IntraOs 70 X-Ray Equipment - Chicago X
Contents
1. a te E OLI 3 S dz ih a h i YELLOW GREEN lt OF ETTARO d YELLOW GREEN A IPS GROUND PROVISION E Ee FROM MAINS YELLOW GREEN GROUND PROVISION ON TIMER sa y Ur A Pass the conductor of the grounding provision already connected to the common bolt into the timer for connection to the central ground point in the connecting block protective earthing B Connect the grounding provision of the support arm to the common bolt on the wall plate flat washer ground provision lock washer nut C Pass through the supply cable of the scissor arm into the timer for connection to the OUT positions supply cable output to tube head 3 1 10 Connecting the Wall Adaptor with Timer remote A Prepare the terminations of the cable for remote connection of timer with tips to fit the connecting blocks in timer and connecting blocks plus the common bolt for grounding in wall support B Make sure the copper section of the yellow green wire is large enough see section 3 1 3 Electrical Requirements at page 16 YELLOW GREEN TO YELLOW GREEN COMMON BOLT ON WALL SUPPORT ds WALL SUPPORT SIDE V 5 03 69 500 00210 21 56 d BLUEX IntraOs 70 Service amp Installation Manual C Remove from the common bolt for bonding and erounding on the wall adaptor the existing cable for ground provision D Connect the cable for remote connection of the timer by placing2. IntraOs 70 Ray Equipment Blue X Imaging Srl Via Idiomi 1 8 33 20090 As a BLUEX IntraOs 70 Service amp Installation Manual Control panel and exposure pushbutton 2 A 6 000A 9 099 9 AutoSet Device for emission of ionizing radiation on request Indication of system turned on and ready Irradiation Alarm mAs display the controlled technique factor 6 Manual decrease of controlled technique factor Manual increase of controlled technique factor Patient size adult large 9 Patient size child small 2 56 69 500 00210 V 5 03 IntraOs 70 Service amp Installation Manual BLUEX Layout Power Board Timer AutoSet E b A N SS A d n on a paa ded d as a ERA E LP GEEAE m m mm SUPPLY 5 V LED SET UP Sr KEYBOARD MICROSWITCHES Rua CONNECTOR Kr P Aw ASSAGO q F z DE BACK UP TIMER AAA TEST POINT amp LED E MICROPROCESSOR SS RE x d j WATCHDOGLED j A e POWER if SUPPLY I Be s z L e e n n Z c I Li k Le Ze th f T MEZ ei h pal d d i 2 I 9 i i i segnano T s ia r j pa ki CR dl i P emp LE z Sed FAL SS ner S F n S d S D EM d m F i Ze d L i i mi j S r Ki D F i E k D i LA i y Li m 1 1 wa Esta C T50mA 230V T80m
3. COOLING CURVE OF TUBE HOUSING ASSEMBLY 150 kJ 125 100 75 50 25 0 20 40 60 80 100 120 140 160 180 200 Tempo min V 5 03 69 500 00210 55 56 IntraOs 70 X ray Equipment Service amp Installation Manual English Edition Version 5 03 6955000210
4. O DS O 00 O O lt OD med Dn O e gt O O LL IntraOs 70 Service amp Installation Manual BLUEX Appendix D Alarm Conditions AutoSet Timer Alarm Conditions Code Fault Error Signal Action Reset X ray requested Green lamp System By acknowledgement during cool down System Ready iD Led on the panel or when oeriod flashing system cooled down Green lamp System Automatically when pb SR below Ready and red lamp line voltage back in Alarm flashino range Green lamp System Automatically when e Ready and red lamp m line voltage back in upper Amit Alarm flashing inhibited range Computed exposure factor Green lamp System Minumum Ready and red lamp exposure lower than snai Alarm flashing factor forced Corrected exposure Green lamp System Maximum factor greater than Ready and red lamp exposure PY rola maximum Alarm flashino factor forced P Line Frequency G rendi de System By switching system Detection Failure i a NOS Inhibited off and on again Exposure push Red Exposure B k fad G L A 07 button pressed at I E Inhibited ye ene Di SES AE Alarm flashing on the panel By acknowledgement Exposure stopped Red lamp System by the operator Alarm flashing inhibited S the panel or after ace Red lamp Alarm system By switching system ima switched on inhibited off and on again Back up relay Red lamp Alarm System By switching system failure switched on
5. or its Agent from responsibility for any injury damage or non compliance which may result Maintenance for the IntraOs 70 system to be done regularly by a service technician at least once every 24 months with regular checks performed by the operator every year Any defect or malfunction should be corrected immediately by qualified personnel with adequate training WARNING ANY DEFECTIVE ITEM AFFECTING A T SAFE USE MUST BE REPAIRED OR REPLACED Only original certified components and spare parts must be used for repairs or replacements Correction of damages to the identification labels to be handled with the Manufacturer Any defect or non compliance must be reported promptly to the Manufacturer or to its Local Agent ALWAYS DISCONNECT THE SYSTEM FROM THE LINE VOLTAGE SUPPLY USING THE GENERAL LINE VOLTAGE SWITCH FOR THE ROOM WHERE THE A EQUIPMENT IS LOCATED BEFORE PERFORMING ANY MAINTENANCE ACTIVITY AVOID USING LIQUID OR SPRA Y DETERGENTS WHICH MA Y ENTER INTO THE EQUIPMENT AND CAUSE CORROSION A AVOID THE USE OF SOLVENTS OR CORROSIVE DETERGENTS WHICH CAN DAMAGE PAINTED SURFACES AND PLASTIC COVERS V 5 03 69 500 00210 33 56 BLUEX IntraOs 70 Service amp Installation Manual 4 1 Maintenance of Wall Adaptor POSITION OF 21 DISK SPRINGS IN FRICTION SCREW 7 GROUPS OF 3 A Remove the cover and verify that the id mounting is closely connected to the y wall and stays firm and steady during BOLT FOR
6. F Secure it to the wall ensuring it is leveled Improper leveling might cause the arm to move and swing out of position G Perform wire connection and final set up complying with recommended sequence of actions reported in the following 69 500 00210 V 5 03 IntraOs 70 Service amp Installation Manual BLUEX 3 1 6 Mounting the Timer A Use the mounting plate or the template to mark the holes on the wall B Remove the plastic cover after having taken away the blocking screws behind the logo strip Pay attention when disconnecting the flat cable of the control panel from the control board C Drill the four holes in the wall and secure the timer making sure it 1s leveled Cabling should have been laid out in accordance to mounting requirements D Perform wire connection and final set up complying with recommended sequence of actions reported in the following 3 1 7 Mounting the Support Arm A Unpack the extension arm and check for completeness of parts B Do not remove the rope to pull the cable of the Arm to the Wall Adaptor through the Extension Arm C Push back the cylinder of the side friction not to interfere lightly grease the shaft of the extension arm and insert 1t into the wall adaptor D Mount the rotation end stop spacer and close the side friction without tightening V 5 03 69 500 00210 19 56 BLUEX IntraOs 70 Service amp Installation Manual 3 1 8 Mounting the Scissor Arm WARNIN
