Home

AM4024_AM4024E User Manual

1. Processor Cores four four two Processor Base Frequency HFM 1 8 GHz 2 4 GHz 1 7 GHz 1 6 GHz Maximum Turbo Frequency 3 2 GHz 3 4 GHz 2 7 GHz LFM 800 MHz 800 MHz 800 MHz Hyper Threading supported supported supported SpeedStep supported supported supported L1 cache per core 64 kB 64 kB 64 kB L2 cache per core 256 kB 256 kB 256 kB L3 cache 6 MB 6 MB 3 MB On package cache up to 128 MB DDR3L Memory up to 16 GB 1600 MHz up to 16 GB 1600 MHz up to 16 GB 1600 MHz Graphics Intel Iris Intel HD Graphics 4600 Intel HD Graphics 4600 Pro Graphics 5200 Graphics Base Frequency 750 MHz 400 MHz 400 MHz Graphics Max Dynamic Frequency 1 0 GHz 1 0 GHz 900 MHz Graphics Execution Units 40 20 20 Configurable Thermal Design Power cTDP Power Limit Reduction Power Limit Reduction Power Limit Reduction Thermal Design Power 47 W 47 W 37 W 25 W Note The Intel Core 17 4700EQ processor supports the cTDP Down mode to 37 W The maxi mum power consumption of the Intel Core 17 4860EQ and Intel Core 15 4402 0 pro cessors can be reduced to approx 10 W using the Power Limit Reduction feature This feature can be configured via the kBoardConfig uEFI Shell command For information on this command refer to the Chapter 9 uEFI BIOS For further information about the processors used on the AM4024 E please visit the Intel website
2. 17 3 n Meer 21 4 R lated Publications RP 22 5 Features of the Processors Supported on the AM4024 E 23 7 ser Specific LEDS PUNCH ONS asua en o Come eo ence ete sete eee sdaws 26 6 Module Management and Hot Swap LEDs Functions 26 8 POST Code Sequence uu aaa EEEE E EEEE 27 9 POST Code Cun E 27 10 Mod le Handle Positions d ANM dE 28 11 Serial Port Connector J11 LOMA Pinout 29 12 Gigabit Ethernet Controller Port Mapping for the 4024 31 13 Gigabit Ethernet Controller Port Mapping for the AM4024E 31 14 Pinout of AMC Card edge Connector J1 on the AM4024 35 15 Reserved Pin s Description eene eene tette se sette t esses ese sees serere teneo 37 16 Extended Options Region Single Ended Pins Description 37 17 Single Ended GPO Pins Description 37 18 Pinout of AMC Card edge Connector J1 on the
3. 47 33 General Purpose Output Register GPOUT 48 34 DC Operational Input Voltage Range 49 35 AM4024 E Power Consumption 51 36 Power Consumption of AM4024 E Accessories 52 37 Payload Power Consumption 52 38 AM4024 E Airflow Impedance by Zone N m 57 39 AM4024 E Airflow Impedance by Zone inches H20 57 40 X Deviation of the Airflow Rate on the AM4024 E 58 41 SATA Flash Module Main Specifications 59 42 RTC Backup Battery Module Main Specifications 60 43 OM RI 65 44 Main Setup Menu Sub Screens and Functions 66 45 Advanced Setup Menu Sub Screens and Functions 67 www kontron com 8 46 47 48 49 50 AM4024 E Secu
4. ADDRESS 0x292 NAME Reserved 1 55 R R W R W 0 0 0000 BITFIELD DESCRIPTION 1 0 6 01 0 General purpose output signals 0 Output low 1 Output high www kontron com 4 Power Considerations 4 1 AM4024 E Voltage Ranges AM4024 E The AM4024 E has been designed for optimal power input and distribution Still it is necessary to ob serve certain criteria essential for application stability and reliability The AM4024 E requires two power sources the module management power for the MMC nominal 3 3V DC and a single payload power nominal 12V DC for the module components The following table specifies the ranges for the input power voltage within which the board is functional Table 34 DC Operational Input Voltage Range INPUT SUPPLY VOLTAGE Payload Power nominal 12V DC OPERATING RANGE 10 0 V min to 14 0 V max OPERATING RANGE 10 8 V min to 13 2 V max Module Management Power nominal 3 3V DC 3 0 V min to 3 6 V max 3 135 V min to 3 465 V max 45 Note Failure to comply with the instructions above may result in damage to the board or improp er operation 4 2 Carrier Power Requirements 4 2 1 Module Management Power The module management power is used only for the Module Management Controller MMC which has a very low power consumption The management power voltage measured on the AMC at the connect
5. px 190 uouuo 0 5058 385 pte jeddoo Gau lt gt 399 u ddoo 066 lt yueg xueg ON 9 Ae dsiq 9 Spd uos eoiwesg jo4no dems 10H 9009 1508 SQ31 leueg 14 851 Hod Kejdsiq 399 399 1 014 2 1 4 2 Front Panel Figure 3 AM4024 E Front Panel 4024 KA www kontron com AM4024 E Module Management LEDs LED1 red Out of Service LED LED2 red green amber Health LED HS blue Hot Swap LED User Specific LEDs ULED3 red gre
6. 74 9 5 2 Updating the IPMI Firmware 74 www kontron com 6 AM4024 E 9 5 2 1 IPMI Rollback Mechanism 74 9 5 2 2 Determining the Active IPMI Firmware Image 74 9 5 2 3 Updating PrOCedre di io oe eet Ie sa eoe ete et 74 10 ig MEINT M 75 10 1 M E 75 10 2 IPMI Firmware and KCS Interface Configuration 75 10 3 Supported IPMI and ATCA Commands 76 10 3 1 Standard IPMI Commands esses eene 76 10 3 2 AdvancedTCA and AMC Commands 79 10 4 Firmware 80 10 4 1 Get Device RETE 80 10 5 Board Control Extensions uo i rere hasa asas 81 10 5 1 SPI Boot Flash Selection uEFI BIOS Failover Control 81 10 5 2 UEFI BIOS Boot Order Selection 81 10 5 3 Set Control State SPI Boot Flash Selection Boot Order 82 10 5 4 Get Control State SPI Boot Flash Selection Boot Order S
7. www kontron com 00h OEM Firmware Info 1 COh 0003h 0000h For internal use only A1 IPMIInfo 1 70 7FFFh 01h OEM Firmware Info 2 0003h 0000h For internal use only A1 IPMIInfo 2 OEM 71h 7FFFh 02h Watchdog 23h 010Fh 0000h Watchdog 2 A1 IPMI Watchdog Sensor specific 6Fh 010Fh 03h OEM C5h 0140h 0000h FRUagent A1 FRU Agent Discrete OAh 0147h 04h Platform Alert 24h 0000h 0000 Aggregate states power tem A1 Health Error Digital discrete 03h 0003h perature etc Visualization by the Health LED 05h Platform Alert 24h 0002h 0000h MMC reboot active state Is A1 MMC Reboot Digital discrete 03h 0003h asserted during boot time 06h OEM F2h 001Fh 0000h Hot swap sensor A1 Module Sensor specific 6Fh 001Fh HotSwap 07h C3h 0007h 0000h State of IPMB L bus A1 IPMBL State Sensor specific 6Fh 000Fh 08h Mgmt Subsyst Health 28h 0002h 0000h Storage error A1 MMC Stor Err Sensor specific 6Fh 0003h 09h Firmware Upgrade Manager 010Fh 0000h Status of Firmware Upgrade A1 MMC FwUp C7h Sensor specific 6Fh Manager 0Ah Version Change 2Bh Sen 0002h 0000h firmware upgrade detec A1 Ver change sor specific 6Fh 0002h tion oCh OEM C4h 04DEh 0000h Board reset event A1 Board Reset Sensor specific 6Fh 04DEh Temperature 01h 1A81h
8. 68 9 3 Th uEFD 69 9 3 1 Introduction Basic Operation 69 9 3 1 1 Entering the Shell Jul RO EN E une ERR ERR awanapaq 69 9 3 1 2 Exiting THEUEFL SHELL cose 69 9 3 2 Kontron Specific uEFI Shell Commands 70 9 4 Shell Scripting 71 9 4 1 Startup Scriptiflg 71 9 4 2 Create Startup Script cc m 71 9 4 3 Examples of Startup 72 9 4 3 1 Execute Shell Script on Other Harddrive 72 9 4 3 2 Enable rude 72 9 4 3 3 Handling the Startup Script in the SPI Boot Flash 72 9 5 Firmware Update ia sl aaa ala 73 9 5 1 Updating the WEFT BIOS I u S sassa Pera en oe eo ee qasa puasa race ege 73 9 5 1 1 UEFI BIOS Fail Over Ga arg aep PC UI adis 73 9 5 1 2 Updating Procedure eo 73 9 5 1 3 UEFI BIOS RECOVERY Tm 74 9 5 1 4 Determining the Active Flash
9. 0008h 0008h Firmware Hub 1 boot error A1 FWH1 Boot Err Sensor specific 6Fh 0008h 19h OEM Post Value C6h 0000h 0000h POST Value from host I O port A1 POST Value OEM 78h OOFFh 80h 1Ah LAN 27h 0000h 0000h LAN link status A1 Link GbE A Sensor specific 6Fh 0003h Front port GbE A upper 1Bh LAN 27h 0000h 0000h LAN link status A1 Link GbE B Sensor specific 6Fh 0003h Front port GbE B lower 1Ch LAN 27h 0000h 0000h LAN link status A1 Link AMC 0 Sensor specific 6Fh 0003h AMC port 0 108 LAN 27h 0000h 0000h LAN link status A1 Link AMC 1 Sensor specific 6Fh 0003h AMC port 1 1Eh LAN 27h 0000h 0000h LAN link status A1 Link AMC 8 Sensor specific 6Fh 0003h AMC port 8 AM4024E LAN 27h 0000h 0000h LAN link status A1 Link AMC 9 Sensor specific 6Fh 0003h AMC port 9 AM4024E 20h LAN 27h 0000h 0000h LAN link status A1 Link AMC 10 Sensor specific 6Fh 0003h AMC port 10 AM4024E 21h LAN 27h 0000h 0000h LAN link status A1 Link AMC 11 Sensor specific 6Fh 0003h AMC port 11 AM4024E AM4024 E AM4024 E 10 7 Sensor Thresholds Table 58 Thresholds Standard and Extended Temperature Range Sensor Number ODh OEh OFh ID String NNN Temp CPU NNN Temp PCH NNN Temp Air Upper non recoverable 115 C 118 C 100 C 105 C 108 C 90 C
10. 7A81h CPU die temperature 1 CPU Threshold 01h 3939h OEh Temperature 01h OA80h 7A80h PCH temperature 1 PCH Threshold 01h 3838h OFh Temperature 01h 7A95h 7A95h Air temperature near AMC 1 Air Threshold 01h 3F3Fh edge connector 10h Voltage 02h 2204h 2204h Management Power A1 Board 3 3vIPM Threshold 01h 1212h 3 3V 11h Voltage 02h 2204h 2204h Payload Power PWR 12V 1 12 0v Threshold 01h 1212h Table 57 Sensor List Continued SENSOR NUMBER ID STRING SENSOR TYPE CODE EVENT READING TYPE CODE Deassertion Mask Assertion Mask Reading Mask DESCRIPTION www kontron com 12h Voltage 02h 2204h 2204h Board 5V supply 1 5 0V Threshold 01h 1212h 13h Voltage 02h 2204h 2204h Board 3 3V supply 1 3 3V Threshold 01h 1212h 14h Power supply 08h 0000h 0000h States of all power lines A1 Pwr Good OEM 77h 0887h 15h Power supply 08h 0000h 0887h Power fail events for all power A1 Pwr Good Evt OEM 77h 0887h lines 16h Processor 07h 0463h 0400h aggregate status A1 CPU status Sensor specific 6Fh 04E3h 17h Boot Error 1Eh 0008h 0008h Firmware Hub 0 boot error A1 FWHO Boot Err Sensor specific 6Fh 0008h 18h Boot Error 1Eh
11. Immission STANDARD EN55022 EN61000 6 3 EN300386 EN55024 EN61000 6 2 EN300386 TEST LEVEL Electrical Safety Mechanical Dimensions EN60950 1 IEEE 1101 10 Environmental and Health Aspects Climatic Humidity 1 60068 2 78 93 RH at 40 C non condensing see note below Shock operating 1 60068 2 6 EN300019 2 3 1 61131 2 1 60068 2 27 WEEE Directive 2002 96 EC Waste electrical and electronic equipment RoHS 2 Directive 2011 65 EU Restriction of the use of certain hazardous substances in electri cal and electronic equipment Vibration GR 63 CORE 5 150 Hz frequency range sinusoidal operating EN300019 2 3 1 9 acceleration IEC61131 2 1 oct min sweep rate 10 sweeps axis 3 directions x y z 15 g acceleration 11 ms pulse duration 3 shocks per direction 5 s recovery time 6 directions x 2 Note Boards without conformal coating must not be exposed to a change of temperature which can lead to condensation Condensation may cause irreversible damage especially when the board is powered up again Kontron does not accept any responsibility for damage to products resulting from destruc tive environmental testing Please contact Kontron for assistance prior to performing further environmental testing of the AM4024 E www kontron com AM4024 E 1 7 Related Publications The following publications contain informati
12. Not Connected Carrier 60 Tx6 PCIe 2 Transmitter AMC 111 Rx12 Connected Carrier 61 GND Logic Ground 110 GND Logic Ground 62 Rx6 PCIe 2 Receiver Carrier 109 Tx11 GbE 11 Transmitter AMC 63 Rx6 2 Receiver Carrier 108 11 GbE 11 Transmitter AMC 64 GND Logic Ground 107 GND Logic Ground 65 Tx7 PCIe 3 Transmitter AMC 106 Rx11 GbE 11 Receiver Carrier 66 Tx7 3 Transmitter AMC 105 Rx11 GbE 11 Receiver Carrier 67 GND Logic Ground 104 GND Logic Ground 68 Rx7 PCIe 3 Receiver Carrier 103 Tx10 GbE 10 Transmitter AMC 69 Rx7 3 Receiver Carrier 102 10 GbE 10 Transmitter AMC 70 GND Logic Ground 101 GND Logic Ground 71 SDA L IPMB L Data IPMI 100 Rx10 GbE 10 Receiver Carrier Agent 72 PWR Payload Power Carrier 99 Rx10 GbE 10 Receiver Carrier 73 GND Logic Ground 98 GND Logic Ground 74 TCLKA Telecom Clock A Carrier 97 Tx9 GbE 9 Transmitter AMC 75 TCLKA Telecom Clock A Carrier 96 Tx9 GbE 9 Transmitter AMC 76 GND Logic Ground 95 GND Logic Ground 77 TCLKB Not Connected AMC 94 Rx9 GbE 9 Receiver Carrier www kontron com AM4024 E Table 18 Pinout of AMC Card edge Connector J1 on the AM4024E Continued BASIC SIDE COMPONENT SIDE 1 EXTENDED SIDE COMPONENT SIDE 2 E SIGNAL FUNCTION DRIVEN BY PIN SIGNAL FUNCTION DRIVEN BY 78 TCLKB Not Connected AMC 93 R
13. ULED2 Red Clock failure Processor overtemperature above 125 C blinking Green uEFI BIOS POST bit 2 and bit 6 AMC port 1 Ethernet link signal status ULED1 Red Hardware reset Processor overtemperature above 125 C blinking Green uEFI BIOS POST bit 1 and bit 5 SATA channels active ULEDO Red uEFI BIOS boot failure Processor overtemperature above 125 C blinking Green uEFI BIOS POST bit 0 and bit 4 www kontron com AM4024 E How to Read the 8 Bit POST Code Due to the fact that only 4 LEDs are available and 8 bits must be displayed the POST code output is multiplexed on the User Specific LEDs Table 8 POST Code Sequence STATE GENERAL PURPOSE LEDs 0 All ULEDs are OFF start of POST sequence 1 High nibble 2 Low nibble state 2 is followed by state 0 The following is an example of the User Specific LEDs operation with POST configuration enabled see also Table 8 Table 9 POST Code Example ULED3 ULED2 ULED1 ULEDO RESULT HIGH NIBBLE off 0 on 1 off 0 off 0 0x4 off 0 off 0 off 0 on 1 0 1 POST CODE 0141 Note Under normal operating conditions the User Specific LEDs should not remain lit during boot up They are intended to be used only for debugging purposes In the event that a User Specific LED lights up during boot up and the AM4024 E does not boot please con tact Kontron If all User Speci
14. gt SatalHotplug SATA1 in the uEFI BIOS corresponds to port SATA B in the port mapping IntelVT IntelHT SpeedStep CpuTurbo gt cTDP gt C3State gt C6State C7State gt AMC configuration options e g AMCBaseCfg AMCPort lt n gt AMCFclka etc WrProtSystem AutoUpdate If AutoUpdate is enabled an automatic update procedure from the connected mass storage device is initiated after a reset The update status is indicated in the log file located in the directory where the firmware images are stored Note The parameters of the kBoardConfig command are not case sensitive kBoardInfo kBootScript Shows a summary of board specific data and displays checks various parameters such as the current uEFI BIOS revision etc Manages the flash stored startup script If the shell is launched by the boot process it executes a shell script stored in the flash If the shell script terminates the shell will continue the boot process However the shell script can also contain any other boot command kFlash Programs and verifies the SPI boot flashes holding the uEFI BIOS code uEFI BIOS binary files must be available from connected mass storage devices such as USB flash drive or harddisk kIpmi Executes a comprehensive set of IPMI functions from the uEFI Shell using the KCS interface and upgrades the IPMI firmware kJtag Programs an onboard device via the JTAG interface
15. 7ah 7ch 7eh 80h 9 12 Module in slot 9 12 Bay C2 C4 with bus addresses 82h 84h 86h 88h 0 gt 12 Module position is not in range The IPMB L bus is switched off 15 16 Reserved Bytes 13 through 16 are optional and defined by Kontron www kontron com AM4024 E 10 5 Board Control Extensions 10 5 1 SPI Boot Flash Selection uEFI BIOS Failover Control The uEFI BIOS code is stored in two different SPI boot flash devices designated as the standard SPI boot flash and the recovery SPI boot flash By default the uEFI BIOS code stored in the standard SPI boot flash is executed first If this fails the uEFI BIOS code in the recovery SPI boot flash is then executed During boot up the uEFI BIOS reports its operational status to the MMC within a given time If the sta tusis failed or not reported within the given time the MMC selects the recovery SPI boot flash resets the board s processor and waits for the status report from the uEFI BIOS again In the event the recovery boot operation fails the MMC reports it but takes no further action of its own When a boot operation fails a Boot Error Invalid boot sector event 15 asserted for the related sensor gt FWHO Boot Err sensor indicates the standard SPI boot flash has failed FWH1 Boot Err sensor indicates the recovery SPI boot flash has failed 10 5 2 uEFI BIOS Boot Order Selection Normally the uEFI
16. Lower non recoverable 10 C Table 59 Voltage Sensor Thresholds Sensor Number 12h 13h ID String NNN Board 3 3vIPM NNN Board 12 0v NNN Board 5 0V NNN Board 3 3V Upper non recoverable Upper critical Upper non critical Normal max Nominal Normal min Lower non critical Lower critical Lower non recoverable www kontron com AM4024 E 10 8 OEM Event Reading Types OEM Kontron specific sensor types and codes are presented in the following table Table 60 OEM Event Reading Types OEM SENSOR OEM EVENT DESCRIPTION TYPE CODE READING TYPE CODE Firmware Info 1 COh 70h Internal Diagnostic Data Firmware Info 2 71h Internal Diagnostic Data Board Reset C4h 6Fh Sensor specific Offset Event sensor type specific 00h Reserved 01h HwPowerReset 02h PCIReset 03h HwWatchDogReset 04h SoftReset 05h Reserved 06h ColdReset 07h IPMICommand 08h Reserved 09h Reserved BMCWatchdog IPMBL State C3h 6Fh Sensor discrete State Meaning sensor type specific 04h IPMB L running Manager C7h sensor type specific others IPMB L not running Post Value C6h 6Fh Sensor discrete State Meaning sensor type specific Bits 7 0 Post Value read from host 1 0 port 80h Bits 15 8 Reserved Firmware Upgrade 6Fh Sensor specific Offset Event F
