one s fingerprint information if a wrong user ID is entered during fingerprint enrollment If enabled the administrator must delete a user and then re create the user in order to re e
107. utoMatch Check this option to include this user in the AutoMatch group for the 1 to many fingerprint matching Security Level Personal This is for the unit with the optional fingerprint sensor only Select the default Normal follow system setting and the fingerprint matching security level of this user would follow the system security level Select other security level Such as Low for users with difficulty in fingerprint matching such as those with skin problems Department This is to assign the user to different departments by checking the checkboxes in the department list on the right side of this page The default department is EVERYONE More details about the Department will be discussed in the next section Press the Save button at the bottom to save the change Press the Delete button to delete this particular employee Add Employee In addition to adding new users to the unit using the keypad procedure discussed in the Getting Started section earlier users may also be added from the Add Employee page as shown in the following figure 37 iGuard LM Series Operation Manual Version 3 6 E iGuard Fingerprint Security System Microsoft Internet Explorer File Edit View Favorites Tools Help ay GQ Back x 2 Search Favorites gt Address http 192 168 0 100fAdmins index html sl E e E iGuard Security System Employee Record First Previous Next Last
108. y enter the date and time turn off this option by checking the OfP button Location Time Zone This setting is applicable to the SNTP Time Server and must be correctly set according to the local time zone This setting is important if the SNTP Time Server has been specified in the Terminal Setup page This setting is also required for clock synchronization between master and slave units In Out Time Trigger Use this page to set triggers for the IN OUT setting At the specified time the default access Status will automatically set to IN and the unit clocks in anyone who accesses the unit The same applies for other access statuses like OUT F1 F2 etc The following is a typical example of the setup 59 iGuard LM Series Operation Manual Version 3 6 3 Guard Fingerprint Security System Microsoft Internet Explorer File Edit View Favorites Tools Help Q Back w 12 Search e Favorites In Out Time Trigger Trigger at HH MM 15 30 C in out C Fl C Fa Add Others Click time to remove edit Last Updated Sun 29 Jul 2007 01 48 20 01999 Lucky Technology Ltd All rights reserved US Patent No 6 643 779 A A mgeet In this example when the time reaches 7 00 in the morning the default access status will change from OUT to IN Likewise the device will change the default status to F1 at 11 30 to F3 at 12 30 and to OUT at 16 30 as shown in the following
109. y save the access log records from all the units Follow the same setup procedure to configure the network and other settings of the SuperMaster Similar to the normal master slave configuration the slave unit connects to the SuperMaster by specifying the IP address and the Port number of the SuperMaster in much the same way as connecting to a normal Master unit Unlike the normal Master unit the SuperMaster does not synchronize the whole user database to the slave units Instead it intelligently selects a maximum of 1 000 users from the internal user database which may contain as many as 20 000 users and upload these users to each slave unit During the normal verification procedure at a slave unit the slave unit will first search its internal database to see if the user information is already available If so the slave unit will continue the verification process normally Otherwise the slave unit will send a request to the SuperMaster in the background for the user information and continue the process after receiving the information from the SuperMaster The slave unit will keep the most recently accessed 1 000 users in its internal user database and the oldest user information will be replaced by the newly received user information Therefore in case the network connection is lost chances are pretty good that the user can still get authenticated in these slave units unless the user is not one of the 1 000 recent users 78
110. y the fingerprint matching security level used during the AutoMatch i e 1 to many operation Set this to Maximum to avoid false acceptance error Door Relay and Beep Setting This is to configure the various options for controlling the door relay Use these options to configure which type of events should or should not open the door 3 iGuard Fingerprint Security System Microsoft Internet Explorer File Edit View Favorites Tools Help a Q Back x z J Search Favorites gt address ES http 192 168 0 100 Adminsjindex html SE iinn mam Detault Standard Autamatch Security Level Maximum Di Default Maximum Door Relay and Beep Setting e ben WI M Disable Door Relay Control for In Enable C Disable Door Relay Control for Out Enable C Disable Door Relay Control for F1 F4 C Enable Disable Door Relay Delay Timer lo Sec Time delay for door relay from on to off 1 10 0 factory default Beep Sound Z Enable Code Setting e IMPORTANT Changing Company code may disable all registered smart card Company Code 4 char cuP v Web Cam Setting IP 0 to disable e 7 Cam 1 s IP 0 0 0 0 Model axis 2100 Y2 0X Cam 1 s Descriptions Cam 2 s IP 0 0 0 0 Model axis 2100 Y2 0X Cam2 sDescriptions 4 005 1001 1153 Door Switch Reserved for backward compatibility Always set it to Disable
111. y the unit The default is CMPY When reading the card iGuard will first compare the smartcard s code against the device s code If they do not match iGuard will just simply ignore the card Warning This value must be set prior to issuing any smartcard and must not be changed afterwards Otherwise all previously issued smartcards will be ignored Web Cam Setting This section allows you to configure up to four cameras to be viewed from within the iGuard interface The cameras must be IP capable and will be visible from the Web Camera page under the Tools section iGuard will display the streaming video for 120 seconds at a time and will not record This feature is only for viewing Use the pull down menu to select the web cam models Please contact the manufacturer if the desired web cam is not in the list Wiegand Setup iGuard can be used as a Wiegand Output Reader There is a Wiegand output connector at the back of iGuard which outputs the user ID to another Wiegand device in the standard 26 bit format 56 iGuard LM Series Operation Manual Version 3 6 3 Guard Fingerprint Security System Microsoft Internet Explorer File Edit View Favorites Tools Help Q Bak x i 2 J Search gt Favorites gt Address ES http 192 168 0 100 Adminsfindex html Es x a Tey 4 UU v Z L 4 s Descriptions es Wiegand Setup Lal Output Disable C Enable C Enable

English - Lucky Technology Ltd.

Contents

Download Pdf Manuals

Related Search

Related Contents