7. HAND SWITCH SOCKET TST1 terminal block IN on the left but do not connect any outgoing wire OUT on the right to Wall Adaptor C Make sure that the live conductor is the hot one a Connect an AC voltmeter or a test light between the block terminal live in and ground b Turn line voltage supply ON If full line voltage 1s measured test lamp lights the wiring 1s correct If not turn line voltage supply OFF reverse live in and neutral in wires and repeat the measurement eventually the full line voltage should be read between line and ground test lamp lights c Make sure no voltage Is read between neutral in and ground 1f not check line voltage distribution D Test the timer for full functionality keeping the output cables disconnected so that power 1s not provided to the load E Connect the load B Connect the three wires from the line voltage supply to the T V 5 03 69 500 00210 23 56 BLUEX IntraOs 70 Service amp Installation Manual Turn OFF the line voltage supply line Connect the three wires of additional cable outgoing to the Wall Adaptor Scissor Arm Tube Housing Assembly Live and neutral wires to the scissor arm tube head can be interchanged Fuses of the AutoSetTimer Ref n AutoSet 115 V AutoSet 230 V 6 3 AT 5x20 4AT 5x20 6 3 AT 5x20 4AT 5x20 315 mAT 5x20 315 mAT 5x20 80 mAT 5x20 50 mAT 5x20 3 1 12 Connecting the
8. Rectangular radiation field size 1 26 x1 65 3 2x4 2 cm 2 4 AutoSet Timer Supply Voltage 110 120 for type 93 300 60200 220 240 for type 93 300 60100 18 steps from 0 06 s to 3 2 s R10 scale 10 06 012 025 050 10 20 Time in seconds is converted to number of mains pulses with 1 pulse precision 20 ms at 50 Hz 16 6 ms at 60 Hz 0 02 s or 5 whichever the greater Automatic setting through tooth type selection and patient size for use with traditional film or Exposure factor setting digital sensor or manual setting moving up or down the scale with plus and minus keys Irradiation signal Yellow light on hand switch and on control oanel plus acoustic buzzer Hand switch Hand switch with 3 m coiled cord with remote mounting optional kit 6 15 cm width 9 1 2 24 cm height A 172 9 cm depth Other features Microprocessor controlled tunctionality Traditional film speed setting Digital sensor speed setting Zero crossing power switching 3 s minimum waiting time Energy management for cool down time Optional kit with 33 ft 10 m cable for remote mounting V 5 03 69 500 00210 11 56 BLUEX IntraOs 70 Service amp Installation Manual 2 5 Mechanical Suspension System 4 72 12 cm width 9 45 24cm height 3 54 9 cm depth Support Arm Short 11 8 30 cm medium 33 6 60 crn 54 3 138 cm with short support arm Useful Reach 66 1 168 cm with medium support arm
9. ZA 188 cm with long support arm Mobile Stand 29 74 cm width 24 V 62 cm depth 42 107 cm height 65 165 cm total height with arm 2 6 Weights Round BLD O Medium Ext 8 y Q Y Y DS N gt e o O O O O O OOO DA gt Le CO e Dm 00 mn Y al o ol N OI So l L O k AIN 00 O O SIN w eolo 0 O Wall Adaptor Mobile Stand VIN Plo CO I O O mb N F 9 4 ko 12 56 69 500 00210 V 5 03 IntraOs 70 Service amp Installation Manual BLUEX 3 ASSEMBLY AND INSTALLATION 3 1 Wall Mounted Systems 3 1 1 Unpacking Unpack the components of the system and check the following A Each item is in good conditions and was not damaged during transportation B All the items for the desired system configuration are available C The line voltage on the labels of timer and tube head are corresponding to the existing local line voltage Tube Housing Assembly arm Beam Limiting Device Extension Wall q Arm Support Timer and manuals V 5 03 69 500 00210 13 56 BLUEX IntraOs 70 Service amp Installation Manual 3 1 2 Structural Requirements The wall adaptor has to be mounted in a convenient position on left or right side of the chair or on back wall head of the patient The maximum useful reach 1s of 74 188 cm from the wall when combining a 31 5 80 cm support arm with a arm The wall adaptor
10. could be emitted o O Q Q AutoSet 69 500 00210 39 56 BLUEX IntraOs 70 Service amp Installation Manual 5 MEASUREMENTS All measurements to be done with the equipment supplied at nominal line voltage with specified line resistance see section 2 1 at page 10 The tolerances on the measured values have to take into account the precision of the each measurement instrument Measurements have to be done by trained personnel only to avoid the risk of electrical shock 5 1 Line Voltage The Line voltage can be measured using a Volt Meter for Alternate Current within the proper range service function can be activated on the AutoSet timer to display the current line voltage in V and frequency In Hz see section 4 8 of this Manual 5 2 Anode Voltage KVp The kVp level is the actual peak value of the Anode voltage which stabilizes once the preheating time of the filament has elapsed in about 0 2 s and the high voltage transformer ts actually loaded The kVp level can be measured with a non invasive kVp meter placed in front of the BLD following the instructions in the user manual of the instrument A correct measure can be done with an exposure time of 500 ms or more having introduced a delay of the reading instrument of about 300 ms to allow the voltage level to stabilize after the pre heating time has elapsed 5 3 Anode Current mA WARNING To prevent high voltage shock make sure the system 1s d
11. is then placed on the same common bolt and blocked second with lock washer and nut D Connect the grounding wire for the timer to the ground provision on the terminal block of the timer and the two line wires of the power cord to the input points of the terminal block of the timer 48409488 Ay gt UN L Pe POWER SUPPLY ES CORD BONDING 2 CONDUCTOR 3 3 8 Connecting the Timer For the connection of the output cable to the timer please refer to section 3 1 10 at page 23 3 3 9 Activation of Fuse 2 Units provided with supply cord and plug must be equipped with fuses on both line phases The activation on the second A fuse 1s done by cutting the Jumper Fuse 2 zero Ohm resistor close to Fuse F2 See position on layout in section 3 2 1 at page 28 3 3 10 Mounting and Connecting the Tube Head Refer to section 3 1 14 at page 24 3 3 11 Mounting the Beam Limiting Device Refer to section 3 1 15 at page 26 3 3 12 Final Tuning and Set Up Refer to section 3 1 16 at page 26 32 56 69 500 00210 V 5 03 IntraOs 70 Service amp Installation Manual BLUEX 4 MAINTENANCE Here in the following the list of recommended maintenance actions to keep the IntraOs 70 system in compliance with the Performance Standard It 1s the responsibility of the User to maintain the equipment in compliance with the standard Failure of the User to properly maintain the equipment may relieve the Manufacturer