17. gen2 local gen3 www kontron com AM4024 E 10 11 1 1 Default of AMC Configuration Settings The AMC configuration is set to default via the kBoardConfig AMCBaseCfg default uEFI Shell com mand The default values are indicated in the following table Table 62 AMC Configuration Default Values kBoardConfig DEFAULT DESCRIPTION OPTION AMCPort lt n gt auto Enable or disable an AMC port AMCPcieSpeed gen3 Select the maximum speed for the PCIe interfaces the AMC connector AMCFclka auto Select the PCIe clock source Fabric Clock A AMCTclka in Disable Telecom Clock A input AMCTclkc in Disable Telecom Clock C input 10 11 1 2 Forced AMC Port Activation Deactivation The configuration options to forcibly activate or deactivate an AMC port may be useful during system setup and testing and are available for each AMC base configuration The current setting can be shown or changed using the kBoardConfig uEFI Shell command option AMCport lt n gt Note When a base configuration is selected via the kBoardConfig uEFI Shell command option AMCBaseCfg the configuration options for the AMC ports 2 3 4 7 and 8 11 are set to their default values auto E Keying 10 11 1 3 PCI Express Speed Selection The configuration options to set the maximum PCI Express speed may be useful during system setup and testing The value set is the maximum speed which is used for PCI Express communication t
18. kNvram Manages the NVRAM to restore the system s default settings Since all uEFI settings are stored inside the NVRAM the default settings are loaded after invok ing this command www kontron com AM4024 E Table 50 Kontron Specific uEFI Shell Commands COMMAND DESCRIPTION kPassword Controls uEFI Setup and Shell passwords This command is used to determine the status of both passwords set or not set and to set or clear the uEFI Shell and Setup passwords Both user and superuser Supervisor passwords can be controlled with this command Call without options to get current password status Entering an empty password clears the password kRamdisk Creates and manages RAMdisks This command is used to perform file operations when no real filesystem is connected to the system kUpdate Controls the Kontron common update tool When using the kUpdate command the structure of the ZIP archive must not be altered kUp date automatically starts the update procedure via kUpdate u If a certain image is intended to be used enter kUpdate s to select the respective image kWatchdog Configures the Kontron onboard Watchdog This command is used to enable the Kontron onboard Watchdog with reset target before OS boot This can be used to detect if the OS fails to boot and react by reset The uEFI Shell commands are not case sensitive Each uEFI Shell command is provided with a detailed online help that ca
19. Compatibility Support Module Quick Boot Enables Disables time optimized POST causing certain preconfigured OEM optimizations to be made when the system boots USB Legacy Enables Disables support for USB devices including mouse keyboard mass storage and so on Console Redirection Enables Disables console redirection over serial port Terminal Type Baudrate Selects the terminal type to be emulated Selects the baud rate of the serial port Flow Control Specifies the type of flow control to be used for the serial port Continue C R after POST Enables Disables console redirection after the operating system has loaded www kontron com AM4024 E 9 2 2 Advanced Setup Menu The Advanced Setup menu provides sub screens and functions for advanced configuration Note Setting items on this screen to incorrect values may cause the system to malfunction Table 45 Advanced Setup Menu Sub Screens and Functions SUB SCREEN FUNCTION DESCRIPTION Processor Configu Flex Ratio Override Enables Disables CPU Flex Ratio Programming ration CPU Flex Ratio Settings CPU Flex Ratio Settings This value must be between Max Efficiency Ratio LFM and Maximum non turbo ratio set by Hardware HFM See Table 5 Features of the Processors Supported on the AM4024 E for possible LFM HFM values The active nominal CPU frequency is 100MHz ME Configuration
20. ME FW Downgrade Enables Disables ME FW Downgrade function 9 2 3 Security Setup Menu The Security Setup menu provides information about the passwords and functions for specifying the security settings The passwords are case sensitive The AM4024 E provides no factory set passwords Table 46 Security Setup Menu Functions FUNCTION DESCRIPTION Supervisor Password is Read only field User Password is Read only field Set Supervisor Password Sets or clears the Supervisor Password Supervisor Hint String Press Enter to specify a hint string for the Supervisor Password Set User Password Sets or clears the User Password User Hint String Press Enter to specify a hint string for the User Password Min password length Specifies the minimum password length Authenticate User on Boot Enables the user authentication prompt on the boot HDD Password Select Specifies whether to enable User only support for HDD or User and Master support HDDOO Password State Read only field Set HDDOO User Password Specifies and confirms the HDD User Password TPM Support Enables Disables TPM support Note If there is already a password installed the system asks for this first To clear a password simply enter nothing and acknowledge by pressing lt RETURN gt To set a password enter it twice and acknowledge by pressing lt RETURN gt Table 47 TPM Configuration Sub Screen FUNCTION DESCRIPTION Current TPM
21. POST messages or splash screen 3 Press the F2 key 4 Ifthe uEFI BIOS is password protected a request for password will appear Enter either the User Password or the Supervisor Password see Security Setup menu press lt RETURN gt and proceed with step 5 5 ASetup menu will appear The AM4024 E uEFI BIOS Setup program uses a hot key based navigation system A hot key legend bar is located on the bottom of the Setup screens The following table provides information concerning the usage of these hot keys Table 43 Navigation HOT KEY DESCRIPTION lt 1 gt The lt F1 gt key is used to invoke the General Help window lt F5 gt or lt gt The lt F5 gt key or the lt Minus gt key is used to select the next lower value within a field lt F6 gt or lt gt The lt F6 gt key or the Plus key is used to select the next higher value within a field F9 The F9 key is used to load the standard default values lt F10 gt The lt F10 gt key is used to save the current settings and exit the uEFI BIOS Setup lt gt lt gt The lt Left Right gt arrows are used to select major Setup menus on the menu bar For example Main screen Advanced screen Security screen etc 1 lt gt The lt Up Down gt arrows are used to select fields in current menu for example a Setup function ora sub screen lt ESC gt The lt ESC gt key is used to exit a major Setup menu and enter the Exit Setup
22. SIDE 1 EXTENDED SIDE COMPONENT SIDE 2 SIGNAL FUNCTION DRIVEN BY mm swa 39 Rx3 SATA B Receiver Carrier 132 15 COMA Serial Port Receive Carrier 40 GND Logic Ground 131 GND Logic Ground 41 ENABLE AMC Enable Carrier 130 Rx15 Not Connected Carrier 42 PWR Payload Power Carrier 129 Rx15 Not Connected Carrier 43 GND Logic Ground 128 GND Logic Ground 44 Tx4 PCIe 0 Transmitter AMC 127 Tx14 Debug serial data output AMC 45 Tx4 PCIe 0 Transmitter AMC 126 14 Debug serial clock output AMC 46 GND Logic Ground 125 GND Logic Ground 47 Rx4 PCIe 0 Receiver Carrier 124 Rx14 Not Connected Carrier 48 Rx4 PCIe 0 Receiver Carrier 123 Rx14 Not Connected Carrier 49 GND Logic Ground 122 GND Logic Ground 50 Tx5 PCIe 1 Transmitter AMC 121 1 13 Not Connected AMC 51 Tx5 PCIe 1 Transmitter AMC 120 Tx13 Not Connected AMC 52 GND Logic Ground 119 GND Logic Ground 53 Rx5 PCIe 1 Receiver Carrier 118 Rx13 Not Connected Carrier 54 Rx5 PCIe 1 Receiver Carrier 117 Rx13 Not Connected Carrier 55 GND Logic Ground 116 GND Logic Ground 56 SCL_L IPMB L Clock IPMI 115 Tx12 Not Connected AMC Agent 57 PWR Payload Power Carrier 114 12 Not Connected AMC 58 GND Logic Ground 113 GND Logic Ground 59 Tx6 PCIe 2 Transmitter AMC 112 Rx12
23. Serial ATA Flash module or an RTC Backup Battery module AMC Card edge Connector One 170 pin AMC Card edge connector Module Management LEDs red Out of Service LED LED2 red green amber Health LED HS LED blue Hot swap LED User Specific LEDs ULED3 red green AMC port 0 Ethernet link status green POST code m ULED2 red green AMC port 1 Ethernet link status green POST code ULED1 red green SATA channels active green POST code ULEDO red green POST code Ethernet LEDs Act green Network Link Activity Speed green yellow Network speed Watchdog Timer Software configurable two stage Watchdog with programmable timeout ranging from 125 ms to 4096 s in 16 steps Serves for generating IRQ or hardware reset o System Timer The Intel amp QM87 Chipset contains three 8254 style counters which have fixed uses In addition to the three 8254 style counters the Intel QM87 Chipset includes eight individual high precision event timers that may be used by the operating system They are implemented as a single counter each with its own comparator and value register Thermal Management CPU and board overtemperature protection is provided by gt Temperature sensors integrated in the 41 gen Intel Core 17 15 processor gt Up to four digital thermal sensors for monitoring the processor cores sensor for each core 5 One digital thermal sensor for monitoring the graphics co
24. State Read only field TPM Action Enacts TPM Action Note Most TPM actions require TPM to be Enabled to take effect Omit Boot Measurements Enabling this option causes the system to omit recording boot device attempts in PCR 4 www kontron com AM4024 E 9 2 3 1 Remember the Password It is highly recommended to keep a record of all passwords in a safe place Forgotten passwords may lead to being completely locked out of the system If the system cannot be booted because neither the User Password nor the Supervisor Password are known refer to the Chapter 3 1 DIP Switch Configuration for information about clearing the BIOS settings or contact Kontron for further assistance Note The HDD security passwords cannot be cleared using the above method 9 2 4 Boot Setup Menu The Boot Setup menu lists the for boot device priority order which is dynamically generated Table 48 Boot Priority Order FUNCTION DESCRIPTION Boot Priority Order 1 Internal Shell Keys used to view or configure devices 2 USB FDD 1 and i arrows select a device 3 USB CD lt gt and lt gt move the device up or down 4 ATAPI CD Shift 1 enables or disables a device 5 USB HDD Del deletes an unprotected device 6 ATA HDDO 7 ATA HDD1 8 ATA HDD2 9 ATA HDD3 10 ATA HDD4 11 ATA HDD5 12 Other HDD 13 PCILAN 9 2 5 Exit Setup Menu The Exit Setup menu
25. Yes Get Event Receiver 29 2 S E 01h M Yes Platform Event a k a Event Message 29 3 S E 02h M Yes PEF AND ALERTING COMMANDS 30 1 to 30 8 S E 10h to 17h 0 No SENSOR DEVICE COMMANDS M Get Device SDR Info 35 2 S E 20h M Yes Get Device SDR 35 3 S E 21h M Yes Reserve Device SDR Repository 35 4 S E 22h M Yes Get Sensor Reading Factors 35 5 S E 23h 0 No Set Sensor Hysteresis 35 6 S E 24h 0 Yes Get Sensor Hysteresis 35 7 S E 25h 0 Yes Set Sensor Threshold 35 8 S E 26h 0 Yes Get Sensor Threshold 35 9 S E 27h 0 Yes Set Sensor Event Enable 35 10 S E 28h 0 Yes Get Sensor Event Enable 35 11 S E 29h 0 Yes Re arm Sensor Events 35 12 S E 2Ah 0 No Get Sensor Event Status 35 13 S E 2Bh 0 No Get Sensor Reading 35 14 S E 2Dh M Yes Set Sensor Type 35 15 S E 2Eh 0 No Get Sensor Type 35 16 S E 2Fh 0 No Set Sensor Reading and Event Status 35 17 S E 30h 0 No www kontron com AM4024 E Table 51 Standard IPMI Commands Continued COMMAND IPMI 2 0 SPEC NETFN KONTRON SUPPORT SECTION ON MMC FRU DEVICE COMMANDS M Get FRU Inventory Area Info 34 1 Storage 10h M Yes Read FRU Data 34 2 Storage 11h M Yes Write FRU Data 34 3 Storage 12h M Yes SDR DEVICE COMMANDS 33 9 to 33 21 Storage 20h to 2Ch 0 No SEL DEVICE COMMANDS 40 2 to 40 13 Storage 40h to 5Bh 0 No LAN DEVICE COMMANDS 0 Set LAN Configuration Parameters 23 1 Transport 01h 0 Yes Get LAN Configurat
26. complex only Ports 8 11 Four Gigabit Ethernet SerDes ports Extended Options Region Port 14 One debug port gt Port 15 One serial port Port 16 Two GPOs www kontron com AM4024 E Figure 10 AM4024 E Port Mapping AMC AM4024 AM4024E Port No Standard Port Mapping Port Mapping Port Mapping Common Options Region 6 Extended Options Region GbE 0 GbE 0 GbE 1 GbE 1 SATA A 6Gb s SATA A 6Gb s SATA B 6Gb s not used SATA B 6Gb s not used not used not used Debug not used Debug not used Serial COMA Serial COMA TCLKC 2 x GPO TCLKC 2 x GPO not used not used not used not used not used not used not used not used www kontron com AM4024 E 2 8 2 Synchronization Clock Interface On the AM4024 E two PCI Express reference clock configurations are supported in accordance with the PCI Express Base Specification Revision 3 0 as follows 4024 uses local PCI Express reference clock and AMC input clock FCLKA is disabled In this configuration the clock spread spectrum modulation must be disabled AM4024 E uses local PCI Express reference clock and AM4024 E generates PCI Express ref erence clock to the AMC Card edge connector FCLKA The PCI Express reference clock configurations can be set via the uEFI BIOS k
27. executes the shell script named bootme nsh located in the root of the first detected disc drive 50 50 bootme nsh 9 4 3 2 Enable Watchdog The uEFI Shell provides an environment variable used to control the execution flow The following sam ple start up script shows the uEFI Shell environment variable wdt_enable used to control the Watchdog echo echo Executing sample startup nsh if wdt enable on then kwatchdog t 15 echo Watchdog enabled endif To create a uEFI Shell environment variable use the set uEFI Shell command as shown below Shell set wdt enable on Shell set wdt enable on Shell reset 9 4 3 3 Handling the Startup Script in the SPI Boot Flash In case there 15 no mass storage device attached the startup script can be generated in a RAM disk and stored in the SPI boot flash using the following instructions 1 Press lt ESC gt during power up to log into the uEFI Shell 2 Create a RAM disk and set the proper working directory as shown below Shell kramdisk s 3 c m myramdisk Shell myramdisk 3 Enter the sample start up script mentioned above in this section using the edit uEFI Shell command myramdisk N edit boot nsh www kontron com AM4024 E 4 Save the start up script to the SPI boot flash using the kBootScript uEFI Shell command myramdisk gt kbootscript boot nsh 5 Reset the board to execute the newly installed script using the
28. following figures illustrate the operational limits of the AM4024 E taking into consideration pow er consumption vs ambient air temperature vs airflow rate The maximum airflow input temperature was measured at the bottom of the AMC module just before the air flowed over the board Note The AM4024 E must be operated within the thermal operational limits indicated below www kontron com AM4024 E 5 1 Operational Limits for the AM4024 E Figure 11 4024 with i7 4860EQ SV 1 8 GHz 60 ay g 55 55 50 50 gt a E AS 45 40 40 lt 2 35 35 30 30 2 25 5 amp gt 20 20 0 25 5 75 10 125 15 17 5 20 22 5 25 27 5 30 32 5 35 37 5 40 VOLUMETRIC FLOW RATE CFM SYSTEM Figure 12 AM4024 E with i7 4700EQ SV 2 4 GHz 65 6 5 55 Eso 50 45 45 5 40 40 lt 35 35 30 30 25 5 25 20 20 0 25 5 7 5 10 12 5 15 17 5 20 22 5 25 27 5 30 32 5 35 37 5 40 VOLUMETRIC FLOW RATE CFM SYSTEM www kontron com Figure 13 AM4024 E with 15 4402 0 LV 1 6 GHz AM4024 E 70 65 65 5 a E 60 60 o 74 lt 55 50 50 45 45 40 gt gt gt 40 0 25 5 75 10 12 5 15 17 5 20 22 5 25 27 5 30 32 5 35
29. good image Manual rollback is also possible via the kIpmi hpm rollback uEFI Shell command 9 5 2 2 Determining the Active IPMI Firmware Image To determine the active IPMI firmware image use the kIpmi info command 9 5 2 3 Updating Procedure The active IPMI firmware image can be updated with the latest HPM 1 file from the ZIP archive using the kUpdate u or the kIpmi hpm upgrade uEFI Shell command When using the kUpdate command the structure of ZIP archive must not be altered www kontron com AM4024 E 10 IPMI Firmware 10 1 Overview The AM4024 E provides an IPMI controller NXP ARM7 with 512 kB of internal firmware flash as well as external firmware flash for firmware upgrade and rollback The IPMI controller Module Management Controller MMC carries out IPMI commands such as monitoring several onboard temperature condi tions board voltages and the power supply status and managing hot swap operations The MMC is ac cessible via one IPMB L interface one host Keyboard Controller Style KCS interface and up to four Gigabit Ethernet interfaces IOL The AM4024 E is fully compliant with the IPMI Intelligent Platform Management Interface v2 0 and the PICMG 2 9 R1 0 specifications The following are key features of the AM4024 E s IPMI firmware Keyboard Controller Style KCS interface IPMB L interface for out of band management and sensor monitor
