Home

User Manual - Projector Central

Contents

1. e 1 IN 2 IN 1 OUT 2 OUT PA lt CEP fold 4 Pe D gt Co bid Pa A gt EDP o Sog e es b Ss e o S b K o ife e Se S e i i Pane i bi f g From Source FIGURE 2 27 1X3 WIRING SOLUTION Twin HDMI Input 108 311101 01 0 e 02 1 IN 2 IN 1 OUT 2 OUT LS See oS lt gt 2 gt e gt FJ 1 ae es i i 2 beq q o i i FIGURE 2 28 2X2 WIRING SOLUTION 8 ese e ye e 19 3 ROW 1 COL 1 ROW 1 COL 2 ROW 1 COL 3 a o e Yr o e Yr i Bok od i aad lt lt i Ma Bs ad os
2. Curved Screen l FIGURE 2 FLAT SCREEN Rear Screen Installations There are two basic types of rear screens diffused and optical FIGURE 2 7 CURVED SCREEN A diffused screen has a surface which spreads the light striking it Purely diffused screens have a gain of less than 1 0 The advantage of the diffused screen is its wide viewing angle similar to that of a flat screen for front screen projection This type of screen is suitable when a wide viewing angle is required but there is low ambient room lightening Optical screens take light from the projector and redirect it to increase the light intensity at the front of the screen This reduces it in other areas A viewing cone similar to that of a curved front screen installation is created This type of screen is better suited for brightly lit rooms where the audience is situated within the viewing cone 2 8 M Series User Manual 020 100009 04 Rev 1 10 2009 Screen Size Choose a screen size appropriate for your lens and application If the projector will be used to display text information the image size must allow the audience to recognize all text clearly The eye sees a letter clearly if eye to text distance is less than 150 times the height of the letter Small text located
3. ROW 2 COL 2 ROW 2 COL 3 FIGURE 2 29 2X3 LOOP THROUGH WIRING SOLUTION M Series User Manual 020 100009 04 Rev 1 10 2009 ROW 1 COL 1 ROW 1 COL 2 ROW 1 COL 3 IWa lt gt e gt lt gt e gt GJ SEG lt gt e gt lt gt is lt gt lt gt lt gt lt gt a From Sos ee T b Sg 7 e i s e eS o i i Se S S e i L ROW 2 CO ROW 2 COL 2 ROW 2 COL 3 FIGURE 2 30 2x3 SINGLE WIRING LOOP THROUGH NO PIP IS SUPPORTED e O S SS e eS S ROW 1 COL 1 ROW 1 COL 2 ROW 1 COL 3 O lt lt EG Wa lt gt lt gt lt gt lt gt a lt lt gt lt gt lt gt S From i Source 25 oe e 9 IS e o S m eg S fod oo
4. oolsiH dwe ZL dwe Buguo L L u s z dwe OL u s dwe 6 sinou s yoe dwe uaym we g uoqy sly 9luupu dq Z dwe Bueuo z nunuo2 Z z dwe 6ueuo Ire uo yoms dwel ajbuls 9 J qwny enas dwej MeN L Js qw ny euas dwe7 pio L due 65ueuo 494l 4 YOION MOII A S k dwe auey Jaquinn eliag dwe7 pio ndul a dwe B5ueuS isu lul JaMOd poN dwe Zz UUBYD IXON 6 uonei do dwe7 jauueyyD Snoad g we lt pex907 Z pales ony 9 nu lN ul S yndu 101S uoneinbyuog Ig8uueuo Z sjeuueyd Ily l l q 10 p V 95ed 99S OWEN L luo p y ojun l l q gounos ou s jauueyy l l q p veju u puueyp dog Aouenbal4 jouueyd 1Ip3 1o 5 oid siu 104 pauyap Aouenbai4 H uonei do jauueyd 59 l S la ee ee er s n adh pie SI ie lt dnjas jauuey9 4p3 jeuueyd a sl 9luugu q S sBull S 10109 s6unm s uogonp y sIoN wo Ado 6 sBumes 11842A z w s6um s ewweg L uolss iduioS SHUM g sBun s Beuu paoueapy p ds sol o Z p ds u do 9 AWAIISUBS G lqeud 10 09 L L sBuijes sui S3iuugu dq py 1ojo l q ye q ndul OL poNW uol eoo 1 dwejo 6 uollisoq SHI Z lqeu3 10 09 Ny g p lqeu3 aA 1ndul lt qq gt ni8g Z SHI 3iuueu q g a J I8A 9 398l1g lt qd gt N 9 Auq ndul lt A gt u uo S aimesadwia 10 05 Z lSASPOEIG lt A gt U9SIO y BAU 1ndul lt Iq gt p u 1u unsn pv 10109 9919S L ISABDISEIEI
5. Enter 07 to utilize this channel If you press any non numbered key the number entered up to that point is accepted and updated as the new value Press EXIT to cancel editing of numerical values Using Inputs and Channels The projector stores and recalls up to 99 different channels source setups for a variety of inputs This memory feature allows you to define and use a variety of customized setups Depending on what you have defined each physical source connection i e input at the projector can have several different channels associated with it NOTE See Section 2 Installation and Setup for a full explanation of how to connect sources to the projector How Do Select an Input Or A Channel INPUT An input is a source physically connected to the projector INPUT describes the source signal and which input slot it is connected to CHANNEL A channel is a collection of measurements locations and settings that tailor the display of a signal to your specific needs Since source types and applications can vary greatly you will likely want to adjust and define a wide variety of parameters such as brightness contrast size etc in order to customize and optimize the display from or for a particular source For example the display settings you choose for a VCR source may be very different from those you choose for a high resolution computer source Once you have adjusted a display parameter such as pixel tracking or contr
6. The projector is equipped with a 3 wire plug with a grounding pin This is a safety feature If you are unable to insert the plug into the outlet contact an electrician to have the outlet replaced NEVER defeat the safety purpose of the grounding type plug Do not allow anything to rest on the power cord Locate the power cord where persons walking on it or objects rolling over it cannot damage the cord 5 1 Section 5 Maintenance CHRISTIE 5 1 3 Lamp Precautions 5 2 5 2 1 5 2 2 A DANGER LAMPS MAY EXPLODE POSSIBLE BODILY HARM OR DEATH The lamps are under pressure and may explode causing physical injury and or property damage Allow the lamps to cool before handling or unplugging the projector Lamp replacement to be done by qualified service personnel consult User Manual or lamp kit for instructions Never attempt to access the lamp while the lamp is ON After turning the lamp OFF it is crucial that you wait at least 10 minutes before handling the lamp This provides sufficient time for the lamp cooling fans to properly cool the lamp For all other precautions critical for safe removal and replacement of the lamp refer to 5 4 Replacing the Lamps Maintenance of the Cooling System The high intensity lamps and electronics rely on a properly functioning cooling system Regular maintenance of the cooling system is critical to prevent overheating and sudden projector failure and helps ensure reliable operation Vent
7. n n sassa 2 15 2 2 6 Basie Optical Alignment siseosas nre E a AEA EREE 2 16 2 2 7 Advanced Optical Alignments xsisscstaxscessavdsesbesdeccsoavaadeuhdtsscassdantsscveeuadeasdasgoreyengobeesbatdesesaden 2 17 2 2 8 Powering DOWN siiicssedcshocansepntedetindacosianncsandaancoanscnaseselssdccaatsdadanediabotautaiaccupsssandestanndaseanstacainles 2 19 2 2 9 Connecting OMIA IC ALONG cs yiesieccvndedeaiiiasiausnudedeuanducaaniehennlaa tein sieeaeea as 2 20 2 2 10 Projector Communications sccpcazsscavnesdacencntsecasenscaraneasesaduaeshecendsastassnnedestepeantecssaaveeosneasbanes 2 25 2 3 COMMS CUMS SOuPCeS uu unusual uqukapun aS asss 2 26 3 Operation 3 1 Using the Remote Keypad or Built In Keypad n 3 1 3 1 1 Remote Keypad Commands n tones atta Guncavanceneatineeis 3 4 3 2 Navigating The lM6en S ua aanuasaasahatuashananaykaqhyyawasawissaqanaqhuiwa lanes opebeadaseauibeassousiaoeians 3 8 3 3 Using Inp OtS and Channels u uuu usapu apana yassaaaawqa wah iwaqqasaawhaqsaskaycakaa ha EER ET 3 12 3 4 Channel Setup MENU uuu aunaaaaqunaqcaqhasqhapaquqaqhakayaaaqsaqyasahakussaqkauwahyyshasqapikasa 3 14 3 5 Adj sting th Imagens annn naqa s qawasaq hawaka ead 3 17 3 6 Size and Position Menu 5a cacy oaaas en acaeasenenciesuascnacaametaeesadeasonaeiesteseuscaceresstuassaaseacesseaatacssanteseesasnneess 3 18 3 7 Image Settings MNU sssini n E E E ES 3 22 3 8 Configurati
8. FIGURE 4 17 RTE LISTING WINDOW EXAMPLE TO ADD A SYSTEM EVENT 1 Click Add to open the RTE Wizard 2 Select the System Event tab 3 Select a type of event from the System Event drop down list NOTE Depending on the selection made additional selections are made available in the second drop down list located underneath i e Input Change gt Input 1 Slot 1 See Figure 4 18 Add System Event RTE Wizard Scheduled Event System Event GPIO Event Function Key Event DMX Channel Event System Event oot up Power Good Signal Description Bain EE E Channel Change Command String GPIO Output Helper Help El Serial Representation maa FIGURE 4 18 ADD SYSTEM EVENT M Series User Manual 4 11 020 100009 04 Rev 1 10 2009 Section 4 Web User Interface To Add a GPIO Event 1 Click Add to open the RTE Wizard 2 Select the GPIO Event tab 3 For the GPIO Event option define the Input Condition field as required The Input Condition field contains 7 blocks which refer to the 7 I O pins on the GPIO connector Pin 1 12V and Pin 5 Ground are not included or changed 2 Clicking a block toggles between H L and X as shown in Figure 4 19 GPIO Event See Appendix B for detailed information To Add a Function Key Event 1 Click Add to open the RTE Wizard 2 Select the Function Key Event tab 3 Select a Function key from the drop down list as shown in Figure 4 20 Function Key Event Refer
9. 8 Blue Y 0 093 8 Blue Y 0 100 8 Blue Y 0 106 FE 9 White X 0 320 1 9 White X 0 374 8 _ 9 White X 0 323 8 _ 10 White Y 0 330 E 10 White Y 0 367 EE 10 White Y 0 359 E 11 Yellow Notch Filter s 11 Yellow Notch Filter Z 11 Yellow Notch Filter F4 12 Auto Color Enable 12 Auto Color Enable 12 Auto Color Enable 13 Color Enable 13 Color Enable 13 Color Enable 14 Copy From 14 Copy From 14 Copy From Set to User 1 4 Then copy x y values into all projector menus FIGURE 3 42 Copy X Y VALUES INTO ALL PROJECTORS 6 In each projector judge by eye and adjust x y coordinates slightly in the following manner M Series User Manual 020 100009 04 Rev 1 10 2009 CHRISTIE Section 3 Operation To match reds decrease Red X until full Color Adjustments by X Y field red screens match 1 Select Color Adjustment User 2 2 Color Temperature 6521 I e To match greens decrease Green Y until full field green screens match A ie oe i _ lt Reduce Red X Re f E To match blues increase both Blue X and 5 Green X 0 332 L Blue Y until full field blue screens match 6 Green Y 0 575 L Reduce Green Y 7 Blue X 0144 sen Increase Blue X NOTE For speed enable the Auto Color 8 Blue Y 0 093 I and Y Enable check box Each color coordinate 9 White X 0 320 g Il th call i 10 White Y 0 330 you select will then automatically