12. m 40 EXPOSUTS KTT 41 o Ae Fe E ee 42 EAT Resistance eritema 42 Earth L nka66 uu uu uuu sssapasqawasqawassqawsasawasasayapaawpaastaspaqmkuwasa 43 69 500 00210 V 5 03 IntraOs 70 Service amp Installation Manual BLUEX 6 SRARE PAR IP usa PP ita 44 Ot ui TL DE 44 O eT OP Mies 45 60 5 AA 46 64 Wal Adaptor 47 09 Te s E e 48 00 AT ee enee 49 Appendix A System Components 50 Appendix B cons 51 APPEndix E ADO b anio 52 Appendix D Alarm Conditions 53 Appendix E Identification Labels 54 APpendix DOO NS Ci v uu ux susan EE 55 V 5 03 69 500 00210 7 56 BLUEX IntraOs 70 Service amp Installation Manual 1 INTRODUCTION 1 1 Purpose The IntraOs 70 X ray Equipment is design to fulfill the needs for Intra oral radiography in the general dental practice The systems can be configured for wall or mobile solutions The available features make the use simple and grant long life with minimum maintenance requirements The Operator s Manual and the Service and Installation Manuals supplied with the
13. supply the timer itself and to make available power for the X ray head at the output terminals OUT upon request by the operator via the hand switch Power to the X ray head 1s thus controlled by the timer acting as a SWITCH SWITCH IN ELECTRONIC WALL TIMER SUPPORT The cables 2 poles plus ground to connect the power line to the timer and the timer to the wall adaptor are not provided Cables with large section conductors have minimum electrical resistance and voltage drop Wire Type Cross Section Area m 0 05 Ohm AWG14 208mm 0 00829Ohmm 60m AWG 12 3 31mm 0 00521 Ohm m The resistance between the ground provision in the connecting block of the timer and the metal body of the tube housing assembly has not to exceed 0 1 Ohm Proper section of the yellow green wire to A be used In case remote mounting of the timer The wall adaptor is provided with a common bolt for bonding and grounding blocked in place with a nut which has not to be removed The grounding conductors to be connected as indicated below e First the conductor to ground provision in the connecting block of the timer flat washer ground provision flat washer lock washer nut e Second the bonding conductor of support arm plus in case the one of the cable in the arm flat washer bonding conductors flat washer lock washer nut 16 56 69 500 00210 V 5 03 IntraOs 70 Service amp Installation Manual BLUEX LOCK W
14. system are integral part of the product The original language of the Operator s Manual is English 1 2 Equipment Classification e JEC IntraOs 70 is a Class I type B equipment e FDA IntraOs 60 is a Class II medical device equipment 21 CFR 872 1800 1 3 Applicable Standards The IntraOs 70 system configurations equipped with the AutoSet timer comply with the following standards IEC 601 1 General requirements for safet IEC 601 1 2 Electromagnetic compatibilit General requirements for radiation protection in Particular requirements for the safety of high voltage generators of diagnostic X ray generators Particular requirements for the safety of X ray source IEC 601 2 28 assemblies and X ray tube assemblies for medical diagnosis 1 4 Environmental Data Applicable ranges of temperature humidity and atmospheric pressure are reported here below both for operation and transport conditions O Ambient Transport amp Storage from 10 to 40 C from 20 to 50 C Relative Humidit from 30 to 75 10 to 90 from 700 to 1060 hPa from 500 to 1060 hPa 8 56 69 500 00210 V 5 03 IntraOs 70 Service amp Installation Manual BLUEX 1 5 Obligations of the Installer Obligations of the Installer are e To make sure that the line voltage specified by the Manufacturer of the equipment is available and within the specified range e For safety reasons verify that a proper switch 19 available to disconnect from line
15. the ground wire as first conductor on the common bolt for bonding and grounding block with washers and nut E Place the phase and neutral wires to the connecting block F Connect to the common 7 PRI BOLT FOR BONDING AND GROUNDING 2 LO x i e S C te Wie saiz A ped I AN SUPPLY CABLE m 281 TOTUBEHEAD Ce U h e Date Ge YELLOW GREEN GROUND PROVISION bolt for bonding and TO TIMER grounding the bonding MOSS conductor of the support BONDING CONDUCTOR arm and the one of the OF EXTENSION ARM cable of the scissor arm pome G Connect the phase and BONDING CONDUCTOR neutral conductors of the OF ARM supply cable in the scissor arm to the connecting SUPPLY CABLE block FROM REMOTE TIMER d TO TUBE HEAD H See section 3 1 3 Electrical Requirements at page 16 CONNECTIONS IN THE to determine cable length REMOTE TIMER and maximum distance O Oo pa i Nepi SS CONNECTING BLOCK x SCH IN THE TIMER y SE Jet de JO lt ANI Pcs L a MAINS SUPPLY INPUT TO TIMER TA 1 SUPPLY CABLE FROM REMOTE TIMER TO TUBE HEAD 22 56 69 500 00210 V 5 03 IntraOs 70 Service amp Installation Manual BLUEX 3 1 11 Connecting the Timer A Turn off the line voltage supply line 6 HAND SWITCH CONNECTION JUMPERS LST L EA LL E gt CH 4 lt lt y gt o y 2 rs lt lt HAND SWITCH l 143 SOCKET TST2
16. voltage supply when needed during installation e Install and test the equipment with due diligence according to the installation instructions from the Manufacturer e To provide the Operator s Manual to the User 1 6 Warning X ray equipment produce ionizing radiation that may be harmful if not properly controlled It 1s therefore recommended that the equipment be operated by trained personnel only in accordance with existing law Even 1f compliant to specifications of electromagnetic compatibility 1t 1s recommended not to use the equipment in presence of external electromagnetic fields such as those generated by cellular phones which might interfere with the electronic circuits of the system 1 7 Demonstration In order to use of the system for demonstration purposes radiation A emission has to be inhibited by disconnecting the supply cables to the tube head into the wall adaptor or into the timer Cables to be disconnected are those leaving the connection block towards the tube head out connections on the connecting block Make sure that the disconnected cables are properly insulated to prevent undesired contacts with live points This task has to be done by trained personnel only to avoid the risk of electrical shock DISCONNECT HERE SWITCH _ IN OUT ELECTRONIC WALL TIMER SUPPORT A V 5 03 69 500 00210 9 56 BLUEX IntraOs 70 Service amp Installation Manual 2 TECHNICAL DATA 2 1 Syste