30. menu Pressing the lt ESC gt key in a sub menu causes the next higher menu level to be displayed lt RETURN gt The RETURN key is used to execute a command or select a submenu www kontron com 9 2 Setup Menus AM4024 E The Setup utility features four menus listed in the selection bar at the top of the screen Main Advanced gt Security gt Boot gt Exit The Setup menus are selected via the left and right arrow keys The currently active menu and the cur rently active uEFI BIOS Setup item are highlighted in white Each Setup menu provides two main frames The left frame displays all available functions Functions that can be configured are displayed in blue Functions displayed in gray provide information about the status or the operational configuration The right frame displays an Item Specific Help window pro viding an explanation of the respective function 9 2 1 Main Setup Menu Upon entering the uEFI BIOS Setup program the Main Setup menu is displayed This screen lists the Main Setup menu sub screens and provides basic system information as well as functions for setting the system time and date Table 44 Main Setup Menu Sub Screens and Functions SUB SCREEN System Information FUNCTION BIOS Version Build Time etc DESCRIPTION Read only field Displays information about the system BIOS processor memory etc Boot Features CSM Support Enables Disables
31. of max 5 0 of the average value of the four thermal zones max 25 is allowed Positive deviation means increased airflow Negative deviation means decreased airflow Note The AM4024 E module provides an open area of 40 According to the PICMG AMC 0 Spec ification an open area of 20 to 70 perpendicular to the airflow path is recommended www kontron com AM4024 E 6 SATA Flash Module The AM4024 E provides an optional SATA Flash module with up to 64 GB NAND flash memory The SATA Flash module is connected to the AM4024 E via the board to board connectors J7 located on the AM4024 E and J2 located on the SATA Flash module The SATA Flash module has been optimized for embedded systems providing high performance reliability and security Note Ifthe SATA Flash module is installed the J7 interface is not available for the RTC Backup Battery module 6 1 Technical Specifications Table 41 SATA Flash Module Main Specifications FEATURES SPECIFICATIONS Board to Board One 34 pin male board to board connector J2 for interfacing with the AM4024 E Connector 5 Memory Up to 64 GB SLC based NAND flash memory 3 gt Built in full hard disk emulation 2 Up to 100 MB s read rate Up to 90 MB s write rate Power Consumption typ 1 0 W 3 3 V supply Temperature Range Operational O Cto 60 C Standard 40 Cto 70 C Extended on request Storage 40 C to 8596 Cli
32. reset uEFI Shell command myramdisk gt reset 6 Ifa scriptis already installed it can be edited using the following kBootScript uEFI Shell commands myramdisk gt kbootscript g boot nsh myramdisk gt edit boot nsh 9 5 Firmware Update Firmware updates are typically delivered as a ZIP archive containing only the firmware images The con tent of the archive with the directory structure must be copied on a data storage device with FAT par tition If the command kBoardConfig AutoUpdate has been enabled the images are automatically detected during boot up and an update of the uEFI BIOS or the IPMI firmware is carried out 9 5 1 Updating the uEFI BIOS 9 5 1 1 uEFI BIOS Fail Over Mechanism The AM4024 E has two SPI boot flashes programmed with the uEFI BIOS a standard SPI boot flash and a recovery SPI boot flash The basic idea behind that is to always have at least one working uEFI BIOS flash available regardless if there have been any flashing errors or not 9 5 1 2 Updating Procedure The standard SPI boot flash can be updated with the latest uEFI BIOS from the ZIP archive using the kUpdate u or the kFlash p uEFI Shell command When using the kUpdate command the directory structure of ZIP archive must not be altered The update status is indicated in the log file located in the directory where the firmware images are stored www kontron com AM4024 E 9 5 1 3 uEFI BIOS Recovery In case of the standard SPI boot
33. to 10 W TDP can be configured via the kboardconfig uEFI Shell command For information on this command refer to the Chapter 9 uEFI BIOS www kontron com AM4024 E 4 4 Payload Power Consumption of Accessories The following table indicates the payload power consumption of AM4024 E accessories Table 36 Power Consumption of AM4024 E Accessories MODULE PAYLOAD POWER SATA Flash module approx 1 0 W Gigabit Ethernet port connected on the front panel per interface approx 0 5 W 4 5 IPMI FRU Payload Power Consumption The following table indicates the IPMI FRU payload power consumption Table 37 IPMI FRU Payload Power Consumption AM4024 E with Intel Core AM4024 E with Intel Core AM4024 E with Intel Core i7 4860EQ SV 1 8 GHz i7 4700EQ SV 2 4 GHz i5 4402EQ LV 1 6 GHz 65 W 65 W 40 W www kontron com AM4024 E 5 Thermal Considerations The thermal characteristic graphs shown in the following sections are intended to serve as guidance for reconciling the required computing power with the necessary system volumetric airflow over the ambient temperature The graphs contain two curves representing upper level working points based on different levels of average CPU utilization When operating below the corresponding curve the CPU runs without any intervention of thermal supervision the CPU is below 100 C When operated above the corresponding curve various thermal pr
34. 1504 503 ued 10014 asn 851 VOD OJIN 2 190 uoww0g 6 les gsn uw 02 8SN Hod uod 4J 7 LA Bnq zm AS 4 aed Josues duiei 100 0 F lt seques 300 en 1eddos l lul 349 340 9909 096 399 g xueg yueg ON 40j9euuo2 1u044 lt AM4024 E ional Block Di AM4024E Funct Figure 2 I Jewod juawabeuew n Josues gt ejouoo 399 OL IS ON AZL la 049 100 1x3 gi 5 90 9 V1VS Bay 190 e z 9d asn 0131W v edA did 125 7 r 810d vx Bay 4 11 01 seqiss3q5 xz em 5 pod 810d 7 6 8 90 IS ON Josues amp
35. 16550 compatible UART routed either to the front 1 0 RS 232 signaling or the AMC Card edge connector TTL level AMC Interconnection Gigabit Ethernet Common Options Region ports 0 1 Two Gigabit Ethernet SerDes ports Fat Pipes Region ports 8 11 AM4024E Four Gigabit Ethernet SerDes ports Serial ATA Common Options Region ports 2 3 Two Serial ATA ports 6 Gb s PCI Express Fat Pipes Region ports 4 7 One x4 PCI Express interface configured as root complex only and operating up to 8 0 GT s Debug Interface Extended Options Region port 14 One Debug port Serial Interface Extended Options Region port 15 One Serial port COMA TTL signaling GPO Extended Options Region port 16 Two GPOs Clock Clock FCLKA PCI Express clock reference output to the host system www kontron com AM4024 E Table 2 AM4024 E Main Specifications Continued FEATURES SPECIFICATIONS DIP Switch One DIP switch SW2 for board configuration E Hot Swap One Hot Swap switch a Front Panel Connectors One Serial port COMA with RS 232 signal level on a 5 pin micro AB USB connector J11 One 20 pin mini DisplayPort connector J5 Two Gigabit Ethernet ports on RJ 45 connectors with integrated magnetics J3 and J4 z One USB 2 0 port on a 5 pin mini USB type A connector J2 E Onboard Connector One extension connector J7 for either a
36. 33 11 AM4024 E with i7 4860EQ SV 1 8 GHz 54 12 AM4024 E with i7 4700EQ SV 2 4 GHz 54 13 AM4024 E with 15 4402EQ LV 1 6 GHz 55 AM4024 E Airflow Impedance 56 15 Thermal Zones ofthe AM4024 E Module 57 16 SATA Flash Module Layout Bottom View 59 17 RTC Backup Battery Module Layout Top and Bottom Views 60 www kontron com AM4024 E 1 Introduction 1 1 Board Overview The AM4024 E is a highly integrated CPU board implemented as a Single Mid size Advanced Mezzanine Card AMC for ATCA and MicroTCA applications The design is based on the th generation Intel Core 15 17 processor platform combined with the mobile Intel QM87 Chipset The AM4024 E supports up to 16 GB dual channel Double Data Rate DDR3 memory with Error Check ing and Correction ECC running at 1600 MHz Up to two Intel 1350 Quad Gigabit Ethernet controllers providing up to 8 GbE ports are directly connected to the processor via x4 PCI Express 3 0 interfaces thus ensuring a maximum data throughput between processo
37. 37 5 40 VOLUMETRIC FLOW RATE CFM SYSTEM www kontron com 5 1 1 Airflow Impedance The following figure shows the airflow impedance curves of the AM4024 E module AM4024 E No card guides or struts have been used for the measurements because the resulting airflow impedance depends on individual configuration of the AMC carrier or MicroTCA system Figure 14 AM4024 E Airflow Impedance 0 35 0 30 0 25 0 20 0 15 0 10 Pressure Drop inches H 0 0 05 Volumetric Flow Rate 3 5 0 01 0 015 IO Zone Zone A ZoneB Zone C 15 20 25 30 35 Volumetric Flow Rate CFM 40 45 Pressure Drop Pa The following table indicates the pressure drop ranging from 5 to 40 cfm volumetric flow rates www kontron com AM4024 E Table 38 AM4024 E Airflow Impedance by Zone N m VOLUMETRIC PRESSURE DROP N m row crn zones ZONED 5 3 5 3 4 3 4 3 2 2 8 10 9 5 9 0 8 9 8 3 7 2 15 15 7 14 9 14 6 13 8 11 9 20 24 7 22 7 22 4 21 0 18 0 25 34 5 31 2 30 8 29 3 25 2 30 46 4 42 4 41 4 39 1 33 7 35 60 4 54 1 53 1 50 4 42 8 40 75 2 67 2 65 8 62 5 53 1 Table 39 AM4024 E Airflow Impedance by Zone inches H 0 VOLUMETRIC PRESSURE DROP inches H30 PLOW RATE 5 0 01 0 01 0 01 0 01 0 01 10 0 04 0 04 0 04 0 03 0 03 15 0 0
38. 4h 0 Yes Read Event Message Buffer 22 8 App 35h 0 Yes Get BT Interface Capabilities 22 9 App 36h 0 No Get System GUID 22 14 App 37h 0 No Get Channel Authentication Capabilities 22 13 App 38h 0 Yes Session Control 22 15 to 22 20 App 39h to 3Dh 0 Yes Get AuthCode 22 21 App 3Fh 0 No www kontron com Table 51 Standard IPMI Commands Continued 4024 2 0 5 SUPPORT SECTION ON MMC Channel Commands 22 22 to 22 30 App 40h to 47h 0 Yes User Commands 24 1 to 24 9 App 48h to 4Fh 0 Yes Get Channel OEM Payload Info 24 10 App 50h 0 No Master Write Read 22 11 App 52h 0 Yes Get Channel Cipher Suites 22 15 App 54h 0 No Suspend Resume Payload Encryption 24 3 App 55h 0 Yes Set Channel Security Keys 22 25 App 56h 0 No Get System Interface Capabilities 22 9 App 57h 0 No CHASSIS DEVICE COMMANDS 0 Get Chassis Capabilities 28 1 Chassis 00h 0 Yes Get Chassis Status 28 2 Chassis 01h 0 Yes Chassis Control 28 3 Chassis 02h 0 Yes Extended Chassis Control Commands 28 4 to 28 8 Chassis 03h 04h 0 No 05h 06h Set Power Cycle Interval 28 9 Chassis OBh 0 Yes Extended Chassis Control Commands 28 11to 28 13 Chassis 07h to 09h 0 No Get POH Counter 28 14 Chassis OFh 0 Yes EVENT COMMANDS M Set Event Receiver 29 1 S E 00h M
39. 6 0 06 0 06 0 06 0 05 20 0 10 0 09 0 09 0 08 0 07 25 0 14 0 13 0 12 0 12 0 10 30 0 19 0 17 0 17 0 16 0 14 35 0 24 0 22 0 21 0 20 0 17 40 0 30 0 27 0 26 0 25 0 21 5 1 2 Airflow Paths The area between the front panel and the AMC Card edge connector is divided into five zones 1 0 zone and four uniform thermal zones A and D The PICMG 0 Specification states that the uniformity of the airflow paths resistance should provide an impedance on the A B C and D zones that is within 25 of the average value of the four thermal zones The following figure shows the thermal zones of the AM4024 E Figure 15 Thermal Zones of the AM4024 E Module VO ZONE ZONE A ZONE B ZONE C ZONE D 32 8 mm 34 mm 34 mm 34 mm component envelope V V V V V V V KV TY PCB component envelope I IL MLL LD LP www kontron com AM4024 E The following table indicates the deviation of the airflow rate on the AM4024 E module Table 40 Deviation of the Airflow Rate on the 4024 VOLUMETRIC PRESSURE DROP N m Sweeper Wwe qo cms nn qo 5 1 6 2 5 0 7 4 7 10 0 9 2 2 0 9 4 0 15 0 6 2 1 1 2 3 9 20 0 6 1 9 1 0 3 5 25 0 5 1 9 1 2 3 6 30 0 4 1 9 1 2 3 5 35 0 3 1 9 1 2 3 4 40 0 3 1 8 1 3 3 3 Note The AM4024 E module has an airflow rate deviation
40. 6 kontron AM4024 E Doc ID 1056 0032 Rev 1 0 Date July 18 2014 The pulse of innovation AM4024 E Revision History Revision Brief Description of Changes Date of Issue 1 0 Initial issue 18 Jul 2014 Imprint Kontron Europe GmbH may be contacted via the following MAILING ADDRESS TELEPHONE AND E MAIL Kontron Europe GmbH 49 0 800 SALESKONTRON Lise Meitner Straf e 3 5 sales kontron com 86156 Augsburg Germany For further information concerning other Kontron products please visit our Internet website www kontron com Disclaimer Copyright 2014 Kontron AG All rights reserved All data is for information purposes only and not guaranteed for legal purposes Information has been carefully checked and is believed to be accurate however no responsibility is assumed for inaccuracies Kontron and the Kontron logo and all other trademarks or registered trademarks are the property of their respective owners and are recognized Specifications are subject to change without notice www kontron com 2 AM4024 E Warranty This Kontron product is warranted against defects in material and workmanship for the warranty period from the date of shipment During the warranty period Kontron will at its discretion decide to repair or replace defective products Within the warranty period the repair of products is free of charge as long as warranty conditions are observed The warranty does not apply to defec
41. 8 11 in the Fat Pipes Region of the AMC Card edge Connector On the AM4024E the two Gigabit Ethernet copper ports and the two Gigabit Ethernet ports in the Common Options Region AMC ports 0 and 1 support IPMI over LAN IOL and Serial over LAN SOL via the 1st Intel 1350 Gigabit Ethernet controller which is con nected to the Network Controller Sideband Interface NC SI The Boot from LAN feature is also supported on all Ethernet ports www kontron com Table 12 Gigabit Ethernet Controller Port Mapping for the AM4024 AM4024 E ETHERNET CONTROLLER 1st Intel 1350 port 0 PORT MAPPING AMC port 0 IPMI Channel 101 501 1 1st Intel 1350 port 1 AMC port 1 1st Intel 1350 port 2 Front 1 0 connector J3 GbE 1st Intel 1350 port 3 Front 1 0 connector J4 GbE A 2 3 4 Table 13 Gigabit Ethernet Controller Port Mapping for the AM4024E ETHERNET CONTROLLER PORT MAPPING IPMI Channel IOL SOL 1st Intel 1350 port 0 AMC port 0 1 1st Intel 1350 port 1 AMC port 1 2 1st Intel 1350 port 2 Front 1 0 connector J3 GbE 3 1st Intel 1350 port 3 Front 1 0 connector J4 GbE A 4 2nd Intel 1350 port 0 AMC port 8 2nd Intel 1350 port 1 AMC port 9 2nd Intel 1350 port 2 AMC port 10 x 2nd Intel 1350 port 3 AMC port 11 E 2 8 AMCInterconnection The AM4024 E communicates with the carrier board or the MicroTCA backpl
42. AM4024E 38 19 Reserved Pin s Description asqaqasaIkusqanasaqiqwasqyasaqu kaqa yawaqawaqaqq tan endis aariin 40 20 Extended Options Region Single Ended Pins Description 40 21 Single Ended GPO Pins Description 40 22 DIP Switch SW2 Functionality 41 23 Fail Safe AMC Fabric Configuration 41 24 AMAOZA E Specihic Registers 29d eb lacia deba ii 42 25 Write Protection Register WPROT 42 26 R setStatus Register RSTAD 43 27 Board ID High Byte Register BIDH 44 28 Geographic Addressing Register GEOAD 44 29 Watchdog Timer Control Register WTIM 45 30 Board ID Low Byte Register BIDL 46 31 LED Configuration Register LCFG 46 32 LED Control Register LETRE uuu eo eret snae o eu oe nera
43. AMC PIN AMC PORT FUNCTION 1 0 SIGNALING VOLTAGE 139 16 General purpose output 1 0 3 3V TTL level 138 16 General purpose output 2 0 3 3V TTL level www kontron com AM4024 E 2 8 6 2 Pinout of AMC Card edge Connector J1 on the AM4024E Table 18 Pinout of AMC Card edge Connector J1 on the AM4024E BASIC SIDE COMPONENT SIDE 1 EXTENDED SIDE COMPONENT SIDE 2 SIGNAL FUNCTION DRIVEN BY LECHE NN ER 1 GND Logic Ground 170 GND Logic Ground 2 PWR Payload Power Carrier 169 TDI JTAG Test Data Input Carrier 3 PS1 Presence 1 AMC 168 100 JTAG Test Data Output AMC 4 MP Management Power Carrier 167 TRST JTAG Test Reset Input Carrier 5 GAO Geographic Address 0 Carrier 166 TMS JTAG Test Mode Select In Carrier 6 RSV Reserved Optional PCIe AMC 165 TCK JTAG Test Clock Input Carrier Reset Output 7 GND Logic Ground 164 GND Logic Ground 8 RSV Reserved 163 Tx20 Not Connected AMC 9 PWR Payload Power Carrier 162 Tx20 Not Connected AMC 10 GND Logic Ground 161 GND Logic Ground 11 Tx0 GbE 0 Transmitter AMC 160 Rx20 Not Connected Carrier 12 Tx0 GbE 0 Transmitter AMC 159 Rx20 Not Connected Carrier 13 GND Logic Ground 158 GND Logic Ground 14 Rx0 GbE O Receiver Carrier 157 Tx19 Not Connected AMC 15 Rx0 GbE 0 Receiver Carrier 156 Tx19 Not Connected AMC 16 GND Logic
44. BIOS will apply the boot order which was selected in the uEFI BIOS menu uEFI Boot Boot Option Priorities But there is another alternative boot order which is stored in the MMC s non volatile memory This boot order can be set and read by IPMI OEM commands At payload start the MMC writes this boot order into a register where the uEFI BIOS can read it If this MMC s boot order has a non zero value the uEFI BIOS will use it instead of its own boot order www kontron com AM4024 E 10 5 3 Set Control State SPI Boot Flash Selection Boot Order Selection Table 54 Set Control State COMMAND LUN NetFn Set Control State SPI Boot Flash Boot Order 0h OEM 3Eh REQUEST DATA Byte Data Field 1 Control ID 00h SPI boot flash selection 9Dh uEFI BIOS boot order configuration 2 Control state for SPI boot flash selection 00h 00h Standard SPI boot flash is selected default 01h Recovery SPI boot flash is selected Note The DIP switch SW2 switch 2 may overwrite the above selection Control state for uEFI BIOS boot order configuration 9Dh 00h Boot order is according to uEFI BIOS setup default 01h Next boot device is Floppy 02h Next boot device is HDD 03h Next boot device is CD 04h Next boot device is Network 05h Next boot device is USB Floppy 06h Next boot device is USB HDD 07h Next boot device is USB CD ROM RESPONSE DATA Byte Data Field 1 Completion co