10. PIP Image Adjust e ous through PIP Size amp Position Submenu PIP menu Most controls in the PIP Size and Position menu adjust the PIP secondary Image in the same fashion as their counterparts in the main Size and Position menu POSITION PRESETS Set the location of the PIP secondary image in the display PIP Image Settings Submenu The controls adjust the PIP secondary image in the same fashion as their counter parts in the main Image Settings menu NOTE Refer to 3 7 Image Settings Menu for details of Contrast to Advanced Image Settings M Series User Manual 3 51 020 100009 04 Rev 1 10 2009 3 10 3 52 PIP BORDER WIDTH Enables the optional border around the PIP image When enabled a one pixel wide border will surround the PIP image When disabled no border will be displayed PIP BORDER COLOR This control allows you to choose the color of the optional border around the picture in picture image The border can be disabled by setting the width to zero FADE TIME Sets the amount of time in seconds it takes to fade between images on a source switch and fades in the PIP image FRAME LOCKING This option allows the projector to control the output frame timing based on the input signal The Frame Lock option forces if possible the output image to be phase locked to the input frames When Frame Locked the output is always locked to the primary input and never to the PIP image Free Run sets the output to
11. Refer to Figure 3 1 Remote Keypad for the description of those keys provided for the remote keypad AY Ete Laser radiation is emitted from the laser diode in the remote DO NOT look directly into the beam of the laser M Series User Manual 3 1 020 100009 04 Rev 1 10 2009 Section 3 Operation Remote Keypad Test e Display a test pattern Power e Turn projector ON or OFF Plug In for Remote Keypad Left side of remote keypad Slots e Display the source from the next active input on the card in the selected slot NOTE If PIP is on Input keys affect the PIP window only Input e Select an active or inactive input on any slot PIP Turn picture in picture ON or OFF Menu Display menus Arrow Keys Adjust a setting up or down e Navigate within a menu Channel e Select channel setup Laser e Activate laser pointer at front of keypad Gamma Adjust mid range levels Number Keys e Enter a number such as channel value etc NOTE Can be set to select inputs if desired Nelp e Display context sensitive help toggle TOGGLE KEYS CHAKISTIE Laser Pointer Status LED Activated when Laser pressed Shutter Open or close the Shutter Auto e Optimize image automatically Lens Functions Use lt and keys to adjust parameters OSD Use to hide or show menus Press OSDW to turn Off Swap Swa
12. Best results are obtained with defined channels Otherwise switching from one video source to another can sometimes cause slight disturbances in the display indicating that the Auto function is struggling Recover by briefly selecting a different video standard then going back Table 3 3 Regions and Video Standards Summary STANDARD WHERE USED Subject to Change PAL Most of Europe China Australia some of S America some of Africa NTSC N America and Japan SECAM France Eastern Europe most of Africa NTSC 4 43 A tape only standard for partially translated hybrid signals PAL M Brazil PAL NC Argentina Chile other Latin American countries PAL 60 NOTE Generally use Auto for all instances except a poor quality input signal or a black and white video signal In order to detect and display such signals select the relevant standard from the list e INPUT VIDEO BLACK This control compensates for incoming elevated black levels present in certain video signals and ensures that blacks in the display are neither crushed i e where dark grays appear black nor excessively elevated i e where blacks appear dark gray By default the projector automatically determines the best setting according to the type of incoming video signal 0 IRE Used for DVD output with enhanced black SECAM most PAL standards and Japanese NTSC 7 5 IRE Used for most NTSC video signa
13. Disable use of warps or 2D Keystone 2 Enable edge blending if not enabled 3 Enable Black Level Blending 4 Power down the projector then power up again Adjustments can now be made to black level controls To restore the use of Christie Twist 1 Disable black blending 2 Power cycle the projector 3 Begin using the Twist controls Black Level Blending Procedure NOTES 1 Adjust white levels before adjusting black levels 2 The zones in BLB menu correspond to the Edge Blend zones If a given Edge Blend zone width is set to 0 i e no blend on that side then the corresponding BLB zone is disabled It only becomes accessible when that Edge Blend zone is active 1 Start with two projectors Select the black test pattern for both projectors from the Geometry and Color submenu 2 Inthe Black Level Blending submenu enable black blending by putting a checkmark in the check box for each projector 3 Working with one projector at a time use the center brightness slide bar to adjust the center brightness brightness of the non blended region so that the center intensity matches that of the brightest blended region the center of all images when blending a 2 x 2 display is the target area 4 Use the following three color slide bars Black Red Level Black Green Level and Black Blue Level so the black hue of each projector matches 5 You can choose which of the next four options Top Bottom Left Right to use depending o
14. It takes approximately 10 seconds for the projector to respond at its new address TCP PORT On some Ethernet networks firewall restrictions may require that the port number of the projector be changed from its default of 3002 If so enter a new valid port number here It is highly recommended not to use a port below 1000 as these ports are typically reserved for and used by common IP applications SUBNET MASK Subnet Mask determines the subnet for the IP address and must be set manually e DEFAULT GATEWAY This is the IP address of the gateway used to reach any non local IP addresses it must be set manually HOST NAME Set the hostname for the device DOMAIN NAME Set the domain for the device MAC ADDRESS Displays the MAC address of the projector read only e BROADCAST KEYS Use Broadcast Keys to relay all key presses received by the projector to all other projectors on the network FRONT IR ENABLED Enable or disable the IR sensor on the front of the projector e REAR IR ENABLED Enable or disable the IR sensor on the rear of the projector WIRED KEYPAD ENABLED Enable or disable the interface for the wired keypad on the rear of the projector M Series User Manual 3 37 020 100009 04 Rev 1 10 2009 3 38 DMX ArtNET Submenu The projector supports the DMX512 protocol through both the DMXC option card and through the ArtNet communications via the Ethernet connector Both input methods share the same
15. J id n u N uu 1 jeq sISsy ue dui ISAO 6 aw pes uonei u B6 xi dwe g snes uolyeuque ul sayy Aqpueys 1 lud Z uonisoq woH sy uw aayy bew YO uni 9 dnyejs uo ayeiqueo 9 lqeu3 umopny ny S Su 1 MON UO l uiqileO S dn 1 mod Ony oe hak ayesigued ML yu snoog uuooz jenuey Z qybipjoeg qO1 L uu s s su 7 us 6ill lul jJu ui BeuelN JaMod sBum s su 1 Kou nb 13g uny 8913 9 Aejaq uueid G Bulyoo7 aswel py paslaesay panlasay Z uonejuano ewj u 15s suondo jndjno suj 9lutgu q ZL sBumjes pied uondo L L 9 A19S OL uoleiqieo g sonsouberq 10 09 An uuo o SUOEIIUNWWOD s ou 1u J iq nu N Sul 8 3q ju uiu B5eueN Jamod s6un s su 7 suondo 1ndino BenBue 7 uoneinBijuoS QN c r LO O O O gt uj led S L 6 oabenbue7 g did Burysymg ynduy snjejs 9 dwe uol unBijuoo y dnjas I uugu2o g s6um s B6eulil z uonisod pue z S L nua Uew p nul uo5 nuayy pesueapy M Series User Manual 020 100009 04 Rev 1 10 2009 A 4 Menu Tree Appendix A CHRISTIE wo Ado 9 SHUM JO Hed anig S SUYM JO Hed U93919 y SUUM JO Hed pay goeds 10109 PIILA jugjeainba A x Ag aunyesadwia JOjOD Z 1u unsn pvy 10109 158l S syu uysnfpy 101
16. The presence of any activity within this combined interval will cancel Auto Shutdown and return the projector to normal operation e TURN OFF IMAGE AFTER min This sets the activation interval in minutes for Auto Shutdown If all activity input signals web or serial port activity key presses is lost for this length of time and Auto Shutdown is enabled an Auto Shutdown cycle will begin e ENTER STANDBY AFTER min This sets the interval in minutes between starting Auto Shutdown and entering Standby mode Once Auto Shutdown has been entered and all activity continues to be absent for this interval the projector will automatically enter power Standby mode e LAMP REGENERATION START TIME For 24 7 operation the lamp regeneration cycle is required or lamp life will be reduced This control allows you to set the time of day in 24 hour format when the regeneration cycle will start In Dual Lamp mode the cycle will be performed on each lamp separately The second lamp will wait for the first lamp to come back on before it begins the cycle In single lamp mode the projector will go into Standby mode for the regeneration cycle The regeneration cycle will run for 15 minutes for each lamp The lamp s must run for a minimum of 24 hours or the regeneration cycle will be skipped e OVER TEMP FAN ASSIST When enabled this option will cause all fans to come on at full speed if any enabled thermal sensor has an over temperature fault This