17. A 115V HANDSWITCH Y JUMPERS e E FUSE 18 FUSE2 PY T4A 230V T6 3A 115V E h F k INPUT MAINS LINE OUTPUT NEUTRAL LINE TO amp LIVE TUBEHEAD HANDSWITCH SOCKETS V 5 03 69 500 00210 3 56 BLUEX IntraOs 70 Service amp Installation Manual SWITCH IN OUT ELECTRONIC WALL TIMER SUPPORT Electrical requirements see section 3 1 3 at page 16 HAND SWITCH CONNECTION JUMPERS HAND SWITCH N SOCKET TST2 ns ai HAND SwWITCH i SOCKET TST1 LIP Z Se A To connect the timer see section 3 1 11 at page 23 4 56 69 500 00210 V 5 03 IntraOs 70 Service amp Installation Manual BLUEX C 0051 Blue X Imaging S r l Via Mario Idiomi 1 8 33 20090 Assago ITALY tel 39 0245712171 fax 39 0245703385 e mail bluex bluex it www bluex it IntraOs 70 Dental X ray Equipment Service amp Installation Manual English Edition Version 5 03 February 2010 Printed 2 2 2010 3 14 00 PM Code 69 500 00210 Blue X Imaging is committed to Total Quality Thank you for notifying us any error found in the document V 5 03 69 500 00210 5 56 BLUEX IntraOs 70 Service amp Installation Manual Table of Contents INTRODUCTION 8 8 Equipment Classtification 8 Applicable Standards 0nnnnsnnnnsoenneseensseenssseessseersseesssserssseesss
18. ASHER COMMON BOLT TT FLAT WASHER BONDING tall eg BONDING CONDUCTOR CONDUCTOR OF OF ARM EXTENSION ARM IN CASE G nnn GROUND PROVISION T TT FLAT WASHER TO HEH eee L LOCK WASHER BLOCKING NUT FLAT WASHER DO NOT REMOVE TT FLAT WASHER METAL BODY OF WALL SUPPORT 3 1 4 Mounting and Connecting Sequence A riMount the Wall Adaptor B riMount the Timer C c Mount the Support Arm D Mount the Arm E Connect the Wall Support F Connect the Timer G Connect the Hand Switch H Optional Remote hand S witch I riMount and connect the Tube head J Mount the Beam Limiting Device K Final Tuning and Set Up V 5 03 69 500 00210 17 56 BLUEX IntraOs 70 Service amp Installation Manual 3 1 5 Mounting the Wall Adaptor A Take away the plastic cover removing the screws under the loeo label B Use the Wall Support plate or a template to mark the holes on the wall Please note that the timer can be mounted close to the Wall Support on the right side or in a remote position Cabling should have been laid out accordingly C Make the holes in the wall according to the applicable type of mounting with two four bolts or six bolts with or without reinforcing plate D Slide the logo strip out from the plastic cover to access the screws and remove it from the metal frame E Mount the metal frame on the wall using proper heavy duty metal anchors and make sure that the power cable enters from behind YA
19. G THE SPRINGS IN THE ARM MAY CAUSE INJURY TO THE INSTALLER AS WELL AS DAMAGE TO THE ARM ITSELF IF NOT HANDLED PROPERLY DO NOT REMOVE BINDING STRING UNTIL WHEN NECESSARY A Light grease the shaft at the base of the arm and make sure the ring spacer 1s in place push back the cylinder of the friction into the support arm not to interfere during the insertion of the shaft B Secure the trailing rope to the end of the electrical cable of the Scissor Arm C Pull the other end of the trailing rope to drive the electrical cable of the Scissor Arm through the Support Arm out into the Wall Adaptor D Hold the opening section of the Scissor Arm carefully remove the safety string and allow the arm to open slowly away from people SAFETY STRING 7 E Perform final set up complying with recommended sequence of actions reported In the following CONNECT TO TIMER WARNING IRRADIATION DEVICE LA Der NEVER CONNECT DIRECTLY TO MAINS 20 56 69 500 00210 V 5 03 IntraOs 70 Service amp Installation Manual BLUEX 3 1 9 Connecting the Wall Adaptor with Timer at side Da Br ii L 0 RE r MAINS LINE Sch A E d a5 app B a BS INPUTTO Ew 9 E S 2 ein TIMER K r a YELLOW GREEN SUPPLY CABLE NO OUTPUT TO TUBE HEAD CONDUCTOR OF EXTENSION ARM SUPPLY CABLE FROM TIMER TO TUBE HEAD Rtl e Le m f RS y y a me RE
20. Hand Switch A The hand switch is provided with a 3 m coiled cord to be plugged one side In the hand switch the other side In the lower left corner of the timer s board either externally connector TST1 or internally to the timer connector TST2 Internal connection is for remote hand switch or for additional control safety switches B Jumpers are available to activate properly the hand switch connection a Position ISTI to enable external socketTST1 b Position TST2 to enable the internal socket TST2 c Position TST1 2 f to enable the internal and the external sockets 3 1 13 Optional Remote Hand Switch The connection of the wires 1s here indicated The wires of the switch are number 3 and 4 those in the middle of the connector The hand switch can be remotely mounted by making use of the optional kit made of a remote box wall holder and connection cable e The wall holder remote box has a hook to hold the hand switch and a plug to connect the coiled cable e A cable 10 m long is provided with a plug on one side to connect to the socket on the timer and free wires on the other side 24 56 69 500 00210 V 5 03 IntraOs 70 Service amp Installation Manual BLUEX 3 1 14 Mounting and Connecting the X ray Head HANDGRIP ii x AO oe PIPE e handgrip pipe from the arm and place it a onto the tube head shaft of the coupling yoke 1 y B Lubricate the shaft insert it into the arm x passing the ca
21. RATOR UNLESS SAFE EXPOSURE FACTORS AND OPERATING INSTRUCTIONS ARE YX AutoSet Timer OBESERVED ELECTRICAL SHOCK AN 0 06 3 2 HAZARD DO NOT REMOVE PANELS 3 258 RISK OF EXPLOSION DO NOT USE IN Round BLD Type 9130000020 UI 1 EEL SN 2412BR0012 U LO Bmanufactured by lue X Imaging S r l Assago Italy i PRESENCE OF FLAMMABLE ANESTHE E TICS FOR CONTINUED PROTECTION 5 gt IO SSD 21 cm Beam Size 6 cm AGAINST RISK OF FIRE REPLACE z III ONLY WITH SAME TYPE AND RATING S SN 2402AA0199 COMPLIES WITH DHHS FUSE IF UNO 0 ian se COMPLIES WITH DHHS PERFORMANCE u lt 2 220 240 V 50 60 Hz STANDARD 21 CFR SUBCHAPTER J Ska Ea Fuse T 44 MANUFACTURED DECEMBER 2007 AR AutoSet Timer 0 06 3 2 s MANUFACTURED DECEMBER 2008 Type 9330060200 IIIIIIII RIIT SN 2402AB0199 ONT RIIT 110 120V 50 60 Hz Fuse T 6 3 A Mobile Stand SECUREARM FOR TRANSPORT CHIUDERE PER TRASPORTO TYPE 9315020080 SIRONA 62 80 312 FERMER POUR TRANSPORT SN 2310GB0022 CI RRESE PARA TRANSPORTE III ARM ZUM TRANSPORT SICHERN 2 E 2 lt o o lt BLUE X IMAGING VIA IDIOMI 1 8 33 ASSAGO ITALY a DE 22 gz O se 2 u lt gt m 54 56 69 500 00210 V 5 03 IntraOs 70 Service amp Installation Manual BLUEX Appendix F Cooling Curves COOLING CURVE OF X RAY INSERT kJ 5 4 3 2 1 0 0 0 5 1 1 5 2 2 0 3 3 0 4 4 5 5 Tempo min