45. BoardConfig command option AMCFclka 2 8 3 System Management Interface The system management interface is a port from the module to the carrier via the Local Intelligent Plat form Management Bus IPMB L The Module Management Controller uses this port for the communi cation with the carrier Intelligent Platform Management Controller IPMC The IPMB L is a multi master I C bus 2 8 4 JTAG Interface JTAG support is provided on the AMC Card edge connector The JTAG interface is supported for vendor product test and logic update On the AM4024 E the FPGA JTAG port is connected to the AMC JTAG port 2 8 5 Module Power Interface The module power interface provides the management power MP and payload power PWR These two supply voltages must have power good indicators so that the system management can detect boot se quence events and nominal operating conditions The AM4024 E operates with payload power in the range of 10 8 V to 13 2 V and with management power of 3 3 V 45 The board supports removal and insertion in a powered slot as required by the AMC O specification 2 8 6 AMC Card edge Connector J1 The AMC Card edge connector is a high speed serial interface with 170 pins The following table pro vides the pinout of the AMC Card edge connector J1 The shaded table cells indicate signals that are not used on the AM4024 E Note When handling the board take care not to touch the gold conductive fingers of the AMC Car
46. Boost Technology was enabled Work Load Idle For this measurement all processor cores and the graphics controller were in idle state no application running and Intel Turbo Boost Technology was enabled Work Load Typical For this measurement all processor cores were operating at maximum work load and the graphics controller was off or performing basic operation e g dual screen output configu ration with no 3D graphics application running while Intel Turbo Boost Technology was disabled These values represent the power dissipation reached under realistic OS con trolled applications with the processor operating at maximum performance Work Load Maximum These values represent the maximum power dissipation achieved through the use of specific tools to heat up the processor cores and graphics controller For this measurement Intel Turbo Boost Technology was enabled These values are unlikely to be reached in real applica tions Table 35 AM4024 E Power Consumption Intel Core Intel Core Intel Core i7 4860EQ SV i7 4700EQ SV 15 4402 0 LV 1 8 GHz 2 4 GHz 1 6 GHz uEFI Shell on 21 55 W 22 61 W 16 65 W Idle on 17 15 W 15 81 W 13 59 W Typical off 32 39 W 44 53 W 20 12 W Maximum on 63 28 W 68 67 W 37 74 W Note The Intel Core 17 4700 0 SV 2 4 GHz processor provides a software configurable Thermal Design Power TDP that allows for reduction of the power consumption by up
47. Diagrams 12 1 4 1 Fu metronal Block Diagrams uu eiie ci ee eo eo saya akaqa 13 1 4 2 15 1 4 3 Board Layout c usc aaa waq fader See ndegseveesnsaxencecgsepeacsieanereseen es 16 1 5 Technical Specification M 17 1 6 ase n 21 1 7 Related Publications uu au an 22 2 Functional Description cccccscccccccccccccccccccccscccccccccesccsscesscccccsscsssoeees 23 2 1 23 2 1 1 Integrated Processor Graphics Controller 24 2 2 zu 24 2 3 Watchdog ligeros scere ess ene 24 2 4 sd 24 2 5 Flash s a 25 2 5 1 SPI Boot Flash for UEFI Ee e REPRE Re reso 25 2 5 2 SATA Flash Module IET LITM m 25 2 6 Trusted Platform 1 2 eoe eroe i iE 25 2 7 Board Interfa6ges u umu a 25 2 7 1 Front Panel 5 u roo oen den eoe ve eren een Se ee aves us 25 2 7 1 1 Modul
48. EDs are dedicated to functions as follows ULED3 ULED2 ULED1 ULEDO Note 3 3 8 Ethernet Link Status of AMC Gigabit Ethernet channel A AMC port 0 green Ethernet Link Status of AMC Gigabit Ethernet channel B AMC port 1 green SATA channels active green If the ULED3 is lit red the processor temperature is above 100 C If all ULEDs are blinking red the processor temperature is above 125 C LED Control Register LCTRL The LED Control Register enables the user to switch on and off the front panel User Specific LEDs Table 3 ADDRESS 0x291 NAME LCMD LCOL ACCESS R W R W RESET 0000 0000 2 LED Control Register LCTRL BITFIELD DESCRIPTION 7 4 LCMD User Specific LED command 0000 Get ULEDO 1000 Set ULEDO 0001 Get ULED1 1001 Set ULED1 0010 Get ULED2 1010 Set ULED2 0011 Get ULED3 1011 Set ULED3 0100 0111 Reserved 1100 1111 Reserved 3 0 LCOL User Specific LED color 0000 Off 0001 Green 0010 Red 0011 Red Green 0100 1111 Reserved Note The LED Control Register can only be used if the User Specific LEDs indicated in the LED Configuration Register Chapter 3 3 7 are configured in Mode A www kontron com 3 3 9 General Purpose Output Register GPOUT AM4024 E The General Purpose Output Register holds the general purpose output signals of the AMC Card edge connector Table 33 General Purpose Output Register GPOUT
49. For further information concerning the suitability of other Intel processors for use with the AM4024 E please contact Kontron www kontron com AM4024 E 2 1 1 Integrated Processor Graphics Controller The 4 gen Intel Core 17 15 processor includes a highly integrated processor graphics controller with up to 40 execution units delivering high performance 3D 2D graphics capabilities The AM4024 E uses one display interface of the integrated processor graphics controller and supports res olutions up to 3840 x 1160 pixels 60 Hz through DisplayPort and up to 1920 x 1200 pixels 60 Hz using DVI 2 2 Memory The AM4024 E supports a soldered dual channel 144 bit Double Data Rate DDR3 memory with Er ror Checking and Correcting ECC running at 1600 MHz memory error detection and reporting of 1 bit and 2 bit errors and correction of 1 bit failures The available memory configuration can be either 8 GB or 16 GB However when the internal graphics controller is enabled the amount of memory available to appli cations is less than the total physical memory in the system For example the chipset s Dynamic Video Memory Technology dynamically allocates the proper amount of system memory required by the oper ating system and the application 2 3 Watchdog Timer The AM4024 E provides a Watchdog timer that is programmable for a timeout period ranging from 125 ms to 4096 s in 16 steps The Watchdog timer provides the follo
50. Ground 155 GND Logic Ground 17 GA1 Geographic Address 1 Carrier 154 Rx19 Not Connected Carrier 18 PWR Payload Power Carrier 153 Rx19 Not Connected Carrier 19 GND Logic Ground 152 GND Logic Ground 20 Tx1 GbE 1 Transmitter AMC 151 Tx18 Not Connected AMC 21 Tx1 GbE 1 Transmitter AMC 150 Tx18 Not Connected AMC 22 GND Logic Ground 149 GND Logic Ground 23 Rx1 GbE 1 Receiver Carrier 148 Rx18 Not Connected Carrier 24 Rx1 GbE 1 Receiver Carrier 147 Rx18 Not Connected Carrier 25 GND Logic Ground 146 GND Logic Ground 26 GA2 Geographic Address 2 Carrier 145 Tx17 Not Connected AMC 27 PWR Payload Power Carrier 144 17 Not Connected AMC 28 GND Logic Ground 143 GND Logic Ground 29 Tx2 SATA A Transmitter AMC 142 Rx17 Not Connected Carrier 30 Tx2 SATA A Transmitter AMC 141 Rx17 Not Connected Carrier 31 GND Logic Ground 140 GND Logic Ground 32 Rx2 SATA A Receiver Carrier 139 Tx16 GPO1 AMC 33 Rx2 SATA A Receiver Carrier 138 16 GP02 AMC 34 GND Logic Ground 137 GND Logic Ground 35 Tx3 SATA B Transmitter AMC 136 Rx16 Telecom Clock C Carrier 36 Tx3 SATA B Transmitter AMC 135 Rx16 Telecom Clock C Carrier 37 GND Logic Ground 134 GND Logic Ground 38 Rx3 SATA B Receiver Carrier 133 15 Serial Port Transmit AMC www kontron com AM4024 E Table 18 Pinout of AMC Card edge Connector J1 on the AM4024E Continued BASIC SIDE COMPONENT
51. Logic Ground 17 GA1 Geographic Address 1 Carrier 154 Rx19 Not Connected Carrier 18 PWR Payload Power Carrier 153 Rx19 Connected Carrier 19 GND Logic Ground 152 GND Logic Ground 20 Tx1 GbE 1 Transmitter AMC 151 Tx18 Not Connected AMC 21 Tx1 GbE 1 Transmitter AMC 150 18 Not Connected AMC 22 GND Logic Ground 149 GND Logic Ground 23 Rx1 GbE 1 Receiver Carrier 148 Rx18 Not Connected Carrier 24 Rx1 GbE 1 Receiver Carrier 147 Rx18 Not Connected Carrier 25 GND Logic Ground 146 GND Logic Ground 26 GA2 Geographic Address 2 Carrier 145 Tx17 Not Connected AMC 27 PWR Payload Power Carrier 144 Tx17 Not Connected AMC 28 GND Logic Ground 143 GND Logic Ground 29 Tx2 SATA A Transmitter AMC 142 Rx17 Not Connected Carrier 30 Tx2 SATA A Transmitter AMC 141 Rx17 Not Connected Carrier 31 GND Logic Ground 140 GND Logic Ground 32 Rx2 SATA A Receiver Carrier 139 Tx16 GPO1 AMC 33 Rx2 SATA A Receiver Carrier 138 Tx16 2 AMC 34 GND Logic Ground 137 GND Logic Ground 35 Tx3 SATA B Transmitter AMC 136 Rx16 Telecom Clock C Carrier 36 Tx3 SATA B Transmitter AMC 135 Rx16 Telecom Clock C Carrier 37 GND Logic Ground 134 GND Logic Ground 38 Rx3 SATA B Receiver Carrier 133 Tx15 Serial Port Transmit AMC 39 Rx3 SATA B Receiver Carrier 132 15 COMA Serial Port Receive Carrier www kontron com AM4024 E Table 14 Pinout of AMC Card edge Co
52. See Chapter 4 for details Temperature Range Operational 5 Cto 55 C Standard depending on processor version and air flow in the system Storage 40 Cto 70 C Without hard disk and without battery Note When the RTC Backup Battery Module is installed refer to the opera tional specifications of this module as this determines the storage tem perature of the AM4024 E See RTC Backup Battery Module below Note When additional components are installed refer to their operational specifications as this will influence the operational and storage tem perature of the AM4024 E RTC Backup Battery Mod ule on request General Climatic Humidity Special battery mezzanine module with up to two batteries connected in parallel uses the J7 connector for interfacing with the AM4024 E Temperature ranges Operational 5 C to 55 C Storage 30 C to 60 C 93 RH at 40 C non condensing acc to IEC 60068 2 78 Dimensions Dimensions of the AM4024 E without retention screws on front panel Mid size 181 5 mm x 73 5 mm x 18 96 mm Board Weight 280 grams The above mentioned board weight refers to the AM4024 E without extension modules such as the SATA Flash module or the RTC Backup Battery module www kontron com 1 6 Standards AM4024 E The AM4024 E complies with the requirements of the following standards Table 3 Standards TYPE Mechanical ASPECT Emission
53. The Write Protection Register holds the write protect signals for non volatile devices Table 25 Write Protection Register WPROT ADDRESS 0x284 NAME SWP Reserved SFWP DSWP BSWP SSWP R R R W R R R W 0 000 0 0 0 0 BITFIELD DESCRIPTION 7 SWP System write protection status 0 Onboard non volatile memory devices not write protected 1 Onboard non volatile memory devices write protected 3 SFWP Reserved 2 DSWP This bit reflects the state of the system write protection via DIP switch SW2 switch 3 0 System not write protected via DIP switch 1 System write protected 1 BSWP This bit reflects the state of the system write protection via backplane SYS_WP 0 System not write protected via backplane 1 System write protected 0 SSWP This bit reflects the state of the system write protection via software 0 System devices not write protected via software 1 System write protected Ifthis bitis programmed once it cannot be reprogrammed www kontron com AM4024 E 3 3 2 Reset Status Register RSTAT The Reset Status Register is used to determine the host s reset source Table 26 Reset Status Register RSTAT ADDRESS 0x285 NAME PORS Reserved SRST Reserved IPRS Reserved Reserved WTRS ACCESS R W R R W R R W R R R W RESET N A 0 0 0 0 0 0 0 BITFIELD DESCRIPTION 7 PORS Power on reset status 0 System reset generated by warm re
54. Yes Set FRU LED State 3 26 PICMG 07h M Yes Get FRU LED State 3 27 PICMG 08h M Yes Get Device Locator Record ID 3 29 PICMG ODh M Yes AMC TABLE 0 Set AMC Port State 3 27 PICMG 19h 0 Yes Get AMC Port State 3 28 PICMG 1Ah 0 Yes Set Clock State 3 44 PICMG 2Ch 0 Yes Get Clock State 3 45 PICMG 2Dh 0 Yes 1 Only FRU Control Cold Reset and FRU Control Quiesce are supported www kontron com AM4024 E 10 4 Firmware Identification 10 4 1 Get Device ID Command Table 53 Get Device ID Command COMMAND LUN NetFn REQUEST DATA Byte Data Field RESPONSE DATA Data Field 1 Completion code 2 10h Device ID 3 80h Device Revision 4 02h Firmware Revision 1 Major Firmware Revision varies depending on firmware revision 5 00h Firmware Revision 2 Minor Firmware Revision BCD encoded varies depending on firmware revision 6 51h IPMI Version holds IPMI command specification version BCD encoded 7 B9h Additional Device Support 8 10 98h 3Ah 00h Manufacturer ID LSB first 03A98h 15000 Kontron 11 12 10h B4h Product ID LSB first B410h Identifies the board family firmware 13 Release number of the IPMI firmware varies depending on firmware revision 10h for R10 11h for R11 14 Module geographical address site number 1 8 Module in AMC bay A1 A2 A3 A4 B1 B2 B3 B4 or in slot 1 8 with bus addresses 72h 74h 76h 78h
55. aling voltage The following table lists the single ended GPO pins Table 21 Single Ended GPO Pins Description AMC PIN AMC PORT FUNCTION 1 0 SIGNALING VOLTAGE 139 16 General purpose output 1 0 3 3V TTL level 138 16 General purpose output 2 0 3 3V TTL level www kontron com 3 Configuration AM4024 E 3 1 DIP Switch Configuration 3 1 1 DIP Switch SW2 The DIP switch SW2 serves for general board configuration Table 22 DIP Switch SW2 Functionality SWITCH SETTING FUNCTIONALITY 1 OFF Use AMC fabric port assignment configured in the MMC and indicated in the E Keying data This configuration can be changed via the AMC configuration options in the uEFI BIOS kBoardConfig command ON Load and work with fail safe AMC fabric configuration For further information on the fail safe AMC fabric configuration refer to Table 23 Fail Safe AMC Fabric Configuration 2 OFF Boot from the standard SPI boot flash ON Boot from the recovery SPI boot flash 3 OFF Non volatile memory write protection disabled if no other write protection sources are enabled ON Non volatile memory write protection enabled 4 OFF Boot using the currently saved uEFI BIOS settings ON Clear the uEFI BIOS settings and use the default values The default setting is indicated by using italic bold To clear the uEFI BIOS settings and the passwords proceed as follows Set DIP switch SW2 switch 4
56. ane via the AMC Card edge connector which is a serial interface optimized for high speed interconnects The AMC Card edge con nector supports a variety of fabric topologies divided into five functional groups Fabric interface Synchronization clock interface System management interface JTAG interface Module power interface The following sections provide detailed information on these interfaces 2 8 1 Fabric Interface The Fabric interface is the real communication path and comprises 20 high speed ports providing point to point connectivity for module to carrier and module to module implementations The high speed ports are separated in three logical regions as follows Common Options Region Fat Pipes Region Extended Options Region The AM4024 E port mapping is described below and illustrated in Figure 10 www kontron com AM4024 E AM4024 Options Region Ports 0 1 Two Gigabit Ethernet SerDes ports Ports 2 3 Two Serial ATA ports Fat Pipes Region Ports 4 7 One x4 PCI Express interface operating as root complex only Extended Options Region gt Port 14 One debug port gt Port 15 One serial port Port 16 Two GPOs AM4024E Options Region Ports 0 1 Two Gigabit Ethernet SerDes ports Ports 2 3 Two Serial ATA ports gt Fat Pipes Region Ports 4 7 One x4 PCI Express interface operating as root
57. ansmitter 111 Rx12 Not Connected Carrier 61 GND Logic Ground 110 GND Logic Ground 62 Rx6 PCIe 2 Receiver Carrier 109 Tx11 Not Connected AMC 63 Rx6 2 Receiver Carrier 108 Tx11 Not Connected AMC 64 GND Logic Ground 107 GND Logic Ground 65 Tx7 PCIe 3 Transmitter AMC 106 Rx11 Not Connected Carrier 66 Tx7 PCIe 3 Transmitter AMC 105 Rx11 Not Connected Carrier 67 GND Logic Ground 104 GND Logic Ground 68 Rx7 PCIe 3 Receiver Carrier 103 Tx10 Not Connected AMC 69 Rx7 PCIe 3 Receiver Carrier 102 10 Not Connected AMC 70 GND Logic Ground 101 GND Logic Ground 71 SDA L IPMB L Data IPMI 100 10 Not Connected Carrier Agent 72 PWR Payload Power Carrier 99 Rx10 Not Connected Carrier 73 GND Logic Ground 98 GND Logic Ground 74 TCLKA Telecom Clock A Carrier 97 1 9 Not Connected AMC 75 TCLKA Telecom Clock A Carrier 96 Tx9 Not Connected AMC 76 GND Logic Ground 95 GND Logic Ground 77 TCLKB Not Connected AMC 94 Rx9 Not Connected Carrier 78 TCLKB Not Connected AMC 93 Rx9 Not Connected Carrier www kontron com AM4024 E Table 14 Pinout of AMC Card edge Connector J1 on the AM4024 Continued BASIC SIDE COMPONENT SIDE 1 EXTENDED SIDE COMPONENT SIDE 2 EO SIGNAL FUNCTION DRIVEN BY PIN SIGNAL FUNCTION DRIVEN BY 79 GND Logic Ground 92 GND Logic Ground 80 FCLKA PCIe Reference Clock Carrie