17. d Page SVSUSDI uu uu lapan qasaqasa ca hawasaaawass qayakuspa wasaqkuyasqpawwsaya 4 6 4 3 6 Admin Tabbed Page Sers unan qasasaaqshkasaqha awaqa qsqapaayqaaahasqaaiyasshaqhasqaa 4 8 4 3 7 Advanced Tabbed Page RTE uuu uuu au aaassaanhusanainaasaphusayayasqa sawas aanayyayqasakykya qa 4 9 4 3 8 About Tabbed Page cas ccusesssacencarvcecexuteescevanssaveneantsasseapvatanatensteodniccasuanrqoaseanbaronetinaensanteannents 4 12 5 Maintenance 5 1 Safety Warnings and CiUPeliNeS cz ccccscxcaceseconnaszaasvncssteessenteecssnacasucwsnstancvsuantasasenseadenautssensuacsacnnents 5 1 5 1 General Precautions u uu nun unn aS Sut Sm tiyaku oe ee 5 1 5 12 AC Power Pie CAINS ac ccacecaeccvecsanacsictesctoiacernesesenadicsnenextadareees ee ean 5 1 5 13 Lamp PrecautIons uu aun aqasha na aaa aaa ds E E EEA EREE EE 5 2 5 2 Maintenance of the Cooling System 5 2 5 21 Ventilati nu aun sani anaa annaa raa EEE ERA EEA AAEE eN AEE di KELAPAN EREEREER ar eine 5 2 35 2 2 Optional Filtrs essiant aisneis 5 2 5 3 Maintenance of Optics l nn nn sceecasieswaaatcneuenes eeenaamaeosanttartaness 5 3 5 3 1 Optical Excluding Lens cusascancaveneiancstaiiangsdoatanasreidecesapnaeie aeons aoe 5 3 5 3 2 CNA he Een8g uu uu sn aaa a aska aan qapaq pham a R E paka Ma qasa 5 4 5 4 Repl cine th e Lamps uyan naa aqa hanan hagas EE AEA E EEEE 5 4
18. gt lt gt for Me lt gt gt fod 1 ses E Ezra 2 Er i i SeZeLeLeLn e i ijo Srbe ece ej ii H ki i il ple lt gt lt gt Ss sod s ise Skee o FIGURE 2 26 USE OF DISTRIBUTION BOX Christie loop through may be used to set up a tiling array see Figure 2 26 to Figure 2 31 The system allows wiring providing the HDCP requirement is met when HDCP is used by the source The cascade level of devices must be less than 7 levels deep NOTE Jf single wire loop through is used See Figure 2 30 then PIP is not supported The wiring diagrams are provided to e Meet the HDCP requirement e Minimize the length of HDMI cables to be used and e Balance the connection tree to ensure the level of loop through is minimized NOTE This is to enable the downstream projectors to finish source switches in a minimum amount of time Applicable to arrays with HDCP only M Series User Manual 2 29 020 100009 04 Rev 1 10 2009 Section 2 Installation and Setup From Source 2 30 Twin HDMI Input 108 311101 01 O Se 2 ee Oe S CHRISTIE
19. lt i pon Z Sums 10109 Me 19497 Ndu olnv L u 190 1IIdS y SI A 11ndul uononp y sIoN olinbsoN uoljonpay Joey x5olg Z uey uoneznueno g9Y ZL uojonpay SION L Uu 15S PAS L L s6umas abe pasuenpy sBun s uoHONpay SION 1senuooS Andepv OL senal ndul 9 el q euun1 euuo1u 6 suondo o plA S u 5S yids y9 98q pol Wl 9 oeds 10109 p 1oousi AO 8 9q y poN Buljdwes Z JO 1 4 YOION MOII A PIOUSOIULL HEISE 9 Ss uluBug Z 1u uu oueuu3 1n x Z IL S 1senuoO i Itej q L 40 05 f sBulyes Beuu sBum s 112420 _ yoelg o piA 1ndul piepue S o piA Z wayed 1s81 dols ewweg SW snooeq ela Bulyuelg 6 Sy al th 6 uojoun4 ewweg d dnas ojny uo padsy d y g 18 ewes Z SUOHCO COPIA UOSAN did 9 Bulyoyms 1ndul uoll9911o9 ewweg uonisoq H 9 pee 9 sBumesewweg e yuerg uB seud I xId S 19 yuejg 497 E 3981 XId F hc etna oe yuejg woog z YOJOS JEJA ih SI 6 49 E yuejg dol aZIS Z sbuljag beuul lt MOpuIM ndul AloV S S Jd ZIS Y L UOHISOd 9 ZIS L 6uryuejg k lt lt uonisod z S nua u elN uleyy p 2ueApy M Series User Manual 020 100009 04 Rev 1 10 2009 CHAISTIE Menu Tree A Append z WdinO 10 pON XL Z Indul 104 sujui GIGS k 1ndinO 104 pON XI 1ndul 104 suwi GIGS paeo yndu INAH UML N c r lqeud 10 09 L
20. 15 73 kHz V Frequency 59 94 Hz Interlaced Yes Sync Source S Video Name 15 73kHz i59 94Hz Channel Slot Input In Menu Auto Select Locked Previous Channel Next Channel INI 7 gt gt G2 Go I Ges So SS FIGURE 3 16 CHANNEL EDIT CHANNEL EDIT STEP 3 If desired review and or edit the following channel setups in the Channel Edit menu NAME An alphanumeric label can be defined and or changed here Channel names can be up to 12 characters in length The default name is the horizontal and vertical sync frequencies CHANNEL A two digit channel number can be changed here NOTES 1 If you enter a channel number that already exists a dialog message appears indicating that this number is already in use assign a different channel number 2 You can define up to 99 channels SLOT 1 4 corresponding to which slot in the projector s input panel the source is connected INPUT 1 6 corresponding to which input on the selected slot the source is connected to IN MENU If checked default except for automatically defined channels with unchanged parameters this defined channel will then appear in the list available when CHANNEL key is pressed If unchecked the channel must be accessed via CHANNEL on the keypad or via the Auto Source function NOTE On screen display of the channel list is an option that must be set in the Menu Preferences menu AUTO SELECT If checked defau
21. 3 32 NETWORK ROUTING LIST 3 36 M Series User Manual 020 100009 04 Rev 1 10 2009 Separate Select Separate factory default to keep RS 232 RS 422 and Ethernet messages on their respective paths instead of being broadcast to the other types of ports refer to Section 2 Installation and Setup Figure 2 19 Connecting RS 232 to Figure 2 24 Communicating To All Ports RS 232 and RS 422 Joined Messages originating from an RS 232 or RS 422 controller will be relayed to all RS 232or RS 422 ports Any Ethernet communication however will not RS 232 and Ethernet Joined Messages to and from the RS 232 ports will also be relayed to the Ethernet port and vice versa Any RS 422 communications will be isolated In the case of multiple Ethernet sessions over the single Ethernet connector input on the RS 232 port will be relayed to all Ethernet sessions however input from any Ethernet session will only be relayed to the RS 232 ports All Joined All messages reach all ports regardless of type in the case of multiple Ethernet sessions input on one Ethernet session will be relayed to all other Ethernet sessions as well as to the RS 232 and RS 422 ports ETHERNET SETTINGS NOTE Recommended for network administrators only IP ADDRESS Enter a valid and unique IP address for use on the network to which the projector is currently connected This address will overwrite any previous IP address such as the projector s factory defined default
22. 7 5 5 Ethernet Number of ports Standard Connector 7 5 6 USB 2 0 Device Port Number of ports Standard Connector Max bit rate 7 5 7 GPIO Number of I O Lines Connector Output sink current logic low Power output 7 5 8 Built In Keypad and Display Key type Display type 7 5 9 AMX Crestron Support AMX Device Discovery Partner Crestron Integrated Partner 7 10 CHRISTIE 1 1 female 9 pin Dsub 115 2 kbps 12 V 5 400mA maximum 1 10 100 Base T Female RJ 45 1 Supports mass storage device type Ethernet device type and or serial device type USB type B full size 3 12 Mbps high speed 480 Mbps not supported 7 Male 9 pin Dsub 100 mA 1V typical 12 V 5 400mA maximum Soft touch keys Graphics LCD backlight M Series User Manual 020 100009 04 Rev 1 10 2009 7 6 Power Requirements Rated voltage 100 VAC 240 VAC Rated Current duallamp operation 370W 1080p 12 A 100 VAC 200 W 1080p 9A 100 VAC 370W SXGA 12 A 100 VAC 200W SXGA 9A 100 VAC 370W WUXGA 12 A 100 VAC 200 W WUXGA 9A 100 VAC 370W WXGA 12 A 100 VAC 200W WXGA 9A 100 VAC Line frequency 50 60 Hz AC Input Coupler 15 A 250 VAC Type of connector IEC 320 C14 with wire cable clamp Line Cord 14AWG type FT1 with plug NEMA 5 15P 15A Inrush Current 60 A max Maximum Power Consumption Dual Lamp Single Lamp 370 W 1080p 1320 W 831 W 350 W 1080p 1267 W 805 W 300 W 1080p 1135 W 739 W 200 W 1080p 871 W 607
23. 7 7 2 Adjustment Product Alignment 7 7 3 Weight Maximum product weight with lens removed Maximum shipping weight includes packaging 7 7 4 Operating Position Horizontal Inverted Rotation 7 8 Reliability and Serviceability 7 8 1 Reliability MTBF excluding consumable components Consumable components 7 8 2 Serviceability Time to replace any option card Time to replace lamp Time to replace projection lens Time to replace air filter 7 12 CHRISTIE Mercury Lamp Hg 300 W min 370 W max software adjustable 150 W min 200 W max software adjustable 150W only not software adjustable 1300 hrs typical 370W 1500 hrs typical 350W 2000 hrs typical 300W 2000 hrs typical 200W 3000 hrs typical 150W 5 minutes max 20 deg max tilt of lamp axis from horizontal 561mm 22 1 x 500mm 19 7 x 247mm 9 75 775mm 30 5 x 698 5mm 27 5 x 584mm 23 2 of vertical adjustment on 2 front feet 1 of vertical adjustment on single rear foot 25kg 551b 40kg 871b 20 degrees allowable rotation about lens axis 20 degrees allowable rotation about lens axis 180 degrees perpendicular to lens axis 15 000 hrs Air filters fans lamps 1 minute 1 minute 30 seconds 1 minute M Series User Manual 020 100009 04 Rev 1 10 2009 CHRISTIE 7 9 Environment 7 9 1 Temperature Humidity Altitude Operating temperature range Storage temperature range Humidity ra
24. Colors can be enabled disabled by entering the corresponding function code listed on the back of the standard remote keypad INPUT PEAK DETECTOR A fast method for defining individual input levels and improving the accuracy of input levels set by the Auto Input Level function Enabling the Peak Detector activates a special operating mode for detecting only pixels that are considered black or white all other levels are displayed as a mid level gray When used with a 16 step grayscale pattern in which the two black and white bands are known to be at opposite edges of the image you can watch these isolated areas while adjusting individual black levels and input drives until both bands are just visible Images from this source will then display correct blacks and whites without crushing or washing out NOTE Jf using Peak Detector with PIP both images must have the same color space e INPUT LEVEL DETECTOR The Input Level Detector check box enables specific thresholds for blacks and whites Input levels that fall below a specified level value see below are displayed as black and all others are displayed as white To use Enable Input Level Detector and display a continuous grayscale Set Level Detector Threshold to near black such as 200 Adjust Offsets to minimize area of black stripe Set Level Detector Threshold to near white such as 800 ce Se tA Adjust Gains to minimize area of white stripe LEVLE DETECTOR THRESHOLD Input