22. RY Power Control Board 230V AutoSet FW 76 190 25510 Power Control Board 115V AutoSet FW 76 190 25511 Logo Strip IntraOs 70 76190 25210 A RA Fuse F1 F2 T5A 250V 5x20 set of 10 76 190 25640 115 V Fuse F1 F2 T8A 250V 6 3X32 set of 10 76 190 25641 J2 Fuse F3 F4 T200 mA 250 V 5x20 set of 10 76 190 25630 Figure AU V 5 03 69 500 00210 49 56 IntraOs 70 Service amp Installation Manual BLUEX Appendix A System Components IntraOs 70 Intraoral X ray System Article Wall Adaptor Support Arm 30 cm Support Arm 60 cm Support Arm 80 cm Scissor Arm Tube Head 120 V G120N Tube Head 230V G230N Round BLD Rectangular BLD AutoSet Timer 115 VAC AutoSet Timer 230 VAC Mobile Stand Mobile Stand UL CSA Wall Plate 16 50 56 Type Code 93 100 11000 93 150 17100 93 150 17200 93 150 17300 93 150 12010 93 202 01300 93 202 01700 91 300 00020 91 300 00040 93 300 60200 93 300 60100 93 150 20080 93 150 20090 86 100 11500 69 500 00210 IntraOs 70 Service amp Installation Manual gt Oso O O P w V 5 03 Appendix B IEC Type B Equipment X ray On Irradiation Examine Annexed Documentation Increase Exposure Time one step Decrease Exposure Time one step Child Small Patient Adult Large patient Upper Incisor Upper Canine Premolar Upper Molar Lower Incisor Lower Canine Premolar Lower Molar Bite Wing Interproximal Digital Receptor Radiogr
23. aphy Push Button lonizing Radiation Icons z O G A l le z DI el m lt 69 500 00210 BLUEX Compliance to European Community Requirements Compliance to Canadian and US Standards Line voltage supply On System Ready Off Disconnected from Line voltage Supply On Connected to Line voltage Supply Alternate Current Fuse Protective Earth Neutral Point for equipment permanent connected to line Live Point for equipment permanent connected to line Innerent Filtration Focal Spot Fragile Handle With Care Fear of Humidity Up Do Not Overturn Stacking Limit Separate Collection Do Not Dispose 51 56 BLUEX IntraOs 70 Service amp Installation Manual Appendix C Exposure Table IntraOs 70 70 kVp 7 mA Exposure Times in s Small A ii 5 Patient Focus Film Distance 23 cm il Digital Large Patient 220 250 200 zeo 125 LT 064 050 04 so 200 250 125 100 080 064 050 040 03 Upper i Molar Upper 1 25 1 001 0 80 0 64 0 40 0 32 0 25 0 20 0 16 Premolar Canine TRR 064 090 0 os oz 030050 a Bue wing a a o ve on 0 B A rep O wesch N Ol ni o O A CO O la O N O on O A LS O la GA N la N o o lolo N Cu o Q KM Lower Molar Lower Premolar Canine Incisor Small Patient Large Patient 52 56 69 500 00210 V 5 03 Ki N O gt O esch N sch O E O
24. as Ze a as e BACK UP TIMER SIE Segen TEST POINT amp LED WILL P MICROPROCESSOR Z SERS E ii WATCH DOG LED AAN y m RA TNT POWER SUPPLY 24 V LED 6 ERE Ba Ee T50mA 230V T80MA 115V HANDSWITCH x Y JUMPERS ee AO FUSE 1 amp FUSE 2 wi T4A 230V T6 3A 115V Ei E amp INPUT MAINS LINE OUTPUT NEUTRAL LINE TO amp LIVE TUBEHEAD U HAN DSWITCH SOCKETS 28 56 69 500 00210 V 5 03 IntraOs 70 Service amp Installation Manual BLUEX 3 3 Mobile Systems 3 3 1 Unpacking Unpack the components of the system and check the following A Each item is in good conditions and was not damaged during transportation B All the items for the desired system configuration are available C The line voltage on the labels of timer and tube head are corresponding to the existing local line voltage arm Tube Housing Beam Assembly Limiting Device Timer and manuals Mounting Weels hardware Post Legs Caps for legs V 5 03 69 500 00210 29 56 BLUEX IntraOs 70 Service amp Installation Manual 3 3 2 Room Preparation Make sure that a wall socket 1s available close to the dental chair in reach of the mobile X ray equipment to be connected Such a socket has to be provided with a connection to the protective grounding Due to different standards for different countries the line voltage cable of the mobile system may be supplied without plug
25. bles x Into the coupline FORK x yoke then hold it in place with the 3 retaining fork COUPLING C Attach the connectors of the supply and grounding wires and push them into the side opening of the coupling yoke D Pull down the O ring and push up the handerip pipe then fix it in place with the screw at bottom E Verify smooth movement of the tube head around its vertical and horizontal axis Tune side friction 1f necessary referring to section 4 4 Maintenance of at page 37 for details F Mount the cover on the yoke opening eventually V 5 03 69 500 00210 25 56 BLUEX IntraOs 70 Service amp Installation Manual 3 1 15 Mounting the Beam Limiting Device A Mount the beam limiting device on the tube head and lock it close with a clock wise rotation 3 1 16 Final Tuning and Set Up A Remove the line voltage fuse s from the timer Fuse 1 and Fuse 2 B Tune friction screw in Wall Adaptor for rotation of Support Arm see section 4 1 Maintenance of Wall at page 34 for details C Tune friction screw in Support Arm for rotation of Scissor Arm around it vertical axis see section 4 2 Maintenance of Support Arm at page 34 D The friction points in the scissor arm and those for the rotation of the tube head around its horizontal axis are tuned In factory Should you need to repeat the procedures refer to sections 4 3 Maintenance of Scissor Arm at page 35 and 4 4 Maintenance of at page 37 respectively E Make
26. bs or 204 kg In case the wall is not in condition to withstand the indicated load corrective actions can be evaluated by adoption of reinforcing plates D Large plate to fit vertical supports at 16 distance with 4 mounting holes and one cable opening for the wall mount in the middle 14 56 69 500 00210 V 5 03 APA af a ES w h i a UN Su hi E x a o pr gar K qe e CS T r E Gel me 2 Di gr IntraOs 70 Service amp Installation Manual BLUEX E In case of a thin wooden wall not solid enough the use of a steel counter plate 2 mm thick can be the solution Make sure that the wall is solid enough to carry the load F The use of two reinforcing steel plates of about 4 times the surface of the wall adaptor one by each side of the wall can help when a single plate looks not adequate additional bolts have to be used to hold together the two plates Make sure that the wall is solid enough to carry the load Recommended Bolts M84425 808 8 M t IS088 ___392 O INSUFFICIENT WALL OR HARDWARE STRENGHT MAY CAUSE THE WALL MOUNT TO PULL OUT FROM THE WALL AND THE FULL SYSTEM TO FALL ON TO THE PATIENT OR THE OPERATOR CAUSING INJURIES V 5 03 69 500 00210 15 56 BLUEX IntraOs 70 Service amp Installation Manual 3 1 3 Electrical Requirements The power line cable must be connected to the Input terminals IN of the timer to
27. can be mounted with 2 4 or 6 bolts depending on wall quality A Two bolts only top and bottom central 2 holes T2 B2 are used when there isa 2 solid slim column e g iron mounting C with weak sides e g wooden wall Considering the requested safety factor the top bolt has to withstand a load of 6000 N comprehensive of a safety factor 1 e about 1350 lbs or 612 kg Proper screw to be selected for a solid connection to the wall Classes ISO 8 8 M 8 M 8x1 M 8x1 25 or SAE Grade 5 5 16 18UNC 5 16 24 UNF are recommended B Four bolts two on top sides T1 T3 and two on bottom sides B 1 B3 1s the regular mounting for solid concrete wall but also on large metal plate Considering the requested safety factor each bolt at top has to withstand a load of 3000 N comprehensive of a safety factor E s io EE i e about 675 lbs or 306 kg ee Proper expansion screw to be selected for a solid connection to the concrete wall the permissible load of each screw has to be greater than 308 lbs about 140 kg On solid concrete use heavy duty metal anchors On hollow bricks use injection chemical fixing C Six bolts three on top T1 T2 T3 and three at bottom B1 B2 B3 are required when the wall is not solid enough and the load has to be distributed on more points Considering the requested safety factor each bolt at top has to withstand a load of 2000 N comprehensive of a safety factor 1 e about 450 I