58. any USA Tel 49 0 8165 77 777 Tel 1 888 294 4558 Fax 49 0 8165 77 219 Fax 1 858 677 0898 info kontron com info us kontron com www kontron com AM4024 E Asia Pacific 17 Building Block 1 ABP 188 Southern West 4th Ring Road Beijing 100070 P R China Tel 86 10 63751188 Fax 86 10 83682438 info kontron cn
59. ap Removal Prior to following the steps below ensure that the safety requirements are met When removing a board from the system particular attention must be paid to the components that may be hot such as heat sink etc To remove the AM4024 E from a running system proceed as follows 1 Pull the module handle in the Hot Swap position to initiate the extraction process of the module Figure Module Handle Positions 2 Theblue HS LED displays short blinks When the carrier chassis IPMI controller receives the handle opened event it sends a com mand to the MMC with a request to perform short blinks of the blue HS LED This indicates that the module is waiting to be deactivated Now the module waits for a permission from the higher level management Shelf Manager or System Manager to proceed with its deactivation Oncethe module receives the permission to continue the deactivation all used ports are dis abled 3 The blue HS LED turns on The Intelligent Platform Management Controller on the carrier chassis disables the mod ule s payload power and the blue HS LED is turned on Now the module is ready to be safely extracted 4 Pull the module handle in the Unlocked position 5 Disconnect any interfacing cables that may be connected to the module 6 Disengage the module from the carrier backplane connector by pulling on the module han dle This may require a considerable amount of force 7 Using the front pa
60. bug port Two GPOs Clock PCIExpress reference clock FCLKA AM4024E Common Options Region ports 0 1 Two Gigabit Ethernet SerDes ports Common Options Region ports 2 3 Two Serial ATA ports Fat Pipes Region ports 4 7 One x4 PCI Express interface Fat Pipes Region ports 8 11 Four Gigabit Ethernet SerDes ports Extended Options Region port 14 16 One Serial port One Debug port gt Two 6005 Clock PCI Express reference clock FCLKA PCI Express Configuration The AM4024 E supports the PCI Express root complex configuration Operating Systems The AM4024 E is offered with various Board Support Packages including Windows VxWorks and Linux operating systems For further information concerning the operat ing systems available for the AM4024 E please contact Kontron 1 4 Board Diagrams The following diagrams provide additional information concerning board functionality and component layout www kontron com AM4024 E 1 4 1 Functional Block Diagrams ional Block Di AM4024 Funct Figure 1 I Jewod youms dems 10H juawebeuew V 5 105 85 E gt m NY ST nid 2 389 o L B dems 10H AZL gt la 049 i vb 5 180 x3 9000
61. configuration during their loading time The KCS interface configuration is available in the IPMI Device Information Record included in the SMBIOS table 10 3 Supported IPMI and ATCA Commands 10 3 1 Standard IPMI Commands The following table shows an excerpt from the command list specified in the IPMI specification 2 0 The shaded table cells indicate commands not supported by the AM4024 E IPMI firmware M mandatory 0 optional Table 51 Standard IPMI Commands COMMAND IPMI 2 0 SPEC NETFN KONTRON SUPPORT SECTION ON MMC IPM DEVICE GLOBAL COMMANDS M Get Device ID 20 1 App 01h M Yes Cold Reset 20 2 App 02h 0 Yes Warm Reset 20 3 App 03h 0 No Get Self Test Results 20 4 App 04h 0 Yes Manufacturing Test On 20 5 App 05h 0 Yes Set ACPI Power State 20 6 App 06h 0 No Get ACPI Power State 20 7 App 07h 0 No Get Device GUID 20 8 App 08h 0 No Broadcast Get Device ID 20 9 App 01h M Yes BMC WATCHDOG TIMER COMMANDS 0 Reset Watchdog Timer 27 5 App 22h 0 Yes Set Watchdog Timer 27 6 App 24h 0 Yes Get Watchdog Timer 27 7 App 25h 0 Yes BMC DEVICE AND MESSAGING COMMANDS 0 Set BMC Global Enables 22 1 App 2Eh 0 Yes Get BMC Global Enables 22 2 App 2Fh 0 Yes Clear Message Flags 22 3 App 30h 0 Yes Get Message Flags 22 4 App 31h 0 Yes Enable Message Channel Receive 22 5 App 32h 0 Yes Get Message 22 6 App 33h 0 Yes Send Message 22 7 App 3
62. connectors batteries etc are capable of being recycled Final disposition of this product after its service life must be accomplished in accordance with appli cable country state or local laws or regulations www kontron com 3 AM4024 E Contents Revision Disclaimer Warranty Proprietary Not Trademarks ua aaa Environmental Protection Statement sasawa as kumakuakassusashuqqunadiasqiq pg Fit tes ect Ie 10 1 11 1 1 Board 11 1 2 System Expansion Capabilities 11 1 2 1 SATA Flash Module 11 1 2 2 RTC Backup Battery Module 0ptional 11 1 3 System Relevant Information 12 1 4 Board
63. ction of the AM4024 E is enabled if the DIP Switch SW2 switch 3 is set to ON If the board is write protected neither the IPMI firmware or the FRU data can be updated or reprogrammed The IPMI firmware stores the write protect state in it s local NV RAM Note The write protection mode is still active when the payload is off even if the IPMI firmware re boots To disable the write protection mode set the DIP Switch SW2 switch 3 to OFF and switch on the payload www kontron com AM4024 E 10 10 LAN Functions Four Gigabit Ethernet channels on the board support IPMI over LAN IOL and Serial over LAN SOL While IOL serves to transport IPMI commands and their responses via Gigabit Ethernet SOL serves to transport any serial data via Gigabit Ethernet Please note that IOL and SOL need the Ethernet device to be powered Therefore the board payload must be fully powered For information on the assignment of the IOL SOL channels refer to Chapter 2 7 9 Gigabit Ethernet Interfaces 10 11 E Keying E Keying has been defined in the 0 R2 0 Specification to prevent module damage and malfunc tions and to verify the bay connection compatibility Therefore the FRU data of an AMC module con tains PICMG defined records which describe the module s AMC interoperability Module Current Requirements Record indicates the maximum power consumption of the AM4024 E Clock Configuration Record configures the PCI Express refe
64. d edge connector Failure to comply with the instruction above may cause damage to the board or result in improper system operation www kontron com AM4024 E 2 8 6 1 Pinout of AMC Card edge Connector J1 on the AM4024 Table 14 Pinout of AMC Card edge Connector J1 on the AM4024 BASIC SIDE COMPONENT SIDE 1 EXTENDED SIDE COMPONENT SIDE 2 SIGNAL FUNCTION DRIVEN BY ERE NN 1 GND Logic Ground 170 GND Logic Ground 2 PWR Payload Power Carrier 169 TDI JTAG Test Data Input Carrier 3 PS1 Presence 1 AMC 168 100 JTAG Test Data Output AMC 4 MP Management Power Carrier 167 TRST JTAG Test Reset Input Carrier 5 GAO Geographic Address 0 Carrier 166 TMS JTAG Test Mode Select In Carrier 6 RSV Reserved Optional PCIe AMC 165 TCK JTAG Test Clock Input Carrier Reset Output 7 GND Logic Ground 164 GND Logic Ground 8 RSV Reserved 163 Tx20 Not Connected AMC 9 PWR Payload Power Carrier 162 Tx20 Not Connected AMC 10 GND Logic Ground 161 GND Logic Ground 11 Tx0 GbE 0 Transmitter AMC 160 Rx20 Not Connected Carrier 12 Tx0 GbE 0 Transmitter AMC 159 Rx20 Not Connected Carrier 13 GND Logic Ground 158 GND Logic Ground 14 Rx0 GbE 0 Receiver Carrier 157 Tx19 Not Connected AMC 15 Rx0 GbE 0 Receiver Carrier 156 Tx19 Not Connected AMC 16 GND Logic Ground 155 GND
65. de Note The settings mentioned above are stored in EEPROM and applied to logic each time the MMC detects power on www kontron com AM4024 E 10 5 4 Get Control State SPI Boot Flash Selection Boot Order Selection This command is used to read out the SPI boot flash and boot order settings Table 55 Get Control State COMMAND LUN NetFn c MD Get Control State SPI Boot Flash Boot Order OEM 3Eh REQUEST DATA Byte Data Field Control ID 00h SPI boot flash selection 9Dh uEFI BIOS boot order configuration RESPONSE DATA Data Field 1 Completion code 4 Current control state see Chapter 10 5 3 Set Control State 00h 01h for control ID SPI boot flash selection FFh for control ID uEFI BIOS boot order configuration 10 6 Sensors Implemented on the AM4024 E The MMC includes several sensors for voltage or temperature monitoring and various others for pass fail type signal monitoring Every sensor is associated with a Sensor Data Record SDR Sensor Data Records contain information about the sensors identification such as sensor type sensor name sensor unit SDRs also contain the configuration of a specific sensor such as threshold hysteresis or event generation capabilities that specify sensor s behavior Some fields of the sensor SDR are configurable using IPMI commands others are always set to built in default values Finally one field which
66. deactuated Note 2 7 3 Debug Interface For normal operation the module handle must be in the Locked position The AM4024 E provides several onboard options for hardware and software debugging such as 2 7 4 USB Interface Four bicolor debug ULEDs for signaling hardware failures and uEFI BIOS POST code One optional small form factor extended debug port SFF XDP processor JTAG connector J10 to facilitate debug and uEFI BIOS software development One JTAG interface connected to the AMC Card edge connector for debugging and manufac turing purposes The AM4024 E provides one high speed full speed and low speed capable USB 2 0 host port imple mented as one standard 5 pin Mini USB type A connector J2 on the front panel This connector al lows standard USB peripheral devices to be connected to the AM4024 E via an adapter for Mini USB type A to USB type A connectors The following figure illustrates the adapter required for connecting standard USB devices to the AM4024 E For further technical or ordering information on this adapter please contact Kontron www kontron com Figure 8 Adapter for Mini USB Type A to USB Type A Connector 2 7 5 Serial Ports AM4024 E The AM4024 E supports one serial port COMA fully compatible with the 16550 UART controller COMA is implemented as a serial RS 232 interface available on a 5 pin USB Micro AB connector J11 on the front panel The COMA interface incl
67. e Management LEDs and Hot Swap LED 25 2 7 1 2 User Specitic DEDS per eite rede ebrio 26 2 7 2 Module Handle ie ee tense 27 www kontron com 4 AM4024 E 2 7 3 Debug Interface Mo Eai 28 2 7 4 USB Interfaces satenii EEEE 28 2 7 5 Serial POMS qaqa 29 2 7 6 Mini DisplayPort 2 30 2 7 7 SATA Interia CES u umu umasa ua aaa spa 30 2 7 8 PCI 30 2 7 9 Gigabit EthernetInterfaces 30 2 8 AMC Intercom mob na Sasa pana 31 2 8 1 Fabric u E 31 2 8 2 Synchronization Clock Interface 34 2 8 3 System Management Interface 34 2 8 4 JTAG Interface 34 2 8 5 Power DM TARE 34 2 8 6 AMC Card edge Connector J1 34 2 8 6 1 Pinout of AMC Card edge Connector J1 on the AMAO24 35 2 8 6 2 Pin
68. e steps below 1 2 3 Power on the board Ignore the message Press the lt F2 gt key Press the ESC key within 5 seconds after a message such as the one below appears EFI Shell version 2 31 4660 22136 Current running mode 1 1 2 Device mapping table Removable HardDisk Alias hd33b0b0b fs0 Acpi 0 Pci 1D 7 Usb 1 0 Usb 1 0 HD Part1 Sig17731773 Press the ESC key within 5 seconds to skip startup nsh and any other key to continue The output produced by the device mapping table can vary depending on the board s config uration If the ESC key is pressed before the 5 second timeout has elapsed the shell promptis shown Shell 9 3 1 2 Exiting the uEFI Shell To exit the uEFI Shell follow one of the steps below 1 2 Invoke the exit uEFI Shell command to select the boot device in the boot menu for the OS to boot from Reset the board using the reset uEFI Shell command www kontron com AM4024 E 9 3 2 Kontron Specific uEFI Shell Commands The Kontron uEFI implementation provides the following additional commands related to the specific HW features of the Kontron system Table 50 Kontron Specific uEFI Shell Commands DESCRIPTION COMMAND kBoardConfig Configures non volatile board settings such as Pxe PrimaryDisplay SataMode SataSpeed gt Sata0Hotplug SATAO in the uEFI BIOS corresponds to port SATA A in the port mapping
69. election 83 10 6 Sensors Implemented the AM4024 E 83 10 6 1 Sems r Listu 84 10 7 Sensor ue 86 10 8 QEM Event R ading Types _ _ UNA UU OPEN bi 87 10 9 IPMI Firmware Code uu n AEE S RI 88 10 9 1 Firmware Upgrad 88 10 9 2 IPMI Firmware and FRU Data Write Protection 88 10 10 LAN EsDIIC 89 10 11 89 10 11 1 AMC Module Configuration Options 89 10 11 1 1 Default of AMC Configuration Settings 90 10 11 1 2 Forced AMC Port Activation Deactivation 90 10 11 1 3 PCL Express Speed Selection 90 10 11 1 4 Forced FCLKA PCI Express Reference Clock Configuration 91 10 11 15 Fail Safe 91 www kontron com 7 AM4024 E Tables 1 System Relevant Information 0 e 12 2 4024 Main Specifications
70. en AMC port 0 Ethernet link status green POST Code ULED2 red green AMC port 1 Ethernet link status green POST Code ULED1 red green SATA channels active green POST Code ULEDO red green POST Code Note Ifthe ULEDs3 0 are blinking red or remain lit a failure is indicated Integral Ethernet LEDs ACT green Network Link Activity SPEED green Network Speed Legend Out of Service LED Health LED Hot Swap LED Serial Port Connector a Gigabit Ethernet Connector e lt USB Connector f DisplayPort Connector 1 4 3 Board Layout Figure 4 AM4024 Board Layout Top View 85 SATA Flash Module Battery Module J1 85 ee ee ee eS Intel 1350 2nd SATA Flash Module Battery Module J1 Logic AM4024 E Figure 6 AM4024 E Board Layout Bottom View J11 ULED 3 ULED 2 ULED 1 ULED 0 www kontron com J5 J4 Intel Intel Core i7 Intel QM87 1350 J3 DDR3L Memory J2 J5 J4 Intel Intel Intel Core i7 1350 QM87 1st J3 DDR3L Memory J2 86 410 Air Tem
71. fic LEDs flash red on and off at regular intervals they indicate that the processor junction temperature has reached a level beyond which permanent silicon dam age may occur Once activated the overtemperature event remains latched until a cold re start of the AM4024 E is undertaken all power off and then on again 2 7 2 Module Handle At the front panel the AM4024 E provides a handle for module extraction as well as for securing the module in the carrier chassis and actuating the hot swap switch The module handle supports a three position operation Figure 7 Module Handle Positions Locked BE Hot Swap Unlocked E www kontron com AM4024 E Table 10 Module Handle Positions MODULE HANDLE POSITION Locked FUNCTION When the AM4024 E is installed the module handle is pushed in the Locked posi tion and the following actions result The module is locked in the carrier chassis The hot swap switch is actuated Hot Swap When an extraction process of the AM4024 E is initiated the module handle is pulled in the Hot Swap position and the following actions result The module is locked in the carrier chassis The hot swap switch is deactuated Unlocked When the module handle is pulled to the Unlocked position the AM4024 E can be fully extracted and the following actions result The module is unlocked in the carrier chassis The hot swap switch is
72. flash being corrupted and therefore the board not starting up the board can be booted from the recovery SPI boot flash if the DIP switch SW2 switch 2 is set to ON For further information refer to the Chapter 3 1 DIP Switch Configuration Note The uEFI BIOS code and settings are stored in the SPI boot flashes Changes made to the uEFI BIOS settings are available only in the currently selected SPI boot flash Thus switch ing over to the other SPI boot flash may result in operation with different uEFI BIOS code and settings 9 5 1 4 Determining the Active Flash Sometimes it may be necessary to check which flash is active On the uEFI BIOS this information is available via the kBoardInfo uEFI Shell command 9 5 2 Updating the IPMI Firmware 9 5 2 1 IPMI Rollback Mechanism The 4024 5 IPMI controller has an internal flash where the boot block or the active IPMIfirmware is running from as well as an external flash where two IPMI firmware images are stored namely gt a copy of the currently active image and the previously good image or the newly downloaded image During firmware upgrade the previously good image in the external flash is replaced by the newly downloaded image Then the boot block activates the new image by copying it to the internal flash If the newly downloaded image was successfully activated its copy in the external flash is now the active image The copy of the old active image becomes the previously