25. Drives or colors can be driven on the basis of color temperature For most applications one of these gamuts will produce accurate and realistic colors from a variety of sources They can be applied at any time in the Advanced Image Settings menu Select Color Adjustment and are not adjustable DEFINING USER COLOR GAMUTS You may find the pre defined Select Color Adjustment options do not suit your needs For example you may require a unique color gamut range for a single projector or application or you may need to precisely match colors across multiple adjacent displays In such cases use the Color Adjustments by X Y or Color Saturation submenu to define the precise hue of each primary color component red green blue and white used to generate the millions of colors produced in displays You can create up to four custom color gamuts User 1 2 3 or 4 with these adjustments NOTE The two menus differ only in their user interface so use whichever menu best suits your needs and application A color meter can help with adjustments Use this submenu to create alter or copy a color gamut 1 e color adjustment Controls in this menu define the precise hue of each primary color component red green blue and white used to generate the millions of colors produced in displays The x y coordinates for each color define its location on the standard CIE chromaticity graph see Figure 3 38 CIE 1931 Chromaticity Diagram
26. FOR THE FUNCTION HAVE FIRST BEEN SELECTED FROM THE DROP DOWN LISTS AND OTHER FIELDS ON THE LEFT THE M SERIES SOFTWARE UPGRADE INSTRUCTION SHEET P N 020 100267 Xx THIS BUTTON IS DISABLED IF THE PROJECTOR IS NOT IN STANDBY MODE HIDE BUTTON ALLOWS YOU TO DISABLE THE DISPLAY OF THE HELP TEXT Uploading a Logo File or Gamma File Important The projector must be powered on to enable the Upload drop down list 1 2 3 Click the Upload Browse button to open the Choose file window Locate and select the file you wish to upload from a Network drive location or from your hard drive Select the file type Logo or Gamma from the Upload drop down list NOTE Zfyou select a Logo file type it MUST be a 24 bit bitmap file This enables the Logo Position and Background Color section Proceed to Step 3a If you select a Gamma file type it MUST be a csv file with 1024 values all colors same or 1024 x 3 for individual colors This enables the Gamma Properties section Proceed to Step 4a a Enter the Logo position for the X and Y fields b Click the Color square to open the Choose Background Color window choose the desired background color from the color palette and click OK The color square changes to the selected color c Click the Upload button to display the Logo Upload window Click Yes or No to confirm or cancel the upload An Upload in Progress window appears M Series User Manual 020 1
27. Lens Reset procedure on every power up This is useful if the lens is subject to manual movement between power sessions e HOME POSITION Return the lens to the horizontal and vertical home position Focus and zoom are unaffected M Series User Manual 3 33 020 100009 04 Rev 1 10 2009 3 34 e CALIBRATION STATUS This control displays the current lens calibration status POWER MANAGEMENT LCD BACKLIGHT The backlight for the LCD has 3 states Always On Always Off or Timer The backlight will turn on again when any key on the LCD is pressed or if an alarm is raised LCD BACKLIGHT TIMER Set how long the LCD backlight stays on in seconds when in timer mode LCD BACKLIGHT LEVEL Sets the LCD backlight brightness level Maximum 25 Minimum 0 AUTO POWER UP If there is an AC power interruption while Auto Power Up is enabled the projector will resume operation in the same state as it left off If the lamps are on and an image showing when AC power is lost the projector will automatically power back up with the lamps on and an image will show when AC is restored e AUTO SHUTDOWN ENABLE When Auto Shutdown Mode has been selected and no projector activity has been seen for the activation time out period the projector will enter a power saving mode in which the lamps will dim and the shutter will close If this condition persists for an additional time out period the projector will automatically go to Standby mode
28. Level Value defines the value to be used by the Input Level Detector in recognizing blacks and whites See Input Level Detector above ASPECT RATIO OVERLAY Check this box to display an overlay pattern over the image The overlay shows the boxes corresponding to the size and shape of different aspect ratios TEST PATTERN COLOR SWAP This function swaps the green and red color when drawing the Grid test pattern and may be helpful when adjusting convergence on the projector CALIBRATE LITELOC The LiteLoc calibration process must be run to calibrate the LiteLoc sensor on all model types Constant Intensity mode cannot operate correctly if the calibration has not been performed The calibration must be done in Dual Lamp mode after the lamps have warmed up for at least 5 minutes NOTE The shutter will close for the duration of the calibration and will automatically open again when the calibration is complete e FREEZE IMAGE DURING AUTO SETUP If selected this will hide temporary image artifacts that may appear during the auto setup procedure M Series User Manual 020 100009 04 Rev 1 10 2009 CHRISTIE 3 9 Section 3 Operation Option Card Settings Submenu Allows adjustment of any settings specific to each option card that is currently installed in the projector DYNAMIC IRIS Refer to Image Settings gt Advanced Image Settings Input Switching amp PIP Menu Input Switching amp PIP 1
29. Main Input Video decoder Input card Slot 1 Input 27 Use the Input Switching amp PIP menu to enable 2 PIP Input Analog BNC Input card Slot 2 Input 2 v 3 Swap Main and PIP images and define how you want to use PIP 4 PIP Enable 7 NOTE To control the primary image access all 7 as s J picture controls through the Main menu To 7 PIP Border Width 5 m gt control the secondary PIP image access 8 PIP Border Color Black Y tah 9 Fade Time 75 maman picture controls through the Input Switching amp 10 Frame Locking Free Run Picture in Picture menu 11 Auto Input Searching 7 MAIN INPUT From the list of active inputs select one to be used as the primary or main image FIGURE 3 39 INPUT SWITCHING amp PIP MENU PIP INPUT From the list of active inputs select one to be used as the secondary or PIP SWAP MAIN AND PIP IMAGES Toggle the current PIP relationship so that the primary main image becomes secondary PIP and the secondary image becomes primary Swapping is available only when PIP is enabled NOTE There may be a slight delay when swapping the Primary and Secondary images PIP ENABLE Short cut Press PIP on the Remote if menu not Primary present Image Toggle between displaying two sources at once Agjust 88 ptay ng through Main and PIP images and the primary or main Main menu source only This check box turns the secondary navigation Secondary source on and off
30. Power No Action 25 75 On Off range within the 5 seconds the timer will Power On qv toy Seu 19 Reserved 20 Reserved Auto Select Single Lamp 0 50 21 Lamp Operation Dual Lamp Mode 50 100 22 Lamp Power Scaled as of total control range M Series Setup Guide 020 100011 04 Rev 1 10 2009 Appendix C DMX ArtNet CHRISTIE Channel Name Description Value Notes 23 Brightness Scaled as of total control range 24 Contrast Scaled as of total control range 25 Gamma Scaled as of total control range RGB 0 33 26 Color Space YCbCr SDTV ITU R BT 601 33 66 YCbCr HDTV ITU R BT 709 66 100 27 Size Scaled as of total control range Max Drives 14 5 Color Temperature 47 18 SD Video 79 30 HD Video 111 43 28 Output Color User 1 143 56 User 2 175 68 User 3 207 81 User 4 240 94 29 Interpolated Color Scaled as of total control range Temperature Output Color control must be set to Color Temperature 30 Vertical Stretch Scaled as of total control range Off 9 3 Grid 32 12 Grey Scale 16 53 20 White 74 29 Flat Grey 96 37 Black 117 45 31 Test Patterns Checker 138 54 13 Point 160 62 Color Bars 181 70 Aspect Ratio 202 79 Edge Blend 224 87 Boresight 246 96 32 PIP Enable PIP Disable 0 25 No Action 25 75 C 6 M Series Setup Guide 020 1
31. Press MENU to enter or exit the projector s menu system OSD On screen display Press OSD then the DOWN ARROW to hide the projector s menu system during use To see the menus again do one of the following Press and hold OSD for two seconds Press and release OSD followed immediately by UP ARROW Press OSD OSD Invisible menus are fully functional enabling hidden access to numbered features and image adjustments by entering the corresponding sequence of key presses on the keypad NOTE With OSD on you can still hide error messages and slide bars by disabling these options in the Menu Preferences menu Shutter Press and hold SHUTTER for two seconds to toggle the internal mechanical shutter blade closed or open with a single keystroke Or press and release SHUTTER followed immediately by UP ARROW KEY closed or DOWN ARROW KEY open to guarantee the correct state useful if you are unsure of the present state Alternatively press SHUTTER SHUTTER to toggle from the present on off state A closed shutter blanks the display turns it to black Close the shutter to block the displayed image while maintaining access to projector functions Opening the shutter restores the image NOTES 1 The LCD display shows the current state of the shutter 2 The shutter is open upon power up M Series User Manual 020 100009 04 Rev 1 10 2009 CHAISTIE Section 3 Operation Function Key IF WITHIN A NUMERIC FIELD IN A
32. RGB and will incorrectly decode their color information as YPbPr video These signals can include e RGB signals in NTSC PAL SECAM frequency ranges Scan doubled sync on green Scan quadrupled sync on green For these signals change the color Space to RGB and then define a new channel for future use Video Options Submenu This submenu is used with video sources only ENABLE DECODER AGC AGC affects decoded video images only Enter a checkmark default in most instances Activate the decoder s AGC circuit to ensure properly bright images Delete the checkmark if a decoded video image exhibits strange color artifacts such as stripes in highly saturated colors indicating an incompatibility between this source and the AGC M Series User Manual 3 23 020 100009 04 Rev 1 10 2009 e VIDEO STANDARD For most video standards available in the world the projector automatically detects the incoming horizontal and vertical frequencies and sets the projector s processing of this signal to the corresponding standard The current video standard name appears in the Video Options submenu and includes an A if it is auto detected Press ENTER to view or select a different video standard from those available to the projector any that are disabled have frequency characteristics that differ from those of the incoming signal Selecting a specific standard forces the projector to process the signal according to this standard NOTE