28. e time can also be measured after having connected a precision resistor of 1000 Ohm between points Al and A2 on the small circuit board on the back of the tube head by monitoring the voltage across it tube current with an oscilloscope and counting the number of pulses in the time interval as per above definition When the function to correct the effects of line fluctuations on the emitted X ray dose Is activated the exposure time 1s corrected in order to assure dose consistency When the actual line voltage 1s lower than the nominal line voltage the actual exposure time 1s increased Conversely when the actual line voltage 1s higher than the nominal line voltage the actual exposure time 1s decreased Do disable this correction function dip switch number 1 of SW2 moved to OFF position to verify exposure time accuracy V 5 03 69 500 00210 41 56 BLUEX IntraOs 70 Service amp Installation Manual 5 5 Leakage Radiation The value of leakage radiation of the X ray tube assembly is measured at m distance taking into account the energy provided in 1 hour In case the measurement is performed at a distance different from 1 m the value has to be properly corrected The applicable technique factors for IntraOs 70 are of 70 kV and 7 mA The point of maximum leakage has to be considered excluding the direction of the primary beam The duty cycle factor as reported in sections 2 2 Tube Housing Assemblies at page 10 has also to be ta
29. et of 8 plastic covers FA Friction kit FA with 4 cup springs 20x10x0 8 Handorip pipe with O rino Retaining fork Power cable 3 15 m with end stop tie 3 B D Figure FA V 5 03 69 500 00210 45 56 BLUEX IntraOs 70 Service amp Installation Manual 6 3 Support Arm 93 150 17100 30 cm 93 150 17200 60 cm 93 150 17300 80 cm List of Spare Parts Figure EA H Lage Ring SpacerD35_____________ 76 190 25470_ D SetofcapsFA 76 500 30045 Friction kit EA MB with 15 disk springs 10x5x0 4 76 500 30030 Figure EA 46 56 69 500 00210 V 5 03 IntraOs 70 Service amp Installation Manual BLUEX 6 4 Wall Adaptor 93 100 11000 List of Spare Parts Figure WS B D Figure WS V 5 03 69 500 00210 47 56 BLUEX IntraOs 70 Service amp Installation Manual 6 5 Mobile Stand 93 150 20080 93 150 20090 List of Spare Parts Figure MB Description Code A Transport Handle set of 2 76 500 30055 Strain Relief 76 190 25300 C Cable holder 76 500 30120 Wheel spacer and adaptor set of 2 76 500 30065 E Wheel with Brake spacer and adaptor set of 2 76 500 30090 Friction kit EA MB with 15 disk springs 10x5x0 4 Figure MB 48 56 69 500 00210 V 5 03 IntraOs 70 Service amp Installation Manual BLUEX 6 6 AutoSet Timer 93 300 60200 115 V 93 300 60100 230 V List of Spare Parts Figure TP Item Code A 76 190 25220 B _ Mounting Plate S 76190 25230 _ p K
30. ication data is in place and is readable 36 56 69 500 00210 V 5 03 IntraOs 70 Service amp Installation Manual BLUEX 4 4 Maintenance of X ray Head HOLDING SCREW BLOCKED POSITION OF 8 DISK SPRINGS IN FRICTION SCREW 4 GROUPS OF 2 A Inspect for damage wear to the X ray tube head and support system B Inspect for oil leakage Replace tube head if necessary C Check for position stability If necessary remove the cap on the yoke side tune the three friction screws with disk springs to be moderately tight for smooth rotation The fourth one without disk springs must be blocked in place D Check that electrical cables are correctly twisted and not damaged or worn down E Verify that the technical label with identification data is in place and is readable F Dismount the tube head from the arm and lubricate the pin for smooth rotation p We Z DS Warning remove the tube head with the x arm completely open to avoid the risk of injuries G Check the retaining clip and replace if Y worn down Do not mount the tube head until all checks of the suspension system are completed V 5 03 69 500 00210 37 96 BLUEX IntraOs 70 Service amp Installation Manual 4 5 Maintenance of Beam Limiting Device A Verify that the collimator is properly mounted and firmly closed B Verify that the internal cone is not damaged Replace the collimator if necessary C Verify that the technical label with identificatio
31. inhibited off and on again Power switching Red lamp Alarm System By switching system device failure switched on inhibited off and on again Line dips during Red lamp Alarm Exposure By acknowledgement exposure switched on inhibited on the panel By acknowledgement on the panel V 5 03 69 500 00210 53 56 BLUEX IntraOs 70 Service amp Installation Manual Appendix E Identification Labels BLUEX IntraOs 70 70 kVp 7 mA k A GO E ce A037400 0051 230 V 50 60 Hz 4A TUBE OCX 70 G i 2 5AI70 NH 0 8 CEI BOLOGNA ITALY BLUEX IntraOs 70 70 kVp 7 mA KAZ ee 0051 120 V 50 60 Hz 6A TUBE OCX 70 G He 25 AV70 m 0 8 CE BOLOGNA ITALY TYPE 9320201300 SN 2412TR0001 MANUFACTURED DECEMBER 2008 N COMPLIES WITH DHHS PERFORMANCE y STANDARD 21 CFR SUBCHAPER J BLUE X IMAGING SRL VIA IDIOM 1 8 33 _ ASSAGO ITALY TYPE 9320201700 SN 2412TQ0001 MANUFACTURED DECEMBER 2008 BLUE X IMAGING SRL VIA IDIOMI 1 8 33 Scissor Arm ASSAGO ITALY Type 9315012010 D DUR SN 2412GM0001 DONON AOAI OUIAN A BLUE X IMAGING ASSAGO ITALY VIA IDIOMI 1 8 33 Support Arm 60 TYPE 9315017200 SIRONA 62 80 239 SN 2412600001 00081 BLUE X IMAGING VIA IDIOMI 1 8 33 ASSAGO ITALY Wall Adaptor Type 9310011000 AERIAN MORO 00001 00101 SN 2412WS00001 0000000080 000010011 BLUE X IMAGING VIA IDIOMI 1 8 33 ASSAGO ITALY WARNING THIS X RAY UNIT MAY BE DANGEROUS TO THE PATIENT AND OPE
32. isconnected from the power supply when connections to the measurement points are performed Electric discharge might occur in case of improper operation The Anode current in mA is the actual average value of the tube current which raises when the filament has warmed up after the pre heating time has elapsed Remove the back cover of the tube head disconnect the jumper A1 A2 and replace it with a precision resistor of 1000 Ohm The anode current can be read with a DC voltmeter connected to points Al and A2 with the V corresponding to 1 mA After the measurement disconnect the 1000 Ohm resistor and put back the jumper 40 56 69 500 00210 V 5 03 IntraOs 70 Service amp Installation Manual BLUEX 5 4 Exposure Time The actual exposure loading time is determined as the time interval between the instant when the tube current first rises above the 25 of its maximum value and the instant when tt finally falls below the same value In order to assure the requested exposure time irradiation the pre heating time of the insert used which has been set up at installation 19 taken into consideration The actual switch on time SOT of the tube head assembly 1s therefore the sum of the filament pre heating time PHT and of the requested exposure time RET SOT PHT RET The measurement of the exposure time can be done with kVp amp Time meters with the ability to trigger at 75 of maximum KV level Exposur