73. he re al speed is handled out by HW during link training The current setting can be shown or changed using the kBoardConfig uEFI Shell command option AMCPcieSpeed Note When a base configuration is selected via the kBoardConfig uEFI Shell command option AMCBaseCfg the configuration options for the PCI Express speed setting is set to its de fault value gen3 www kontron com AM4024 E 10 11 1 4 Forced FCLKA PCI Express Reference Clock Configuration The configuration option to forcibly set the FCLKA ignoring E Keying may be useful during system setup and testing and is available for each AMC base configuration providing a PCI Express interface The current setting can be shown or changed using the kBoardConfig uEFI Shell command option AMCFclka Note When a base configuration is selected via the kBoardConfig uEFI Shell command option AMCBaseCfg the configuration option for the FCLKA is set to its default value auto E Keying 10 11 1 5 Fail Safe Mode If the fail safe mode is active all AMC configuration options in kBoardConfig are ignored The fail safe mode is activated by setting the DIP Switch SW2 switch 1 to ON For further information on the fail safe AMC fabric configuration refer to Chapter 3 1 1 DIP Switch SW2 www kontron com CORPORATE OFFICES Europe Middle East amp Africa North America Oskar von Miller Str 1 14118 Stowe Drive 85386 Eching Munich Poway CA 92064 7147 Germ
74. he power consumption measurements were carried out using the following testing parameters Ethernet ports connected Mini DisplayPort connected Front mini USB 2 0 port connected 8 GB DDR3 SDRAM in dual channel mode gt 12 main supply voltage gt 2 5 m s airflow The operating systems used were uEFI Shell and Windows 7 64 bit All measurements were conducted at an ambient temperature of 25 The power consumption values indicated in the tables below can vary depending on the ambient temperature This can result in deviations of the power consumption values of up to 15 The following AMC fabric interfaces were active during the measurements gt Common Options Region ports 0 1 AMC Fat Pipes Region ports 4 7 www kontron com AM4024 E The power consumption was measured using the following the 4 generation processors Quad core Intel Core 17 4860 0 SV 1 8 GHz 6 MB L3 cache GT3e Intel Iris Pro Graphics 5200 Quad core Intel Core 17 4700 0 SV 2 4 GHz 6 L3 cache GT2 Intel HD Graphics 4600 Dual core Intel Core 15 4402 0 LV 1 6 GHz 3 MB L3 cache Intel HD Graphics 4600 The power consumption was measured using the following configurations Work Load uEFI shell For this measurement the processor cores were active the graphics controller was in idle state no application running and Intel Turbo
75. ilable and may be connected to the AM4024 E via the onboard con nector J7 This optionally available module must be physically installed on the AM4024 E prior to installation of the AM4024 E in a system During installation itis necessary to ensure that the module is properly seated in the onboard connec tor J7 i e the pins are aligned correctly and not bent Note Ifthe RTC Backup Battery module is installed the J7 interface is not available for the SATA Flash module www kontron com AM4024 E 9 uEFI BIOS 9 1 Starting the uEFI BIOS The AM4024 E is provided with a Kontron customized pre installed and configured version of Secu reCore Tiano referred to as uEFI BIOS in this manual Phoenix BIOS firmware based on the Unified Extensible Firmware Interface uEFI specification and the Intel Platform Innovation Framework for EFI This uEFI BIOS provides a variety of new and enhanced functions specifically tailored to the hard ware features of the AM4024 E The uEFI BIOS comes with a Setup program which provides quick and easy access to the individual func tion settings for control or modification of the uEFI BIOS configuration The Setup program allows the accessing of various menus which provide functions or access to sub menus with more specific func tions of their own To start the uEFI BIOS Setup program follow the steps below 1 Power on the board 2 Wait until the first characters appear on the screen
76. ing IPMI over LAN IOL and Serial over LAN SOL support Sensor Device functionality with configurable thresholds for monitoring board voltages CPU state board reset etc FRU Inventory functionality IPMI Watchdog functionality power cycle reset Board monitoring and control extensions Graceful shutdown support gt uEFI BIOS fail over control selection of the SPI boot flash standard recovery Field upgradable IPMI firmware viathe KCS IPMB L or IOL interfaces Download of firmware does not breakthe currently running firmware or payload activities Two flash banks with rollback capability manual rollback or automatic in case of upgrade failure E Keying AMC ports and clock in accordance with the AMC 0 R2 0 specification For general information on the Kontron IPMI Firmware refer to the IPMI Firmware User Guide 10 2 IPMI Firmware and KCS Interface Configuration Initially the default configuration of the IPMI firmware KCS interface is IRQ 11 If this is the required configuration no further action is required If the configuration must modi fied the kIpmi uEFI Shell command is used to modify the configuration as required e g kIpmi irq 0 11 For information on the kIpmi uEFI Shell command refer to Chapter 9 uEFI BIOS www kontron com AM4024 E The KCS interface serves for the communication between the AM4024 E s payload and the MMC The OS requires the KCS interface
77. ing Register is set to default values by power on cold reset not by a warm reset www kontron com AM4024 E 3 3 5 Watchdog Timer Control Register WTIM Table 29 Watchdog Timer Control Register WTIM ADDRESS WEN WTR R W R W RESET 00 0 0000 BITFIELD WTE DESCRIPTION Watchdog timer expired status bit 0 Watchdog timer has not expired 1 Watchdog timer has expired Writing a 1 to this bit resets it to 0 WMD Watchdog mode 00 Timer only mode 01 Reset mode 10 2 Interrupt mode 11 Cascaded mode dual stage mode WEN WTR Watchdog enable Watchdog trigger control bit 0 Watchdog timer not enabled Prior to the Watchdog being enabled this bit is known as WEN After the Watchdog is enabled it is known as WTR Once the Watchdog timer has been enabled this bit can not be reset to 0 As long as the Watchdog timer is enabled it will indicate a 1 1 Watchdog timer enabled Writing a 1 to this bit causes the Watchdog to be retriggered to the timer value indicated by bits WTM 3 0 WTM Watchdog timeout settings 0000 0 125 5 0001 0 25 5 0010 0 55 0011 15 0100 25 0101 45 0110 85 0111 16 5 1000 32 5 1001 64 5 1010 128 5 1011 256 5 1100 512 5 1101 1024 5 1110 2048 5 1111 4096 5 www kontron com AM4024 E 3 3 6 Board ID Low Byte Register BIDL Table 30 Board ID Low Byte Regis
78. ion Parameters 23 2 Transport 02h 0 Yes Suspend BMC ARPs 23 3 Transport 03h 0 No Get IP UDP RMCP Statistics 23 4 Transport 04h 0 Yes SERIAL MODEM DEVICE COMMANDS 25 110 25 12 Transport 10h to 1Bh 0 No SOL COMMANDS 0 SOL Activating 26 1 Transport 20h 0 Yes Set SOL Configuration Parameters 26 2 Transport 21h 0 Yes Get SOL Configuration Parameters 26 3 Transport 22h 0 Yes BRIDGE MANAGEMENT COMMANDS ICMB ICMB Bridge 00h to 0 No DISCOVERY COMMANDS ICMB ICMB Bridge 10h to 14h 0 No BRIDGING COMMANDS ICMB ICMB Bridge 20h and 21h 0 No EVENT COMMANDS ICMB ICMB Bridge 30h to 35h 0 No OEM COMMANDS FOR BRIDGE NETFN ICMB Bridge COh to FEh 0 No OTHER BRIDGE COMMANDS Error Report ICMB Bridge FFh 0 No www kontron com AM4024 E 10 3 2 AdvancedTCA and AMC Commands The following table shows an excerpt from the command list specified in the PICMG 3 0 R 2 0 Ad vancedTCA Base Specification and the PICMG AMC 0 Advanced Mezzanine Card Specification R1 0 The shaded table cells indicate commands not supported by the IPMI firmware mandatory Table 52 AdvancedTCA and AMC Commands COMMAND SPEC TABLE KONTRON SUPPORT ON MMC AdvancedTCA PICMG 3 0 TABLE M Get PICMG Properties 3 9 PICMG 00h M Yes FRU Control 3 22 PICMG 04h M Yes 1 Get FRU LED Properties 3 29 PICMG 05h M Yes Get LED Color Capabilities 3 25 PICMG 06h M
79. irst Boot after upgrade 1h First Boot after rollback error 2h First Boot after errors watchdog 3h First Boot after manual rollback 4h Reserved 5h Reserved 6h Reserved 7h Reserved 8h Firmware Watchdog Bite reset occurred www kontron com AM4024 E Table 60 OEM Event Reading Types Continued OEM SENSOR OEM EVENT DESCRIPTION TYPE CODE READING TYPE CODE Power Supply 08h 77h Sensor specific Offset Event i e for OEM Oh 12V good PWR Power Good th 5V good Power Good Event 2h 3V3 good 3h Reserved 4h Reserved 5h Reserved 6h Reserved 7h vccCore good 8h Reserved 9h Reserved Ah Reserved Bh 3V3IPMI good MP Ch Reserved Hot Swap Sensor F2h 6Fh Sensor specific Offset Event sensor type specific 00h Handle close Oth Handle open 02h Quiesced 03h Backend Power Failure 04h Backend Power Shutdown 10 9 IPMI Firmware Code 10 9 1 Firmware Upgrade TheIPMI s operational code can be upgraded via the open source tool ipmitool or via uEFI BIOS com mands The upgrade tool commands allow download and activation of new operational code and also rollback to the last known good operational code For further information on the IPMI firmware up grade refer to the Chapter 9 uEFI BIOS and the IPMI Firmware User Guide 10 9 2 IPMI Firmware and FRU Data Write Protection Write prote
80. is the sensor owner must reflect the module addresses that allow the AMC car rier to identify the owner of the sensor when it is scanned and merged into the AMC Carrier s SDR re pository From the IPMI perspective the MMCis set up as a satellite management controller SMC The MMC sup ports sensor devices IPMI commands and uses the static sensor population feature of IPMI All Sensor Data Records can be queried using Device SDR commands Each sensor has a name field in its SDR The sensor name has a prefix which is automatically adapted dependent on the physical position of the module in a carrier or in a chassis The following prefixes are used for all sensors of an AMC module Table 56 Sensor Name Prefix AMC Bay 1 2 3 4 5 6 7 8 slot 1 2 3 4 5 6 7 8 9 10 11 12 Sensor Name Prefix A2 A3 A4 B1 B2 B3 B4 C1 C2 C3 C4 www kontron com 4024 10 6 1 Sensor List The following table indicates all sensors available on the AM4024 E For further information on Kon tron s OEM specific sensor types and sensor event type codes presented in the following table refer to Chapter 10 8 OEM Event Reading Types Table 57 Sensor List Health LED Shows Error SENSOR NUMBER ID STRING SENSOR TYPE CODE Assertion Mask EVENT READING TYPE CODE Deassertion Mask DESCRIPTION Reading Mask
81. le Layout 60 8 Installati n e 61 8 1 Sri e 61 8 2 General Instructions on Usage 61 8 3 Bila OTIS Eat LION eme 62 8 3 1 Hot Swap Insertion rene een oen e ERIS ERES SUPER cag scar VER SERVE ERES 62 8 3 2 Hot Swap Removal u rre tree oer aeg Eau neues ER kusaka 63 8 4 Installation of Peripheral Devices 64 8 4 1 SATA Flash Module a saqaqapawakaysawawnaqayaqqayaaq an goierri 64 8 4 2 RTC Backup Battery Module Installation 64 9 EEL BIOS sss c 65 9 1 Starting the 5 Ju 65 9 2 Setup MENUS n la Sani Sia ayy su kuya M a 66 9 2 1 Main Setup Memu 66 9 2 2 Advanced Setup reta aee Peso Eee octo aues eee vaso reae Lese dee Dese 67 9 2 3 Security Setup Men sius oos soe eo ee sape ana ioo ao eo teen sawa pasqquu DEus Pana EE 67 9 2 3 1 Remember the PassWord zc rete ue od RA VIRA prd RI d Mi dis 68 9 2 4 Boot Setup MEMU uu terne Ree ao Re Ye ER 68 9 2 5 Exit Setup eue ees aqha eve sees genes
82. matic Humidity 93 RH at 40 C non condensing acc to IEC 60068 2 78 Dimensions 70 mm x 28 mm Board Weight ca 14 grams Note Write protection is available for this module Contact Kontron for further assistance if write protection is required 6 2 SATA Flash Module Layout Figure 16 SATA Flash Module Layout Bottom View www kontron com AM4024 E 7 RTC Backup Battery Module This optional battery mezzanine module is provided for applications requiring backup power for the RTC It is supplied with up to two parallel connected 3V lithium batteries The module is field replace able The batteries themselves are not replaceable The RTC Backup Battery module utilizes the J7 con nector for interfacing with the AMC module Note Ifthe RTC Backup Battery module is installed the J7 interface is not available for the SATA Flash module 7 1 Technical Specifications Table 42 RTC Backup Battery Module Main Specifications FEATURES SPECIFICATIONS Board to Board One 34 pin male board to board connector J1 for interfacing with the AM4024 E 5 Connector 5 Battery Up to two 3 0V lithium batteries w UL approved Temperature Range Operational 5 Cto 55 C Storage 30 C to 60 C E Climatic Humidity 93 RH at 40 C non condensing acc to IEC 60068 2 78 Dimensions 70 mm x28 mm Board Weight ca 14 grams 7 2 RTC Backup Battery Module Layout Figure 17 RTC Back
83. n be invoked by entering lt gt space lt 2 gt in the command line To display the uEFI Shell command list enter help or lt gt in the command line 9 4 uEFIShell Scripting 9 4 1 Startup Scripting If the ESC key is not pressed and the timeout is run out the uEFI Shell tries to execute some startup scripts automatically It searches for scripts and executes them in the following order 1 Kontron flash stored startup script 2 Ifthereis no Kontron flash stored startup script present the uEFI specified startup nsh script is used This script must be located on the root of any of the attached FAT formatted disk drive 3 Ifnoneofthe startup scripts is present or the startup script terminates the default boot or der is continued 9 4 2 Create a Startup Script Startup scripts can be created using the uEFI Shell built in editor edit or under any OS with a plain text editor of your choice To create a startup shell script simply save the script on the root of any FAT for matted drive attached to the system To copy the startup script to the flash use the kBootScript uEFI Shell command In case there 15 no mass storage device attached the startup script be generated in a RAM disk and stored in the SPI boot flash using the kRamdisk uEFI Shell command www kontron com AM4024 E 9 4 3 Examples of Startup Scripts 9 4 3 1 Execute Shell Script on Other Harddrive This example startup nsh
84. nel as a grip remove the module from the carrier chassis 8 Dispose of the module as required www kontron com AM4024 E 8 4 Installation of Peripheral Devices The AM4024 E is designed to accommodate a SATA Flash Module or an RTC Backup Battery Module Prior to installation of a peripheral device ensure that the safety requirements are met Special atten tion must be paid to avoid touching any components that may be hot such as heat sink etc 8 4 1 SATA Flash Module Installation A Serial ATA Extension Module with up to 64 GB SATA NAND Flash Memory may be connected to the AM4024 E via the onboard connector J7 This optionally available module must be physically installed on the AM4024 E prior to installation of the AM4024 E in system During installation it is necessary to ensure that the SATA Flash module is properly seated in the onboard connector J7 i e the pins are aligned correctly and not bent Before putting the AM4024 E into operation ensure that the boot priority is configured as required for the application Note Ifthe RTC Backup Battery module is installed the J7 interface is not available for the SATA Flash module Note Only qualified SATA Flash modules from Kontron are authorized for use with the AM4024 E Failure to comply with the above will void the warranty and may result in dam age to the board or the system 8 4 2 RTC Backup Battery Module Installation An RTC Backup Battery module is ava
85. ng over to the other SPI boot flash may result in operation with different uEFI BIOS code and settings 2 5 2 SATA Flash Module The AM4024 E supports up to 64 GB flash memory in combination with an optional SATA Flash module The SATA Flash module uses the J7 connector for interfacing with the AM4024 E If this module is re quired the J7 interface is not available for the The RTC Backup Battery module Refer to Chapter 6 for further information on this module 2 6 Trusted Platform Module 1 2 The AM4024 E supports the Trusted Platform Module TPM 1 2 TPM1 2 is a security chip specifically designed to provide enhanced hardware and software based data and system security TPM1 2 is based on the Atmel 975 3204 security controller and stores sensitive data such as encryption and signature keys certificates and passwords and is able to withstand software attacks to protect the stored information 2 7 Board Interfaces 2 7 1 Front Panel LEDs The AM4024 E is equipped with three Module Management LEDs and four User Specific LEDs The User Specific LEDs can be configured via two onboard registers see Chapter 3 3 7 LED Configuration Regis ter and Chapter 3 3 8 LED Control Register 2 7 1 1 Module Management LEDs and Hot Swap LED The Module Management LEDs LEDO and LED1 show the software status of the MMC The Hot Swap LED HS LED indicates when the board may be extracted It can be switched on or off by software and may be