33. Section 4 Web User Interface This configuration is useful if you are using a non RS 232 controller with the RS 232 linking available between these projectors For example you may want to use both an RS 422 compatible controller and an Ethernet connected PC for working with a network of projectors linked via their RS 232 in out ports M Series User Manual 2 23 020 100009 04 Rev 1 10 2009 Section 2 Installation and Setup CHKISTIE FIGURE 2 24 COMMUNICATING TO ALL PORTS To isolate just RS 422 communications select RS 232 and Ethernet Joined In Figure Figure 2 25 Input Panel only projector 1 will respond to the RS 422 controller To isolate just Ethernet communications select RS 232 and RS 422 Joined only projector 1 will respond via Ethernet System Integration GPIO Connector The GPIO connector on the input panel interface Figure 2 20 Connecting RS 422 provides a method of interfacing a wide range of external I O devices Refer to Appendix B Figure B 1 GPIO Connector for complete details on pin configuration and how to program the GPIO Serial Communication a sat E gt Ge Gx Ethernet USB GPIO RS232 IN RS232 OUT Standard Image Processor 108 315101 01 OPTIONAL Option Cards FIGURE 2 25 INPUT PANEL 2 24 M Series User Manual 020 100009 04 Rev 1 10 2009 CHRISTIE Section 2 Installation and Setup 2 2 10 Projector Communications Status LEDs Looking from the bac
34. Server Projector DLP Address Projector Mgmt IP Address Subnet Mask M Series User Manual 020 100009 04 Rev 1 10 2009 1 3 1 3 1 1 3 2 1 3 3 1 3 4 Projector Overview The M Series is a family of high resolution video graphics 3 chip 1080p HD SXGA WUXGA and WXGA projectors see Table 1 3 M Series Projectors These projectors are based on next generation DLP technology provided by Texas Instruments How the Projector Works The projector accepts data graphics and video input signals for projection onto front or rear screens Light is generated by dual FIGURE 1 1 M SERIES mercury lamps then modulated by three Digital Micro mirror Device DMD panels that provide digitized red green or blue color information Light from the ON pixels of each panel is reflected converged and then projected to the screen through a single front lens where all pixels are perfectly superimposed as a sharp full color image User Interface Overview The projector can be controlled via a menu system displayed on the image The menu system can be controlled by an IR remote wired remote or through the built in keypad The LCD screen and built in keypad allow some functions to be controlled without the need of an OSD display and provide a quickly accessible interface to view error reporting The functions on the OSD can also be controlled using the Christie Serial Protocol via a serial or Ethernet c
35. Severe Motion Artifacts au unsevaxena dna eae neta leon ooneeanactexetenes 6 3 ii M Series User Manual 020 100009 04 Rev 1 10 2009 CHIS TIE Table of Contents 6 7 3 Image Appears Squeezed or Vertically Stretched into Center of Screen 6 4 6 7 4 The Display is Jittery or ist Is phcsessacseoinaincennnstaxtbontavatssoncs ouspesianieoanupessedusceutanetnseezuvtes 6 4 6 7 5 Th Display IS F3Inti as ennncesecsecutacveaudeeatenancsdeesusecau nem eSEE Ca SERER eat O aiani enea 6 4 6 7 6 The Upper Portion of the Display is Waving Tearing or JitterIng 6 4 6 7 7 Portions of the Display are Cut Off or Warped to the Opposite edge 6 4 6 7 8 Display Appears Compressed Vertically Stretched 6 4 6 9 Datais Cropped from Edges uuu u a apaq Ese EEE EEN EA EEEE KEE 6 4 6 7 10 Display Quality Appears to Drift from Good to Bad Bad to Good 6 4 6 7 11 Display has Suddenly Frozen n nn nnsssssnsasssss 6 5 6 7 12 Colors in the Display are Inaccurate n ana 6 5 6 7 13 Display is Not Rectangular a asa asnsssashasaaawapasiskapaaasashaysakapanahyyssqaqasha 6 5 0 7 l4 Display IS NOISY uka asna ia maaan qata uu a aaa e a Eai aiaa 6 5 6 8 Web Interface scr
36. Stretch H Position V Position and or Blanking FIGURE 3 18 RESIZE PRESETS M Series User Manual 020 100009 04 Rev 1 10 2009 CHAISTIE Section 3 Operation WHAT IS THE RESIZING DEFAULT By default when displaying a new source your image will utilize as much of the projector s display area as possible for the type of incoming source data but with minimal or no changes to aspect ratio See Select Default below The Custom re size descriptor automatically appears in the Size and Position menu when any of the values for Size Vertical Stretch H Position V Position or Blanking do not correspond to those for a preset This option is not offered in the Resize Presets pull down list e Select DEFAULT for most sources factory default The image will be centered and displayed as large as possible depending on the type of source If PC or non HDTV If video or 4 3 graphics If 5 4 graphics If HDTV anamorphic signal 1050 i e x 3 1400 Approx 1312 1400 1400 FIGURE 3 19 RESIZING DEFAULT NO RESIZING displays the image in its native resolution which may or may not match the projector s resolution For example for a source with a native resolution of 800 x 600 No Resizing in an SXGA projector will use the central 800 x 600 pixels and have a black border the black border areas are unused areas see below No Resizing If 800 x 600 signal I
37. User Manual 020 100009 04 Rev 1 10 2009 CHAISTIE Section 2 Installation and Setup FIGURE 2 13 FOLDED OPTICAL PATH 2 2 7 Advanced Optical Alignment Boresight Alignment Procedure 1 Display the Boresight Test Pattern by pressing the TEST key on the remote keypad or use the built in keypad and press the soft key that displays Test on the LCD display then UP ARROW KEY to cycle to Boresight then Enter see Figure 2 14 Boresight Pattern FIGURE 2 14 BORESIGHT PATTERN 2 Focus the image on cross hair pattern I Evaluate the focus on cross hair image II and III If all 3 images are in focus no further action is required If boresight is required see step 3 3 Ifboresight is required refer to Figure 2 15 Cross Hair Pattern to understand how the adjustment screws on the lens mount affect the corresponding cross hairs on the test pattern 4 Use a 5mm Allen key to loosen the 3 locking setscrews on the lens mount see Figure 2 16 Screw Locations below NOTE The setscrews must be backed out several turns so that they do not contact the inner lens mount plate M Series User Manual 2 17 020 100009 04 Rev 1 10 2009 A Capscrew B Setscrew FIGURE 2 15 CROSS HAIR PATTERN FIGURE 2 16 SCREW LOCATIONS 5 Fine tune the focus of cross hair pattern I by adjusting the appropriate capscrew see Figure 2 16 Screw Locations Adjust until the cross hair image is in focus with
38. View Favorites Tools Help mywebsearch Conve Delete Browsing History Le di O Christie Digtal Pop up Blocker Phishing Fiter Manage Add ons Windows Messenger ProxyPal Main Input Send to OneNote Sun Java Console No inputs available Intern jons m rc r General Security Privacy Content Connections Programs Advanced iy settings Internet Local intranet Trusted sites Restricted si Internet J gt Sites This zone is for Internet websites except those ited in trusted and restricted zones Security level for this zone Allowed levels for this zone Medium to High Medium high 1 Appropriate for most websites Prompts before downloading potentially unsafe tent Unsigned Activex controls will not be downloaded Reset all zones to default level ok Cancel Apply Security Settings Internet Zone x Settings Downloads 2 S Automatic prompting for file downloads Disable Enable lt _ _ __ 88 File download Disable enable lt lt 88 Font dovnload l O Disable Enable O Promot S Enable NET Framework setup Disable Takes effect after you restart Internet Explorer Reset custom settings Resetto Medum high default xl Reset ee CE Are you sure you want to change the settings for this zone FIGURE 6 1 M Series Use
39. W 150 W 1080p 739 W 541 W 370 W SXGA 1320 W 831 W 350 W SXGA 1267 W 805 W 300 W SXGA 1135 W 739 W 200 W SXGA 871 W 607 W 150 W SXGA 739 W 541 W 370 W WUXGA 1320 W 831 W 350 W WUXGA 1267 W 805 W 300 W WUXGA 1135 W 739 W 200 W WUXGA 871W 607 W 150 W WUXGA 739W 541 W 370 W WXGA 1320 W 831 W 350 W WXGA 1267 W 805 W 300 W WXGA 1135 W 739 W 200 W WXGA 871W 607 W 150 W WXGA 739W 541 W Maximum Current at 100V 370 W 1080p 13 2 A 83 A 350 W 1080p 12 7A 8 0 A 300 W 1080p 11 4A 7 4 A 200 W 1080p 8 7A 61A 150 W 1080p 74A 54 A 370 W SXGA 13 2A 8 3 A 350 W SXGA 12 7A 8 0 A 300 W SXGA 11 4A 7 4 A 200 W SXGA 8 7A 61A 150 W SXGA 7 4A 54 A 370 W WUXGA 13 2 A 8 3 A 350 W WUXGA 127A 8 0 A 300 W WUXGA 114A 7 4 A 200 W WUXGA 87A 6 1 A 150 W WUXGA 74A 5 4 A 370 W WXGA 13 2A 8 3 A 350 W WXGA 12 7A 8 0 A 300 W WXGA 11 4A 7 4 A 200 W WXGA 87A 6 1 A 150 W WXGA 74A 54 A M Series User Manual 7 11 020 100009 04 Rev 1 10 2009 Section 7 Specifications 7 6 1 Lamp Specification Type Power 350W HD 350W SX 350W WU 350W WX 200W HD 200W SX 200W WU 200W WX DLV Models HD SX 350W Lamp rated lamp life to 50 brightness 2 hrs on 15 min off duty cycle 200W Lamp rated lamp life to 50 brightness 2 hrs on 15 min off duty cycle Warm up time to full output Operating position 7 7 Physical Specifications 7 7 1 Size Maximum product dimensions L x W x H with lens removed Maximum shipping dimensions L x W x H