33. ken into account for the computation of the actual dose rate In case for example a measure 1s done at 50 cm distance from the source with an exposure of 1 s the following computations have to be pertormed e A duty cycle of 1 15 means maximum of 1 s exposure every 15 s 1 e 240 s per hour e Dose at 100 cm is computed taking into account the inverse square law 1 e at twice the distance the dose intensity 1s reduced to one quarter D1h100cm D1s50cm 240 50 100 D1s50cm 60 where D1s50cm is the dose measured at 50 cm with 1 s exposure and DIh100cm is the dose computed at 1 m distance for the energy of hour 9 6 Earth Resistance The measurement of the earth resistance to be done after having disconnected the system for the power supply line Using a voltage generator of not more than 6 V 50 60 Hz a current of 25 A is applied from 5 s to 10 s through the earth terminal in the connecting block of the timer to any metal part which can be in touch to the patient operator applied part The voltage drop 1s then measured and the earth resistance computed The system complies for values up to 0 1 2 extended to 0 2 2 in case of supply cord like in the case of a mobile system 42 56 69 500 00210 V 5 03 IntraOs 70 Service amp Installation Manual BLUEX 5 7 Earth Leakage Connect the Timer to the L measuring circuit as shown in the figure R1 10 kQ 5 R2 1 kQ 1 C1 0 015 uF 5 N A Set the input
34. m Supply Line Voltage 115 V from 99 V to 132 V in sub ranges depending on THA mounted Line Voltage Limited to the working range of the THA Working Range 108 132 V for 93 202 01300 207 253 V for 93 202 01700 Line Fuse Slow Blow 6 3 A at 115 V 4 A at 230 V second fuse to be activated in case of two ohases supply or mobile unit 50 60 Hz 2 Hz lt 0 4 Ohm at 115 V lt 0 8 Ohm at 230 V 2 2 Tube Housing Assemblies Line Voltage 230 V for type 93 202 01700 Line Current 4 A at 230 V for type 93 202 01700 Line Voltage 120 V 10 for type 93 202 01300 Working Range 230 V 10 for type 93 202 01700 Anode Voltage 70 kVp 8 at nominal line voltage peak tube 66 kVp 8 at nominal line voltage 10 Potential 74 kVp 8 at nominal line voltage 10 Anode Current 7 0 mA 15 at at nominal line voltage tube current 5 3 mA 15 at nominal line voltage 10 8 3 MA 15 at nominal line voltage 10 Maximum Load 70kVp 7 mA 3 2 s Anode Material Anode Angle 9 to the tube axis X ray Insert 3 electrodes grid control action models OCX 70 G RFG070 1 O 10 56 69 500 00210 V 5 03 IntraOs 70 Service amp Installation Manual BLUEX 2 3 Beam Limiting Device Metal cone with near focus section Round BLD Focus skin distance FSD 8 27 21 cm Circular radiation field size 2 35 diameter 6 cm Metal body with near focus section Rectangular BLD Focus skin distance FSD 8 27 21 cm
35. n data is in place and is readable 4 6 Maintenance of Timer A Inspect the panel for damages on the surface B Inspect the cable of the exposure switch for wear C Check that all lights except the yellow one are working when the system is switched on D Perform a Functional Check as described in the Operator s Manual This check includes verification of a proper setting of technique factor b proper setting of anode current c yellow light d buzzer e alarm A07 for Exposure push button pressed at power on e alarm AUS for Exposure stopped by the operator E Verify that the fuses used mounted comply with those listed below F Verify that the technical label with identification data is in place and is readable x Fuse S 47 Checking Filament Pre Heating Time During the life of the system the wearing down of the filament may result In a different pre heating time PHT The value set at installation needs therefore to be verified and in case corrected A Ata fixed distance measure the X ray dose for exposure of 2 0 s nominal irradiation of 100 pulses at 50 Hz 120 at 60 Hz B At same distance measure the dose for exposure of 0 2 s nominal irradiation of 10 pulses at 50 Hz 12 at 60 Hz C If dose at 0 2 sis 1 10 of dose at 2 s the value set for PHT is fine D If dose at 0 2 s is lower than 1 10 of the dose at 2 s PHT has to be increased Proceed at steps of 20 ms until fine E If dose at 0 2 s is highe
36. n the socket set screw might lead to breaking the friction pins V 5 03 69 500 00210 35 56 BLUEX IntraOs 70 Service amp Installation Manual d Tune the springs using an allen key for even balancing with arm section In intermediate position e Tighten the two friction pins for little resistance to the movement and eventually tighten the socket set screw allen into the female friction pin to block male and female friction pins together C Specifically for the scissor arm at least every 24 months in case of normal use or after every 5000 cycles performed have the service technician inspect for wear of pins and levers a Remove plastic covers on the joints b Check for wearing out of pin and levers starting from the joint at the base of the arm c Make sure no part is loose and no vibrations are occurring during movements d Apply silicon spray lubricant if needed e Replace the worn out parts or the arm itself 1f they appear damaged D To replace defective pins or levers a have the tube head disconnected with arm fully open to avoid injuries for sudden opening b Loosen completely the springs in the two sections of the arm before extracting pins or removing levers E Mount back the tube head if removed and secure it with the retaining fork F Slide partially out the scissor Arm from the Support Arm inspect for wear of the _ vertical Joint and lubricate for smooth rotation G Verify that the label with identif