86. nix SCT3 Command shell for diagnostics and configuration gt uEFI Shell commands executable from mass storage device in pre OS envi ronment open interface MMCsupport in the command shell IPMI Firmware Software IPMI firmware providing the following features Keyboard Controller Style KCS interface IPMB L interface for out of band management and sensor monitoring IPMI over LAN IOL and Serial over LAN SOL support Sensor Device functionality with configurable thresholds for monitoring board voltages CPU state board reset etc gt FRU Inventory functionality IPMI Watchdog functionality power cycle reset Board monitoring and control extensions Graceful shutdown support UEFI BIOS fail over control selection of the SPI boot flash standard re covery Field upgradable IPMI firmware gt via the KCS IPMB or IOL interfaces Download of firmware does not break the currently running firmware or payload activities Twoflash banks with rollback capability manual rollback or automatic in case of upgrade failure E Keying AMC ports and clock in accordance with the AMC 0 R2 0 specifica tion Operating Systems There are various operating systems available for the AM4024 E For further information please contact Kontron www kontron com AM4024 E Table 2 AM4024 E Main Specifications Continued FEATURES SPECIFICATIONS Power Consumption
87. nnector J1 on the AM4024 Continued BASIC SIDE COMPONENT SIDE 1 EXTENDED SIDE COMPONENT SIDE 2 E SIGNAL FUNCTION DRIVEN BY PIN SIGNAL FUNCTION DRIVEN BY 40 GND Logic Ground 131 GND Logic Ground 41 ENABLE AMC Enable Carrier 130 Rx15 Not Connected Carrier 42 PWR Payload Power Carrier 129 Rx15 Not Connected Carrier 43 GND Logic Ground 128 GND Logic Ground 44 Tx4 PCIe 0 Transmitter AMC 127 Tx14 Debug serial data output AMC 45 Tx4 PCIe 0 Transmitter AMC 126 14 Debug serial clock output AMC 46 GND Logic Ground 125 GND Logic Ground 47 Rx4 PCIe 0 Receiver Carrier 124 Rx14 Not Connected Carrier 48 Rx4 PCIe 0 Receiver Carrier 123 Rx14 Not Connected Carrier 49 GND Logic Ground 122 GND Logic Ground 50 Tx5 PCIe 1 Transmitter AMC 121 13 Not Connected AMC 51 Tx5 PCIe 1 Transmitter AMC 120 Tx13 Not Connected AMC 52 GND Logic Ground 119 GND Logic Ground 53 Rx5 PCIe 1 Receiver Carrier 118 Rx13 Not Connected Carrier 54 Rx5 PCIe 1 Receiver Carrier 117 Rx13 Not Connected Carrier 55 GND Logic Ground 116 GND Logic Ground 56 SCL_L IPMB L Clock IPMI 115 Tx12 Not Connected AMC Agent 57 PWR Payload Power Carrier 114 12 Not Connected AMC 58 GND Logic Ground 113 GND Logic Ground 59 Tx6 PCIe 2 Transmitter AMC 112 12 Not Connected Carrier 60 Tx6 2 Tr
88. on relating to this product Table 4 Related Publications PRODUCT PUBLICATION ATCA PICMG 3 0 R3 0 AdvancedTCA Base Specification March 24 2008 MicroTCA PICMG 0 R1 0 Micro Telecommunications Computing Architecture Base Specifica tion July 6 2006 PICMG MTCA 1 R1 0 Air Cooled Rugged MicroTCA Specification March 19 2009 AMC PICMG 0 R2 0 Advanced Mezzanine Card Base Specification Nov 15 2006 PICMG AMC 1 R2 0 PCI Express on AdvancedMC Oct 8 2008 PICMGG AMC 2 R1 0 Ethernet Advanced Mezzanine Card Specification March 1 2007 PICMGG AMC 3 R1 0 Advanced Mezzanine Card Specification for Storage Aug 25 2005 IPMI IPMI Intelligent Platform Management Interface Specification v2 0 Document Revision 1 0 February 12 2004 Platform Firmware Unified Extensible Firmware Interface uEFI specification version 2 1 All Kontron Products Product Safety and Implementation Guide ID 1021 9142 www kontron com 2 Functional Description 2 1 Processor and Chipset AM4024 E The AM4024 E supports the Intel Core 17 4860 0 the Intel Core 17 4700 0 SV and the Intel Core 15 4402EQ processors in combination with the mobile Intel QM87 Chipset Table 5 Features of the Processors Supported on the AM4024 E FEATURE Intel Core i7 4860EQ Intel Core i7 4700EQ SV 1 8 GHz SV 2 4 GHz Intel Core 15 4402 0 LV 1 6 GHz
89. or shall be 3 3 V 5 and the maximum current is 150 mA see Table 34 DC Operational Input Voltage Ranges The module management power is below 0 45 W and it has therefore not been taken into consideration during the measurements 4 2 2 Payload Power Payload power is the power provided to the module from the carrier or the backplane for the main func tion of the module The payload power voltage should be selected at the higher end of the specified voltage range The maximum continuous current limit value is based on the AMC module s power limit of 80 W At the minimum supply voltage of 10 8 V the 80 W requires approximately 7 4 A The payload power voltage shall be at least 10 8 V and not more than 13 2 V at the module contacts during normal conditions under all loads see Table 34 DC Operational Input Voltage Ranges The bandwidth limited periodic noise due to switching power supplies or any other source shall not exceed 200 mV peak to peak www kontron com AM4024 E 4 2 3 Power Sequencing for Unmanaged Systems If the AM4024 E is installed in an unmanaged system the module management power must be stable and in regulation before the payload power starts to ramp up 4 3 Power Consumption The goal of this description is to provide a method to calculate the power consumption for the AM4024 E baseboard and for additional configurations The processor and the memory dissipate the majority of the thermal power T
90. otection mechanisms may take effect resulting in tempo rarily reduced CPU performance or finally in an emergency stop the CPU is at 125 C in order to protect the CPU and the chipset from thermal destruction In real applications this means that the board can be operated temporarily at a higher ambient temperature or at a reduced flow rate and still provide some margin for temporarily requested peak performance before thermal protection will be activated An airflow of 20 cfm is a typical value for a standard Kontron MicroTCA system For other systems the available airflow will differ The maximum ambient operating temperature must be determined for such environments How to read the diagram Select a specific CPU and choose a specific working point For a given flow rate there 15 a maximum air flow input temperature ambient temperature provided Below this operating point thermal super vision will not be activated Above this operating point thermal supervision will become active protecting the CPU from thermal destruction The minimum flow rate provided must be more than the value specified in the diagram Volumetric flow rate The volumetric flow rate refers to an airflow through a fixed cross sectional area i e slot width x depth The volumetric flow rate is specified in m3 s cubic meter per second or cfm cubic feet per minute respectively Conversion 1 cfm 0 47 x 10 m3 s 1 7 m3 h 1 m3 s 3600 m3 h 2118 9 cfm The
91. out of AMC Card edge Connector J1 the AM4024E 38 3 COonfig ratI nu uuu 41 3 1 DIP Switch C onflguratl fa uu e n tenen 41 3 1 1 41 3 2 System Write Protection 42 3 3 AM4024 E Specific esineisiin 42 3 3 1 Write Protection Register WPR0T 42 3 3 2 Reset Status Register 5 vscdinioussanseursdaxedsesusacupensaenneanabnie UN MER PRA 43 3 3 3 Board ID High Byte Register BIDH 44 3 3 4 Geographic Addressing Register GEOAD 44 3 3 5 Watchdog Timer Control Register WTIM 45 3 3 6 Board ID Low Byte Register BIDL 46 3 3 7 LED Configuration Register LCFG 46 3 3 8 LED Control Register TECTBL 47 3 3 9 General Purpose Output Register GP0UT 48 4 Power Considerations scs
92. perature Sensor O n DDR3L Memory ll 1 1 ON _ 1234 AM4024 E 1 5 Technical Specification Table 2 AM4024 E Main Specifications Processor amp Chipset FEATURES CPU SPECIFICATIONS The AM4024 E supports the following 4 generation processors gt Quad core Intel Core i7 4860EQ SV 1 8 GHz 6 MB L3 cache GT3e Intel Iris Pro Graphics 5200 Quad core Intel Core i7 4700EQ SV 2 4 GHz 6 MB L3 cache GT2 Intel HD Graphics 4600 gt Dual core Intel Core i5 4402EQ LV 1 6 GHz 3 MB L3 cache Intel HD Graphics 4600 Graphics Controller High performance 3D graphics controller integrated in the processor PCH Intel QM87 Chipset Memory Main Memory Up to 16 GB dual channel DDR3L SDRAM memory with ECC running at 1600 MHz soldered Flash Memory Two 16 MB SPI boot flash chips for two separate uEFI BIOS images Up to 64 GB SLC NAND flash via an onboard SATA Flash module SSD EEPROM EEPROM with 64 kbit Onboard Controller Gigabit Ethernet Up to two Intel 1350 Quad Gigabit Ethernet PCI Express bus controllers with advanced management features such as serial redirection over LAN AM4024 Two interfaces routed to the front 1 0 connectors Two interfaces routed to the AMC Card edge connector AM4024E Two interfaces routed to the front 1 0 connectors Six interfaces routed to the AMC Card edge connector Serial One
93. provides functions for handling changes made to the uEFI BIOS settings and the exiting of the Setup program Table 49 Exit Setup Menu Functions FUNCTION DESCRIPTION Exit Saving Changes Equal to F10 save all changes of all menus then exit the uEFI BIOS Setup Finally resets the system automatically Exit Discarding Changes Never save changes then exit the uEFI BIOS Setup Load Setup Defaults Equal to F9 Load standard default values Discard Changes Load the original value of this boot time not the default Setup value Save Changes Save all changes of all menus but do not reset system www kontron com AM4024 E 9 3 The uEFI Shell The Kontron uEFI BIOS features a built in and enhanced version of the uEFI Shell For a detailed de scription of the available standard shell scripting refer to the EFI Shell User s Guide For a detailed de scription of the available standard shell commands refer to the EFI Shell Command Manual Both documents can be downloaded from the EFI and Framework Open Source Community homepage http sourceforge net projects efi shell files documents Please note that not all shell commands described in the EFI Shell Command Manual are provided by the Kontron uEFI BIOS 9 3 1 Introduction Basic Operation The uEFI Shell forms an entry into the uEFI boot order and is the first boot option by default 9 3 1 1 Entering the uEFI Shell To enter the uEFI Shell follow th
94. r 91 Tx8 Not Connected AMC 81 FCLKA PCIe Reference Clock Carrier 90 Tx8 Not Connected AMC 82 GND Logic Ground 89 GND Logic Ground 83 PSO Presence 0 Carrier 88 Rx8 Not Connected Carrier 84 PWR Payload Power Carrier 87 Rx8 Not Connected Carrier 85 GND Logic Ground 86 GND Logic Ground The following table indicates the reserved pin which must not be connected to external circuitry Table 15 Reserved Pin s Description AMC PIN AMC PORT FUNCTION SIGNALING VOLTAGE 6 Optional PCI Express reset output 0 3 3V TTL level Note The reserved pin indicated above is reserved for optional use and must not be connected to external circuitry Failure to comply with the instruction above may cause damage to the board or result in improper system operation The following table lists the Extended Options Region pins with no differential signals Table 16 Extended Options Region Single Ended Pins Description AMC PIN AMC PORT FUNCTION 1 0 SIGNALING VOLTAGE 133 15 Tx serial port COMA 0 3 3V TTL Level 132 15 Rx serial port COMA I 3 3V TTL level 127 14 Debug serial data output 0 3 3V TTL level 126 14 Debug serial clock output 0 3 3V TTL level Note The Extended Options Region pins listed above do not have differential signals They have 3 3V TTL signaling voltage The following table lists the single ended GPO pins Table 17 Single Ended GPO Pins Description
95. r and memory The AM4024 E can be op tionally equipped with up to 64 GB of SLC NAND flash memory via a SATA Flash module The AM4024 E supports a comprehensive set of interconnecting capabilities On the front panel the AM4024 E comes with a broad set of I 0 interfaces such as 2x Gigabit Ethernet DisplayPort COM and USB allowing for a convenient bring up process during the application development process A variety of high speed interconnect ports to the backplane such as up to 8 Gigabit Ethernet ports PCI Express and SATA ensures a wide range of possible application use cases for the AM4024 E The processor and the memory are soldered on the AM4024 E which results in a higher MTBF value and a significant advantage for the cooling concept The careful design and selection of high temperature resistant components together with the elaborated heat sink design ensure high product reliability A front panel design according to the PICMG MTCA 1 specification on project request provides shock and vibration resistance in demanding environmental conditions The AM4024 E is an ideal platform for high performance computing and multi processor systems in general In the communication market the AM4024 E perfectly serves for media server gateway ap plications as well as in test solutions for networking equipment In particular the Core 17 with inte grated Intel HD Graphics 4600 5200 provides a significant performance boost for video
96. re digital thermal sensor for monitoring the package die temperature a One onboard air temperature sensor for monitoring the board temperature Specially designed heat sink www kontron com AM4024 E Table 2 AM4024 E Main Specifications Continued FEATURES SPECIFICATIONS Module Management Controller IPMI NXP ARM7 microcontroller with 512 kB firmware flash and automatic rollback strategy The MMC carries out IPMI commands such as monitoring several onboard tempera ture conditions board voltages and the power supply status and managing hot swap operations The MMC is accessible via a local IPMB L and one host Keyboard Controller Style Interface KCS One MMC system EEPROM for FRU data and firmware private data Hot Swap The AM4024 E has full hot swap capability TPM Security Trusted Platform Module TPM 1 2 for enhanced hardware and software based data and system security uEFI BIOS Phoenix SecureCore Tiano SCT BIOS firmware based on the uEFI Specification and the Intel Platform Innovation Framework for EFI Serial console redirection via serial port LAN boot capability for diskless systems standard PXE Automatic fail safe recovery in case of a damaged image Non volatile storage of setting in the SPI boot flash battery only required for the RTC Compatibility Support Module CSM providing legacy BIOS compatibility based on Phoe
97. rence clock FCLKA on AMC Card edge connector AMC Point to point Record indicates the AMC port capabilities of the AM4024 E i e the supported AMC fabric interface types of the current board configuration Depending on the current board configuration i e the module s description in the FRU data records the carriers s IPMC in an ATCA system or the MCH of a MicroTCA system decides during E Keying which AMC fabric interfaces are activated Therefore the IPMI commands Set AMC Port State andGet AMC Port State defined by the 0 specification are used for either granting or jecting the E Keys i e enabling or disabling of AMC ports during E Keying 10 11 1 AMC Module Configuration Options The board configuration for E Keying is done via the kBoardConfig uEFI Shell command For further information on the kBoardConfig uEFI Shell command refer to Chapter 9 uEFI BIOS For information on the AMC interconnection capabilities and the fabric interfaces supported for an AMC base configuration refer to Chapter 2 8 AMC Interconnection The following table indicates the fabric interfaces available and which board configuration options can be applied to the module and its AMC base configuration Table 61 Overview of Board Configuration Options AMC PORT MAPPING AND BASE CONFIGURATIONS FURTHER BOARD CONFIGURATION OPTIONS AMCTc1ka AMCBaseCfg and AMCTc1kc default GbE GbE SATA SATA PCIE in auto gen1 RC x4 disable out
98. rity Setup Menu Functions 67 TPM Configuration Sub Screen 67 Boot 68 Exit Setup M nu FUNCIONS 68 Kontron Specific uEFI Shell Commands 70 www kontron com 9 AM4024 E Figures 1 AM4024 Functional Block Diagram 13 2 AM4024E Functional Block Diagram 14 3 AMASDPATE Front Panel uuu u oko E pq Viper ARE Us 15 4 AMG026 Board Layout View 16 5 AM4024E Board Layout View 16 6 AM4024 E Board Layout Bottom View 16 7 Module Handle Positions destine ada braun liia a das aU ite Ka OR SUMI PHASE PERI PLAT PEE 27 8 Adapter for Mini USB A to USB Type A Connector 29 9 Serial Port Connector JTT COMA 29 10 AMAO24 E Port Mapping oes e oor aen mo Ene pe aee oen yere eoa er pres seecsasedwacecus
99. sasecdccascsasssssssnssdccseonsccscassececaseusesssevesssecesssddacesss 49 4 1 AM4024 E Voltage Ramgas eR TEM 49 4 2 Carrier Power Requirements u aaa 49 4 2 1 Module Management Power 49 4 2 2 Payload C 49 4 2 3 Power Sequencing for Unmanaged Systems 50 4 3 Power CONSUMPTION 50 4 4 Payload Power Consumption of Accessoriles 52 4 5 IPMI FRU Payload Power Consumption 52 5 Thermal Considerations ua Sa RAS RERRRRERERKA NAR ERRRRARR AS 53 5 1 Operational Limits for the AM4024 E 54 5 1 1 IMP Gd ane EORR 56 5 1 2 s RU 57 www kontron com 5 AM4024 E 6 SATA Flash Module uuu sss 59 6 1 Technical Specifications a aa luan suaqqa Ee RR DE ERR 59 6 2 SATA Flash Module iE EEE EESE 59 7 RTC Backup Battery Module ccscccccccccccccccccccccccccccccccscccsssccccsscscscsces 60 7 1 DET edrTena enr 60 7 2 RTC Backup Battery Modu
100. set 1 System reset generated by power on cold reset Writing a 1 to this bit clears the bit 5 SRST Software reset status 0 Reset is logged by the MMC 1 Reset is not logged by MMC The uEFI BIOS software sets this bit to inform the MMC that the next reset should not be logged 3 IPRS MMC reset status 0 System reset not generated by MMC 1 System reset generated by MMC Writing a 1 to this bit clears the bit 0 WTRS Watchdog timer reset status 0 System reset generated by Watchdog timer 1 System reset generated by Watchdog timer Writing a 1 to this bit clears the bit Note The Reset Status Register is set to default values by power on cold reset not by a warm reset www kontron com AM4024 E 3 3 3 Board ID High Byte Register BIDH Table 27 Board ID High Byte Register BIDH ADDRESS ACCESS 0 4 BITFIELD DESCRIPTION Board identification AM4024 0xB410 AM4024E 0xB412 3 3 4 Geographic Addressing Register GEOAD The Geographic Addressing Register holds the AMC geographic address site number used to assign the Intelligent Platform Management Bus IPMB L address to the AM4024 E Table 28 Geographic Addressing Register GEOAD ADDRESS 0x28A NAME Reserved GA ACCESS R R RESET 000 N A BITFIELD DESCRIPTION Res Reserved GA Geographic address Note The Geographic Address