40. ability to tweak poorly mastered source materials 2 Input levels apply for the current source only but for any color temperature used 3 Assuming that color temperature has been set up based on the internal test patterns you can then set up input levels for a given source so that it matches the color temperature of the internal test patterns e AUTO INPUT LEVEL Use only if you are an experienced user and you have an unusual source that you feel needs further color temperature and or input level adjustment This compensates for incoming out of range drives white and black levels black that would cause crushing of light and dark colors in the image After entering a checkmark wait for the six slide bar values to stabilize then delete the checkmark and exit The Auto Input Level is automatically turned off upon exit from the Input Levels Menu e BLACK LEVELS AND DRIVES To check your image levels and adjust these controls 1 Ensure overall Contrast and Brightness settings are both set to near 50 NOTE Not required for Auto adjustment CONTRAST 50 approx BRIGHT 50 approx 2 Check the color temperature setup using an internal grayscale test pattern making sure to obtain a neutral grayscale NOTE Not required for Auto adjustment 3 Confirm that you are using input on an Analog BNC card or a Dual Link DVI card Input Levels are not applicable for sources going through the decoder A grayscale i
41. affects the rest of the screen slightly Keep all edges just slightly ower than the center light output rather than matching light output precisely Otherwise it may not be possible to brighten the corners typically the dimmest areas of the screen enough i e the best uniformity is a compromise between the brightest and darkest areas of the screen e Adjust corner White Uniformity last each corner adjustment affects only this quadrant Repeat for each screen Step 4 Readjust Color Temperature level of red green blue in Eight Zones a Return to Steps 2a amp 2b and if necessary fine tune the zones so that they all still exhibit a single color temperature Cancelling Brightness Uniformity If you do not want to use or apply Brightness Uniformity settings delete the checkmark from the Uniformity Enable check box at the top of the Brightness Uniformity menu EDGE BLENDING The Edge Blending submenu provides a range of controls for smoothing together the overlapping bright edges of multiple adjacent projected images to create a single larger seamless image These controls which primarily affect white levels are typically used in conjunction with mechanical lens blinders optional which are installed on the front of the projector and which primarily affect black levels Brightness uniformity adjustment if desired should be performed first The Edge Blend or Grid test pattern is useful for the mechanical setup of the proj
42. and Guidelines in Section 5 Maintenance M Series User Manual 020 100009 04 Rev 1 10 2009 CHAISTIE Section 2 Installation and Setup 2 2 1 About the Projector LED STATUS INDICATORS BUILT IN KEYPAD ADJUSTABLE _ FRONT FOOT KENSINGTON LOCK REAR IR COOLING AIR VENTS SENSOR ADJUSTABLE REAR FOOT FIGURE 2 4 ABOUT THE PROJECTOR REAR SIDE VIEW Built in Keypad The built in keypad is located on the side of the projector Use it similarly to the IR remote to control the projector An LCD display is located above the keypad for displaying projector status AC Receptacle The AC receptacle is located at the back of the projector Use this receptacle to plug in an appropriately rated line cord NOTE The power switch is located above the AC receptacle Refer to Section 7 Specifications for details Adjustable Feet Located on the underside of the projector are three adjustable feet Raise or lower these feet when positioning the projector to ensure it is level on all sides so the displayed image will appear rectangular without any keystone Refer to 2 2 5 Adjusting Projector Height Tilt for instructions on how to adjust the projector s feet Input Panel All source connections are made to the input panel located at the back of the projector Any of the available optional input cards can be installed in the 4 option card slots The slots are labelled 1 through 4 All option cards have LEDs to in
43. be read on an input pin if the circuit attached to the pin is shorted to ground This corresponds to a switch closing event _ Open 0 or L Pin __ Pin Closed I or H Example 1 Turn room lighting on when the projector is turned off Assumes a control automation unit is configured to turn the lights on when pin 2 of its input goes high GIO CNFG OOOIIIL Set pin 2 3 amp 4 configuration to output and pin 6 7 8 amp 9 to input GIO STAT 1 0xxxxx Set pin 2 to high pin 3 to low and the state of all other pins unchanged Query Command GIO STAT Request the state of all pins GIO STAT 1001001 Reply of pin states 1 means pin is high 0 means pin is low GIO CNFG Request the configuration of all pins GIO CNFG I1IOOOO Reply of pin configurations pins 2 3 amp 4 are Inputs pins 6 7 8 amp 9 are Outputs NOTE The strings in the commands refer to pins 2 3 4 6 7 8 9 in order from left to right B 2 M Series User Manual 020 100009 04 Rev 1 10 2009 CHRISTIE Appendix C DMX ArtNet C 1 C 1 1 DMX and Real Time Events There are Real Time Events trigger types that allow RTEs to be triggered via DMX channels An RTE event may be linked to DMX channels 55 64 These controls have the same behavior as toggle checkbox controls with 25 75 hysteresis built in When a control is moved above 75 the linked RTE will be triggered When any of the RTE linked
44. communication is always eight data bits no parity e SERIAL FLOW CONTROL Determines whether software flow control or no flow control is used when transmitting and receiving data on the serial port e PROJECTOR ADDRESS Enter a three digit number such as 001 to assign or change a number to the projector currently in use If the current projector already has a number assigned that number will appear here for example 004 in the menu shown below Numerical identity for projectors enables you to communicate with a single projector within a multiple projector application see also PROJ key in 3 Using the Remote Keypad or Built In Keypad If you make a mistake in assigning or changing the projector number press EXIT to cancel NOTE When multiple projectors are being used and you want to adjust the color for individual projectors to create one seamless image you must assign different numbers for each projector to allow switching back and forth between projectors while adjustments are being made e NETWORK ROUTING NOTE Not applicable for stand alone projectors or simple serial networks with only one type of controller and linking 1 Separate Networks do not communicate with one another 2 RS 232 and RS 422 Joined Serial networks are joined but Ethernet is isolated 3 RS 232 and Ethernet Joined RS 232 and Ethernet are joined but RS 422 is isolated 4 All Joined Network communications travel all networks FIGURE
45. feature list and can share the same configuration methods as follows The user may select to monitor both neither or a single interface via a DMX control If both interfaces are selected the DMXC input card will take priority if it is actively receiving data While data is active on this card ArtNet packets will be ignored e Only 1 DMXC card can be used at a time If more than one is populated the 2nd and subsequent cards will not be activated The DMXC card will always be active even when the projector is powered down i e in standby mode When controlling a projector with DMX it is recommended that no other interfaces such as the IR Remote or Web interfaces are used The Menu for setting the ArtNet and DMX interface is always available at Configuration gt Communications gt DMX ArtNet Settings NOTE When a DMXC card is installed the same menu is available at Configuration gt Option Card Settings gt DMX Input Card gt DMX ArtNet Settings DMX INTERFACE Select whether to monitor the DMXC input card only the ArtNet interface only both ArtNet is ignored if the DMXC card is actively receiving data or neither DMX PERSONALITY This control determines how many contiguous channels the projector will respond to Fewer channels mean more devices can be used per universe More channels mean greater control of the projector but fewer devices e Basic 20 channels This is the default setting The 20 basic channels are those
46. for a User color temperature defined when you matched primary colors and continue to use it for all sources displayed on the wall Your other color temperatures will not necessarily be matched from screen to screen WHITE UNIFORMITY SLIDE BARS White Uniformity slide bar values may not reduce to 0 Each slide bar adjusts overall light output in a specific screen zone but the value shown represents the current setting for green in this zone When other hidden values red or blue are lower than green during adjustment in the White Uniformity menu their values will reach 0 first causing the slide bar to stop earlier than expected JUDGE BY EYE OR USE A METER Good brightness uniformity can be achieved with either Step 1 General Setup a Adjust primary colors see 3 12 Using Multiple Projectors Matching Colors in Multiple Screens to ensure matched overall color temperatures and light output between screens IMPORTANT Double check that all WHITES and LIGHT OUTPUT are well matched FOR BEST RESULTS Rather than examining the CENTER of each zone when assessing Brightness Uniformity adjustments focus on extreme EDGES as indicated in the illustration at right b Enable the Brightness Uniformity check box This will enable access to the uniformity controls and will apply the settings to your image c Select the 13 Point test pattern for display This pattern provides nine screen zones with 13 targets see 3 Point Te
47. horizontal position of the image can also be offset that is moved to the left or right of optical center by adjusting the motorized lens mount The amount of horizontal offset available depends on the lens installed and if the image has already been vertically offset Horizontal offset can be expressed as the percent of half the image width or the number of pixels of shift to one side of lens center Table 2 4 Table 2 5 and Table 2 6 each show the horizontal offset of a lens type See Figure 2 10 Horizontal Offset Examples M Series User Manual 020 100009 04 Rev 1 10 2009 CHRISTIE Section 2 Installation and Setup Table 2 4 WUXGA WXGA Horizontal Offset Ranges WUXGA Lens Description Lens Part Number Minimum Offset Above or Below Lens Center Lens ILS 0 73SX 0 67HD 118 100110 XX 6 58 pixels Lens ILS 1 25 1 6SX 1 16 1 49HD 118 100111 XX 38 365 pixels ALL OTHER LENSES 54 518 pixels WXGA Lens Description Lens Part Number Minimum Offset Above or Below Lens Center Lens ILS 0 73SX 0 67HD 118 100110 XX 18 122 pixels Lens ILS 1 25 1 6SX 1 16 1 49HD 118 100111 XxX 58 396 pixels ALL OTHER LENSES 76 518 pixels Table 2 5 HD 1080p Horizontal Offset Ranges HD 1080p Lens Description Lens Part Number Minimum Offset Above or Below Lens Center Lens ILS 0 73 1SX 0 67 1HD 118 100110 XX 12 115 pixels Lens ILS 1 25 1 6SX 1 16 1 49HD 11