37. r than 1 10 of the dose at 2 s PHT has to be reduced Proceed at steps of 20 ms until fine ha I u S TA fl 38 56 69 500 00210 V 5 03 IntraOs 70 Service amp Installation Manual BLUEX 4 8 A Digital Volt Meter This function allows the user to display the line voltage level and the line frequency alternating a B Test of Control Panel Special Service Functions Enter this function by switching the system on while pressing at the same time the the E and the Y keys Exit by switching the system off This function is intended to test S A lights buttons and segments of 70 kV 7mA numerical display on the control panel a Enter this function by C Firmware Version This function O returns the code of the version of e firmware loaded V 5 03 switching the system ON while pressing at the same time the the E and the adult n keys By pressing the or keys AutoSet all segments of the numerical display are scanned By pressing the X ray pushbutton ID the rA Y message IS displayed By pressing each button on the panel the corresponding lamp 19 turned ON a second pressure would turn 1t OFF At the last button pressed the system exit this function et e WARNING Do LA N e A not press the X ray pushbutton as L last button twice the second time the timer becomes active and radiation
38. seees 8 Environmental Data 8 Obligations of the Installer 9 ZARE 9 Demons OL asta EE iaia 9 TECHNICAL DATA 10 SV OI SOY oratoria 10 Tube Housing Assemblies ccccccccccssscceeesceceeneeeeeeeeseesanees 10 Beam Limiting Device 11 US AA A 11 Mechanical Suspension System 12 VE REA 12 ASSEMBLY ANDINSTALLATION 13 Wall Mounted Systems 13 MA WTOC ELO arsenales 27 OEI SV E 29 MAINTENANCE 33 Maintenance of Wall Adaptor 34 Maintenance of Support Arm 34 Maintenance of Scissor Arm 35 Maintenance of X ray Head 37 Maintenance of Beam Limiting Devitce 38 Marmtenance OL LIME aaron 38 Checking Filament Pre Heating Time 38 Special Service FUNCTIONS 39 MISMA 40 EMS VONS O dra io EE E EE 40 Anod Voltage A 40 Anode Current
39. supply voltage Vp equal to 110 of the nominal supply voltage B Connecta voltmeter Vx with 1 MOhm input impedance to the indicated points C Switch the Timer ON D Make two measures in Normal Conditions NC with S1 ON SS ON live and neutral conductors in normal condition S5 OFF swap of live and neutral conductors E Make two measures in Single Fault Condition SFC with S1 OFF R S5 ON live and neutral conductors in normal condition S5 OFF swap of live and neutral conductors Please note that 1V equals to 1mA Make sure values of leakage currents fall within the limits shown in the table below LIMIT OF EARTH LEAKAGE CURRENT Normal Single Fault Type Of Device Condition Condition S1 ON S1 OFF connected to line voltage 5 mA 10 mA Mobile X ray Equipment V 5 03 69 500 00210 43 56 BLUEX IntraOs 70 Service amp Installation Manual 6 SPARE PARTS 6 1 Tube Head 93 202 01300 G120N 120 V without BLD 93 202 01700 G230N 230 V without BLD List of Spare Parts Figure TH tem B Rectangular Beam Limiting Device__________ 91 300 00040 D__ Sidecapforcouplingyoke 76 190 25120 A 00000000 To F Figure TH 44 56 69 500 00210 V 5 03 IntraOs 70 Service amp Installation Manual BLUEX 6 2 Scissor Arm 93 150 12010 List of Spare Parts Figure FA Description Ring Spacer D28 FA S
40. sure the Timer switch is in the OFF position F Set the dip switches SW2 as indicated in the following to define a Enable disable correction of exposure factor to compensate fluctuations of line voltage b The nominal line voltage of the tube head see label c Set the pre heating time according to type of X ray insert used in the tube head assembly the measured value 19 marked in front of the tube head G Put back the line voltage fuse s H Put back all plastic covers and logo strips Connect the system to the line voltage by switching the general line voltage switch on and or plug the power cord into the wall socket J Switch the timer on The system is now ready for Functional Check as described in the Operator s Manual E H ki III Au 26 56 69 500 00210 V 5 03 IntraOs 70 Service amp Installation Manual BLUEX 3 2 Dip Switch Setting DIP AN DIP 8 RA E NOT USED TECHNIQUE FACTOR CORRECTION DIP 1 DIPS5 6 7 Technique Factor Correction Pre Heating Time SEH e LE gl mm man a a o REES gin WW Tee AA some Om come ef zone Hp Ee 20s ERER Dun Rg Um e ut V 5 03 69 500 00210 27 56 BLUEX IntraOs 70 Service amp Installation Manual 3 2 1 Layout POME Board Timer e A 8 L o e C s a das Ve KR AAEL fe FL fe TALARA D HHC i SUPPLY SET UP w KEYBOARD 5 V LED MICROSWITCHES ec CONNECTOR ASSAGO S K
41. the movements of the system GENEE il i GROUNDING B Verify for proper connection of O grounding wires to the common bolt C Check friction during rotation of Support Arm and adjust 1f needed D Verify that the technical label with identification data outside the plastic cover at bottom is in place and is readable 4 2 Maintenance of Support Arm A Slide partially out the support arm from wall mount inspect for wear of the joint and lubricate for smooth rotation POSITION OF 15 DISK SPRINGS IN FRICTION SCREW 5 GROUPS OF 3 B Check friction during rotation of Scissor Arm and adjust relevant screw 1f needed C Verify that the technical label with identification data is in place and is readable 34 56 69 500 00210 V 5 03 IntraOs 70 Service amp Installation Manual BLUEX 4 3 Maintenance of Scissor Arm FRICTION ue POINT 3 FRICTION Ke POINT 2 SPRING TUNING POINT SPRING FRICTION TUNING POINT 4 POINT F A Balance the arms 2 sections and tune frictions 4 points if needed in normal conditions with tube head mounted B To balance the scissor arm for each arm s section a Remove plastic covers on the joints b Reduce the friction at the 2 friction points by loosening the socket set screw allen into the female friction pin which 1s blocking male and female pins together then loosen them to reduce friction c WARNING Trying to loosen the friction pins without having loose
42. to be added matching the existing wall socket 3 3 3 Mounting and Connecting Sequence The recommended sequence to mount and connect system modules 1s listed here A Assemble the Mobile Stand B Mount the Scissor Arm C Mount the Timer D Connect the Line Voltage Cable E Connect the Timer F Activate second Fuse G Mount and Connect the Tube Head H Mount the Beam Limiting Device Final Tuning and Set Up 30 56 69 500 00210 V 5 03 IntraOs 70 Service amp Installation Manual BLUEX 3 3 4 Assembling the Mobile Stand A Mount the legs below the central base HI B Mount rear wheels and front wheels with brakes 7 C Attach the pole with timer E plate D Complete the stand with cable holder and handles 3 3 5 Mounting the Scissor Arm A Loosen the friction and push back the cylinder of the same not to Interfere during the Insertion of the shaft B Insert the scissor arm Refer to section 3 1 8 at page 20 for details 3 3 6 Mounting the Timer The timer 1s blocked in place with four bolts V 5 03 69 500 00210 31 56 BLUEX IntraOs 70 Service amp Installation Manual 3 3 7 Connecting the Line voltage Cable A The line voltage cable for the Bm mobile has to be completed with aoe local plug B The power supply cord bonding au conductor has to be blocked a first to the common bolt for bonding and grounding using lock washer and nut C The grounding wire for the timer
Download Pdf Manuals
Related Search