101. streaming transcoding and IPTV applications The AM4024 E is offered with various Board Support Packages including Windows VxWorks and Linux operating systems For further information concerning the operating systems available for the AM4024 E please contact Kontron 1 2 System Expansion Capabilities 1 2 1 SATA Flash Module Optional The SATA Flash module provides up to 64 GB of SLC NAND flash memory For further information on the SATA Flash module refer to Chapter 6 1 2 2 RTC Backup Battery Module Optional The RTC Backup Battery module provides backup power for the RTC via two soldered parallel connect ed 3V lithium batteries For further information on the RTC Backup Battery module refer to Chapter 7 www kontron com AM4024 E 1 3 System Relevant Information The following system relevant information is general in nature but should still be considered when de veloping applications using the AM4024 E Table 1 System Relevant Information SUBJECT INFORMATION Hardware Requirements The AM4024 E can be installed on any AMC supporting carrier board or MicroTCA backplane with the following AMC Card edae connector port mapping AM4024 Common Options Region ports 0 1 Two Gigabit Ethernet SerDes ports Common Options Region ports 2 3 Two Serial ATA ports Fat Pipes Region ports 4 7 x4 PCI Express interface Extended Options Region port 14 16 gt One Serial port gt De
102. ter BIDL ADDRESS ACCESS 0x10 AM4024 0x12 AM4024E DESCRIPTION BITFIELD Board identification 4024 0xB410 AM4024E 0xB412 3 3 7 LED Configuration Register LCFG The LED Configuration Register holds a series of bits defining the onboard configuration for the front panel User Specific LEDs Table 31 LED Configuration Register LCFG ADDRESS Reserved R R W 0000 0000 BITFIELD DESCRIPTION 3 0 LCON User Specific LED Configuration 0000 POST ULEDs build a binary vector to display Port 80 signals 0001 Mode A LEDs are controlled via the LCTRL register 0010 Mode B default mode function after boot up 0011 1111 Reserved Regardless of the selected configuration the User Specific LEDs are used to signal a number of fatal onboard hardware errors such as ULED3 Power failure red ULED2 Clock failure red ULED1 Hardware reset red ULEDO uEFI BIOS boot failure red In POST mode the ULED3 0 fulfilla basic debug function during the boot up phase as long as the first access to Port 80 is processed For further information on reading the 8 bit uEFI BIOS POST Code refer to Chapter 2 7 1 2 User Specific LEDs In Mode A the ULEDs can be individually configured according to the application requirements see Chapter 3 3 8 LED Control Register www kontron com AM4024 E Configured for Mode B the User Specific L
103. to connect the SATA Flash module Two SATA 6 Gb s ports connected to the AMC ports 2 3 in the Common Options Region of the AMC Card edge Connector 2 7 8 PCI Express The AM4024 E provides one x4 PCI Express 3 0 interface operating at up to 8 0 GT s The PCI Express interface operates as root complex only and is routed to the AMC interconnection Fat Pipes Region ports 4 7 2 7 9 Gigabit Ethernet Interfaces The AM4024 provides four Gigabit Ethernet interfaces using one Intel 1350 Gigabit Ethernet control ler Two Gigabit Ethernet copper ports 1000BASE TX are connected to the RJ 45 front panel connec tors J3 and J4 and two Gigabit Ethernet SerDes ports are routed to the AMC ports 0 1 in the Common Options Region of the AMC Card edge Connector On the AM4024 the two Gigabit Ethernet copper ports and the two Gigabit Ethernet ports in the Common Options Region AMC ports 0 and 1 support IPMI over LAN IOL and Serial over LAN SOL via the Intel 1350 Gigabit Ethernet controller which is con nected to the Network Controller Sideband Interface NC SI The AM4024E provides eight Gigabit Ethernet interfaces using two Intel 1350 Gigabit Ethernet trollers Two Gigabit Ethernet copper ports 1000BASE TX are connected to the RJ 45 front panel nectors J3 and J4 two Gigabit Ethernet SerDes ports are routed to the AMC ports 0 1 in the Common Options Region and four Gigabit Ethernet SerDes ports are routed to the AMC ports
104. to the ON position T 2 3 4 Apply power to the system Wait 30 seconds and then re es are displayed move power from the system During this time period no messag Set DIP switch SW2 switch 4 to the OFF position Table 23 Fail Safe AMC Fabric Configuration www kontron com FUNCTION CONFIGURATION OF DIP SWITCH SW2 SWITCH 1 IF SET TO ON Port 2 SATA off Port 3 SATA off Ports 4 7 PCI Express Off Ports 8 11 Gigabit Ethernet Off Port 16 Debug On FCLKA PCI Express reference clock FCLKA to AMC Card edge connector disabled AM4024 E 3 2 System Write Protection The AM4024 E provides write protection for non volatile memories via the DIP switch SW2 switch 3 the uEFI Shell and a backplane pin If one of these sources is enabled the system is write protected Please contact Kontron for further information before using these functions 3 3 AM4024 E Specific Registers Table 24 AM4024 E Specific Registers ADDRESS DEVICE 0x284 Write Protection Register WPROT 0x285 Reset Status Register RSTAT 0x288 Board ID High Byte Register BIDH 0 28 Geographic Addressing Register GEOAD 0x28C Watchdog Timer Control Register WTIM 0x28D Board ID Low Byte Register BIDL 0x290 LED Configuration Register LCFG 0x291 LED Control Register LCTRL 0x292 General Purpose Output Register GPOUT 3 3 1 Write Protection Register WPROT
105. to the front panel not the module handle During seating in the connector there is a noticeable snap ping of the module into the connector When the board is seated it should be flush with the carrier or system front panel The blue HS LED turns on When the module is seated the module management power is applied and the blue HS LED turns on No payload power is applied at this time Connect all external interfacing cables to the module as required and ensure that they are properly secured Push the module handle in the Locked position Now the module is locked and the hot swap switch is actuated The blue HS LED displays long blinks When the carrier IPMI controller detects the module it sends a command to the module to perform long blinks of the blue HS LED The blue HS LED turns off indicating that the AM4024 E is operating The Intelligent Platform Management Controller on the carrier reads the Module Current Re quirements record and the AMC Point to Point Connectivity record If the module FRU infor mation is valid and the carrier can provide the necessary payload power the blue HS LED will be turned off The carrier now enables the payload power for the module If the module FRU information is invalid or the carrier cannot provide the necessary pay load power the blue HS LED stops blinking and remains lit Should this problem occur please contact Kontron www kontron com AM4024 E 8 3 2 Hot Sw
106. ts resulting from improper or inadequate maintenance or handling by the buyer unauthorized modification or misuse operation outside of the product s environmental specifications or improper installation or maintenance Kontron will not be responsible for any defects or damages to other products not supplied by Kontron that are caused by a faulty Kontron product Proprietary Note This document contains information proprietary to Kontron It may not be copied or transmitted by any means disclosed to others or stored in any retrieval system or media without the prior written consent of Kontron or one of its authorized agents The information contained in this document is to the best of our knowledge entirely correct Howev er Kontron cannot accept liability for any inaccuracies or the consequences thereof or for any liability arising from the use or application of any circuit product or example shown in this document Kontron reserves the right to change modify or improve this document or the product described here in as seen fit by Kontron without further notice Trademarks This document may include names company logos and trademarks which are registered trademarks and therefore proprietary to their respective owners Environmental Protection Statement This product has been manufactured to satisfy environmental protection requirements where possible Many of the components used structural parts printed circuit boards
107. udes receive and transmit signals as well as additional signals for handshaking mode Data transfer rates up to 115 2 kB s are supported The COMA interface can be routed to the AMC port 15 in the Extended Options Region of the AMC Card edge Connector as TTL 3 3 V signal level In this event the COMA port includes only receive and trans mit signals The following figure and table provide pinout information on the serial port connector J11 Figure 9 Serial Port Con J11 COMA Table 11 Serial Port Con J11 COMA Pinout RTS PIN SIGNAL FUNCTION Request to send 1 0 RXD Receive data TXD Transmit data CTS Clear to send GND 6 Signal ground To connect standard serial devices to the AM4024 E a specially designed serial adapter from Kontron is required For further technical or ordering information on this adapter please contact Kontron www kontron com AM4024 E 2 7 6 Mini DisplayPort The AM4024 E provides one DisplayPort interface implemented as a 20 pin standard Mini DisplayPort connector J5 on the front panel for connection to a DisplayPort DVI monitor To connect a monitor with standard DisplayPort connector or a standard DVI connector to the AM4024 E an adapter is re quired 2 7 7 SATA Interfaces The AM4024 E provides three SATA ports One SATA 6 Gb s port routed to the J7 connector which is used
108. up Battery Module Layout Top and Bottom Views www kontron com AM4024 E 8 Installation This chapter is oriented towards an application environment Some aspects may however be applica ble to a development environment 8 1 Safety To ensure personnel safety and correct operation of this product the following safety precautions must be observed All operations involving the AM4024 E require that personnel be familiar with system equipment safety requirements and the AM4024 E This product contains electrostatically sensitive components which can be seriously dam aged by electrical static discharge ESD Therefore proper handling must be ensured at all times Whenever possible unpack or pack this product only at EOS ESD safe work stations Wherea safe work station is not guaranteed it is important for the user to be electrically discharged before touching the product with his her hands or tools This is most easily done by touching a metal part of your system housing gt Donothandle this product out of its protective enclosure while it is not used for operational purposes unless it is otherwise protected gt Do not touch components connector pins or traces Kontron assumes no liability for any damage resulting from failure to comply with these requirements 8 2 General Instructions on Usage In order to maintain Kontron s product warranty this product must not be altered or modified in an
109. used for example to indicate that the shutdown process is finished and the board is ready for ex traction www kontron com AM4024 E Table 6 Module Management and Hot Swap LEDs Functions LED COLOR STATE FUNCTION LED1 Red 0ff MMC running default Out of On MMC out of service or in reset state Service LED Blinking MMC firmware upgrade LED2 Green Off Payload is off module is not powered Health Amber Red Module is healthy normal operation and all related sensors are within LED the specified range Amber Payload is on and at least one sensor is out of range Red Reserved HS LED Blue Off Module in normal operation Do not extract the module Blinking Module hot swap in progress Module is not ready for extraction On a Module ready for hot swap extraction or b Module has just been inserted in a powered system Note The status of the Module Management LEDs may be temporarily overwritten by the PICMG defined Set FRU LED State command to implement for example a lamp test 2 7 1 2 User Specific LEDs Table 7 User Specific LEDs Functions FUNCTION FUNCTION DURING BOOT UP FUNCTION DURING POWER UP POST code enabled AFTER BOOT UP ULED3 Red Power failure Processor overtemperature above 125 C blinking Processor overtemperature above 100 C on Green uEFI BIOS POST bit 3 and bit 7 AMC port 0 Ethernet link signal status
110. wing modes of operation gt Timer only mode Reset mode Interrupt mode gt Dual stage mode In dual stage mode a combination of both interrupt and reset is generated if the Watchdog is not ser viced 2 4 Battery The AM4024 E does not have any provisions for an onboard battery for backup of the RTC There is however an optional mezzanine module available which does provide battery powered backup for the RTC The RTC Backup Battery module uses the J7 connector for interfacing with the AM4024 E If this module is required the J7 interface is not available for the SATA Flash module Refer to Chapter 7 for further information on this module www kontron com AM4024 E 2 5 Flash Memory The AM4024 E provides flash interfaces for the uEFI BIOS and the SATA Flash module 2 5 1 SPI Boot Flash for uEFI BIOS The AM4024 E provides two 16 MB SPI boot flashes for two separate uEFI BIOS images a standard SPI boot flash and a recovery SPI boot flash The fail over mechanism for the uEFI BIOS recovery can be controlled via the DIP switch SW2 switch 2 The SPI boot flash includes hardware write protection func tionality which can be configured via the uEFI BIOS If write protection is enabled the SPI boot flash cannot be written to Note The uEFI BIOS code and settings are stored in the SPI boot flashes Changes made to the uEFI BIOS settings are available only in the currently selected SPI boot flash Thus switch i
111. x9 GbE 9 Receiver Carrier 79 GND Logic Ground 92 GND Logic Ground 80 FCLKA PCIe Reference Clock Carrier 91 Tx8 GbE 8 Transmitter AMC 81 FCLKA PCIe Reference Clock Carrier 90 Tx8 GbE 8 Transmitter AMC 82 GND Logic Ground 89 GND Logic Ground 83 PSO Presence 0 Carrier 88 Rx8 GbE 8 Receiver Carrier 84 PWR Payload Power Carrier 87 Rx8 GbE 8 Receiver Carrier 85 GND Logic Ground 86 GND Logic Ground The following table indicates the reserved pin which must not be connected to external circuitry Table 19 Reserved Pin s Description AMC PIN AMC PORT FUNCTION SIGNALING VOLTAGE 6 Optional PCI Express reset output ee 3 3V TTL level Note The reserved pin indicated above is reserved for optional use and must not be connected to external circuitry Failure to comply with the instruction above may cause damage to the board or result in improper system operation The following table lists the Extended Options Region pins with no differential signals Table 20 Extended Options Region Single Ended Pins Description AMC PIN AMC PORT FUNCTION 1 0 SIGNALING VOLTAGE 133 15 Tx serial port COMA 0 3 3V TTL level 132 15 Rx serial port COMA I 3 3V TTL level 127 14 Debug serial data output 0 3 3V TTL level 126 14 Debug serial clock output 0 3 3V TTL level Note The Extended Options Region pins listed above do not have differential signals They have 3 3V TTL sign
112. y way Changes or modifications to the device which are not explicitly approved by Kontron and de scribed in this manual or received from Kontron s Technical Support as a special handling instruction will void your warranty This device should only be installed in or connected to systems that fulfill all necessary technical and specific environmental requirements This applies also to the operational temperature range of the specific board version which must not be exceeded If batteries are present their temperature restric tions must be taken into account www kontron com AM4024 E 8 3 Board Installation The AM4024 E is designed for hot swap operation Hot swapping allows the coordinated insertion and extraction of modules without disrupting other operational elements within the system 8 3 1 Hot Swap Insertion Prior to following the steps below ensure that the safety requirements are met To insert the AM4024 E in a running system proceed as follows 1 Note Ensure that module handle is in the Unlocked position see Figure 7 Module Handle Posi tions Using the front panel as a grip carefully insert the module into the slot designated by the application requirements until it makes contact with the carrier backplane connector Apply pressure to the front panel until the module is properly seated in the carrier backplane connector This may require a considerable amount of force Apply pressure only

AM4024_AM4024E User Manual

Contents

Download Pdf Manuals

Related Search

Related Contents