48. interface 1 Set them all to the same baud rate as your RS 422 controller NOTE You must enable this combination of RS 422 and RS 232 in the Communications menu Set the Network Routing option to RS 232 and RS 422 Joined see Section 4 Web User Interface 2 Chain the projectors together by connecting an RS 232 OUT Null Cable of the first projector already connected to the computer controller through the RS 422 port straight thru to an RS 232 IN on the next projector in the chains Continue connecting projectors in this manner until you ve reached the last projector in the chain so that only the last projector has one unused port RS 232 OUT see Figure 2 22 Mixed Network FIGURE 2 22 MIXED NETWORK Communication parameters such as baud rate must be set to match the particular controlling device before connecting as a network refer to the documentation that came with your controlling device to determine the proper baud rate See Section 3 Operation for help changing the projector baud rate To communicate to all projectors set the Network Routing to RS 232 and RS 422 Joined NOTES 1 Connect only properly wired serial communication cables 2 Each RS 232 communication cable should be no more than 50 feet in length Use high quality cables ETHERNET NETWORK SETUP To add one or more projectors to an Ethernet network use standard CATS cable to connect each projector s Ethernet port to a hub belongin
49. key that displays Test on the LCD display 2 Course focus Do a quick preliminary focus and if available zoom adjustment with the primary lens Do not worry about consistency across the image at this point just center focus It is good practice to have zoom adjustment color and focus adjustment color in the center of its range 3 Center the image in the lens Holding a piece of paper at the lens surface adjust offsets as necessary until the image is centered within the lens perimeter A full white field works best for this 4 If necessary center the image on the screen If the projector is mounted off center to the screen axis then offset the lens as much as required Aim the projector over slightly towards the center of the screen but use caution when doing so as too much tilt will cause excessive keystone distortion Lens offset will not 5 Re check side to side leveling With the framing pattern on screen double check projector leveling so the top edge of the image is parallel to the top edge of the screen 6 Throw Distance Ensure the projector is positioned in the throw distance range for the particular lens Folded Optics In rear screen applications where space behind the projector is limited a mirror may be used to fold the optical path see Figure 2 13 Folded Optical Path The position of the projector and mirror must be accurately set if considering this type of installation call your dealer for assistance M Series
50. may help to prevent an emergency shutdown if the extra cooling can bring the temperature within limits before the shutdown occurs The fan assist will cause increased noise levels due to the simultaneous full speed operation of all the fans Normal operation will resume when all over temperature conditions are removed or fan assist is turned off M Series User Manual 020 100009 04 Rev 1 10 2009 CHRISTIE Section 3 Operation DATE amp TIME The current year month day hour minute second Changes here reset the projector s real time clock MENU PREFERENCES Adjust the appearance content and or location of on screen menus and messages e LARGE MENU FONT Enter a checkmark to enlarge menus and their text To adjust Menu Location to accommodate the increased menu area e MENU LOCATION Use the pull down list to choose a pre defined default or customized location for the display of all on screen menus To create a custom menu location 1 Choose a preset that is closest to the desired location 2 Adjust Horizontal Shift and Vertical Shift slide bars to move the menu to the desired location NOTE Avoid locations too close to a corner or edge to prevent cropping of larger menus HORIZONTAL SHIFT AND VERTICAL SHIFT Shift your menus as desired creating a customized menu location DISPLAY AUTOMATIC MESSAGE BOXES Enable or disable the pop up of automatic message boxes These are messages to the user that are not directly t
51. menus by pressing MENU followed by the appropriate two digit number representing their location in the menu system For example press MENU 23 to quickly access the Gamma option in the Image Settings menu NOTES 1 For certain options preference may be to use a direct key from presentation level to go directly to a particular option without traveling through the menu system available for certain display parameters only For example press CONTRAST to access the contrast slide bar immediately Press EXIT to return to your presentation 2 To hide direct slide bars disable the Display Slide bars check box in the Menu Preferences menu 3 To hide the entire menu system from view turn off the on screen display by pressing OSD then the DOWN ARROW KEY For a good and efficient first step in perfecting the image press the auto setup button AUTO This optimizes critical display parameters such as size position pixel tracking etc based on the type of incoming source An Auto Setup can save considerable setup time and you can still adjust the image as described below The best auto setup will be obtained under the following conditions Input levels it is best to have an image with saturated very Bright colors e Phase high contrast edges are needed To determine active window size e Video images should have whites and blacks in the image e Wide range video images should have content including white that exte
52. minimal flare 6 Adjust cross hair pattern II by adjusting the appropriate capscrew see Figure 2 16 Screw Locations Adjust until the cross hair image is in focus with minimal flare 7 Adjust cross hair pattern III by adjusting the appropriate capscrew see Figure 2 16 Screw Locations Adjust until the cross hair image is in focus with minimal flare 8 Repeat step 5 6 and 7 as required until all 3 cross hair patterns are in equal sharp focus If the boresight is acceptable see step 11 If the boresight does not appear to be converging to an acceptable level of image quality or if the lens will not focus over the correct range of throw distances then the boresight requires coarse adjustment see step 9 9 The original factory boresight can be recovered approximately by positioning the 3 setscrews see Figure 2 16 Screw Locations Position the setscrews flush with the front face of the lens mount plate and in contact with the inner lens mount plate see below Figure 2 17 Position Setscrew Flush This may require adjusting both setscrews and capscrews 10 If further action is required Repeat 2 11 Lock the setscrews and re check the boresight quality Tighten the setscrew enough to ensure they will not shift 2 18 M Series User Manual 020 100009 04 Rev 1 10 2009 FIGURE 2 17 POSITION SETSCREW FLUSH 2 2 8 Powering Down The projector can be powered down by using one of the following methods Remote Keypad Built In Ke
53. not be both Note that hardware termination is recommended because software termination is only in place when the projector has AC applied If there are cases where the network is required to be terminated without AC applied to the last projector then a hardware terminator should be used M Series User Manual 020 100009 04 Rev 1 10 2009 CHKISTIE Section 3 Operation ARTNET UNIVERSE For DMX512 each universe represents a separate electrical circuit up to 512 devices channels For ArtNet however DMxX data is broadcasted over an Ethernet network so every device will receive every packet of data whether they belong to that universe or not This control specifies which universe the projector belongs to so it can filter out all other data packets The Universe applies to ArtNet only and does not apply to the DMXC input card ARTNET SUBNET This is the highest level address in an ArtNet network providing expandability beyond the universe level This control specifies which ArtNet subnet group of universes the projector belongs to The Subnet applies to ArtNet only and does not apply to the DMXC input card e INPUT NOISE FILTER The Input Noise Filter eliminates DMX ArtNet input oscillation which can occur on some DMX control boards This can cause fine resolution controls e g Lens Brightness to continually change A filter setting of 0 will turn off the filter a setting of 1 will filter 1 step changes etc Using this
54. projectors where m is the number of rows 1 3 and n is the number of columns 1 3 This allows the following arrays to be set up 1x2 2x1 1x3 3x1 2x2 2x3 3x2 3x3 Projectors are numbered from left to right left column 1 and from top to bottom Top row 1 Examples Projector A Projector B Row 1 Col 1 Row 1 Col 2 Projector A Projector B Projector C Row 1 Col 1 Row 1 Col 2 Row 1 Col 3 Projector C Projector D Row 2 Col 1 Row 2 Col 2 On each projector you must set the following O The tiling array size set the total rows and total columns This setting will be the same on all the projec tors in the array O The relative location of the projector within the array set the row number and column number for each projector O Enable Tiling Tiling can be enabled or disabled without losing any of the above settings NOTE The Frame Delay Compensation function in the Tiling menu will cause the system to attempt to automatically correct for frame delay issues which may occur in 3 row tiling When this checkbox is set and using 3 row tiling the manual frame delay control is disabled The features that act differently when Tiling is enabled are O The PIP border is disabled Cascading menus are turned off Menus show only 5 items with a scroll bar to allow the rest of the menu items to be reached Keystone and Warp are not supported with Tiling enabled QOagad0 Pr
55. serial numbers are used for keeping statistics on each lamp used in each lamp position Entering of serial numbers is optional but is recommended When using this function the statistics from the previous lamp are archived and starts statistics tracking for the new lamp If this function is not used statistics are accumulated combined for both the new and old lamps LAMP 1 HISTORY and LAMP 2 HISTORY Lists the serial number and the number of hours logged for each lamp current and previously installed in the projector The current lamp appears at the bottom of the list This entry is added automatically when you record a new serial number during the lamp change process See Change Lamp Submenu Status The read only Status menu lists a variety of details about the standard and optional components currently detected in the projector Refer to the Status menu for versions of hardware and software installed the type size of lamp the hours logged in total and for a specific period such as a rental period and for your projector model name and serial number In addition the Status menu identifies the current channel its location its frequencies and other details Using Multiple Projectors IMPORTANT When working with more than two projectors work left to right top to bottom When an installation requires multiple projectors use the RS 232 serial ports to daisy chain the units together and control the group with a single keypad
56. setting takes affect immediately ENTERING A NUMBER IN A NUMERIC FIELD 1 Position your mouse pointer within the numeric field that you wish to edit 2 Click to highlight the field entry NOTE Zf you click the menu option the field cannot be edited 3 Edit the field entry 4 Press Enter to save your changes Output Options Screen Image Orientation Front Projection Frame Locking Frame Locking Free Run Frequency FIGURE 4 8 SELECT NUMERIC FIELD M Series User Manual 4 5 020 100009 04 Rev 1 10 2009 Section 4 Web User Interface CHKISTIE SELECTING A OPTION FROM A DROP DOWN LIST 1 Click the option drop down arrow to open the drop down list 2 Locate and select the desired option Power Management LCD Backlight Always On 4 Drop down list Always On Always Off Timed LCD Backlight Level lt a Auto Power Up Auto Shutdown Enable a Check box Over Temp Fan Assist FIGURE 4 9 TYPES OF MENU ELEMENTS SELECTING OR CLEARING A CHECK BOX To select or clear a check box click the check box with your mouse pointer This enables or clears the option respectively CLOCK SETTING 1 Click within the field i e Lamp Regeneration Start Time option to allow access 2 Change the Hour Minute and Seconds fields double digit field entry as required 4 3 5 Admin Tabbed Page System Under the Admin tabbed page select the System secondary tab to upgrade upload backup and restore speci
57. the projector optimizes critical display parameters such as size position pixel tracking etc for the current source These parameters are listed in Zable 3 1 Auto Setup An auto setup can save time in perfecting a display and you can modify the adjustments as desired Table 3 1 Auto Setup OPTIMIZES SETS TO DEFAULT Pixel Tracking Contrast Pixel Phase Brightness Size and Blanking Auto Input Level off Vertical Stretch Detail if video source Position Filter Input Levels Luma Delay NOTE You must have an unlocked channel present to use Auto Setup M Series User Manual 020 100009 04 Rev 1 10 2009 The best auto setup will be obtained under the following conditions e Input levels it is best to have an image with saturated very bright colors e Phase high contrast edges are needed To determine active window size Video images should have whites and blacks in the image e Wide range video images should have content including white that extends to all edges of the image Refer to Section 3 5 Adjusting the Image for further details about the Auto Setup function Channel Select a specific source setup channel defined and stored in projector memory Once you enter a two digit channel number or if there is a list displayed highlight it and press ENTER the display will automatically change and update according to the numerous setup parameters defined for that channel NOTE A new c
58. type of option card installed connect your source using the appropriate cable s as follows Analog Input Card connect 3 4 or 5 wire RGB source to Red Pr Green Y Blue Pb H C and V using 3 4 or 5 BNC connectors as required Dual SD HD SDI Input Card connect SDI Serial Digital Interface cable to one of the two inputs 1 IN or 2 IN Both standard definition SD and high definition HD signals are accepted and automatically recognized on either input Dual Link DVI Input Card connect a single or dual DVI video signal to the DVI I connector an analog video signal to the DVI I connector or an analog video signal to the VGA connector The DVI signal may contain HDCP High Bandwidth Digital Content Protection Twin HDMI Input Card connect HDMI High Definition Multimedia Interface cable to one of the two inputs 1 IN or 2 IN Video Decoder Input Card depending on the source you can apply the following e Composite video source to 1 CVBS using a BNC Cable NOTE Same signal can be used on 4 5 or 6 when input is selected as CVBS e A component signal on Inputs 4 Pr 5 Y 6 Pb using BNC Connectors NOTE Grouped as a component input YPbPr e S Video to one of the two 2 SVID or 3 SVID using S Video cable e S Video using two BNC cables with Luma Y connected to 4 Sy and Chroma C connected to 6 Sc NOTE Must be grouped as 1 S Video 1 CVBS DMX512 Interface Card has two Spin XLR connectors 1 input ma
59. 0 2009 CHRISTIE Table 2 1 WUXGA WXGA Vertical Offset Ranges Section 2 Installation and Setup WUXGA Lens Description Lens Part Number Minimum Offset Above or Below Lens Center Lens ILS 0 73 1SX 0 67 1HD 118 100110 XX 22 132 pixels Lens ILS 1 25 1 6SX 1 16 1 49HD 118 100111 XX 82 492 pixels ALL OTHER LENSES 112 672 pixels WXGA Lens Description Lens Part Number Minimum Offset Above or Below Lens Center Table 2 2 HD 1080p Vertical Offset Ranges Lens ILS 0 73 1SX 0 67 1HD 118 100110 XX 50 192 pixels Lens ILS 1 25 1 6SX 1 16 1 49HD 118 100111 XX 120 460 pixels ALL OTHER LENSES 150 576 pixels HD 1080p Lens Description Lens Part Number Minimum Offset Above or Below Lens Center Lens ILS 0 73 1SX 0 67 1HD 118 100110 XX 35 189 pixels Lens ILS 1 25 1 6SX 1 16 1 49HD 118 100111 XxX 102 551 pixels ALL OTHER LENSES 119 643 pixels Table 2 3 SXGA Vertical Offset Ranges SXGA Lens Description Lens Part Number Minimum Offset Above or Below Lens Center Lens ILS 0 73 1SX 0 67 1HD 118 100110 XX 23 121 pixels Lens ILS 1 25 1 6SX 1 16 1 49HD 118 100111 XxX 73 383 pixels ALL OTHER LENSES 100 525 pixels NOTES 1 Offsets are subject to 7 centering tolerance 2 Offset of pixels of offset half vertical panel resolution x 100 The
60. 00009 04 Rev 1 10 2009 4 7 4 Click the Upload button to display the Logo Upload window a Enter a descriptive name in the Display Name field b Click the Upload button to display the Gamma Upload window Click Yes or No to confirm or cancel the upload respectively An Upload in Progress window appears Creating a Backup File 1 2 3 4 5 Select a file type All Preferences Configuration Channels or Users from the Backup drop down list Click Backup to initiate the download A Backup in Progress bar appears Once finished a File Download window appears Click Save to open a Save As window Locate and select a folder within your Network drive or hard drive where you wish to save the file Click Save Restoring a File 1 2 3 Click the Browse button to open the Choose file window Locate and select the file you wish to restore from a Network drive location or from your hard drive Select a file type All Preferences Configuration Channels Users or Real Time Events from the Restore drop down list NOTE DO NOT select All unless transferring all files from one projector to another or cloning Click Restore to initiate the restore A Restore in Progress bar appears Once finished a confirmation message appears Performing a Diagnostic Test using Interrogator 1 2 Select an Interrogator level Basic or Advanced from the Interrogator drop down list Click Interrogate to initiate the di
61. 00011 04 Rev 1 10 2009 CHRISTIE Appendix C DMX ArtNet Channel Name Description Value Notes 32 PIP Enable cont PIP Enabled 75 100 33 PIP Input Input ae Same table as Channel 8 for Main Input 34 PIP Channel Channel F Same table as Channel 9 for Main Input 35 PIP Swap No Action Apply 36 PIP Size Scaled as of total control range 37 PIP Vertical Stretch Scaled as of total control range 38 PIP H Position Scaled as of total control range 39 PIP V Position Scaled as of total control range OSD Disabled 0 25 40 OSD No Action 25 75 OSD Enabled 75 100 Front Projection 30 11 41 Projector Rear Projection 95 37 Orientation Front Projection Inverted 159 62 Rear Projection Inverted 224 87 No Action 0 75 42 Lens Calibrate Run 75 100 ILS Disabled 0 25 43 ILS Enabled No Action 25 75 ILS Enabled 75 100 Off 0 25 This is the global YNF control not the channel 44 YNF No Action 25 75 control On 75 100 Disabled 45 Blend Select 2D Keystone List Size Control is divided up equally for each list The rest of this list is Dip q item dynamic depending on blends saved by the user Disabled 46 Warp Select Standard List Size Control is divided up equally for each list The rest of this list is Dependant item dynamic depending on blends saved by the user M Series
62. 0009 04 Rev 1 10 2009 Section 3 Operation 3 40 CHRISTIE Horizontal keystone is used to correct a keystoned image shape in which the left and right borders of the image are unequal in length and the top and bottom are slanted to one of the sides see Figure 3 34 Horizontal Keystone FIGURE 3 34 HORIZONTAL KEYSTONE All settings to adjust keystone are in the Geometry Correction submenu Brightness Uniformity Edge Blending and Black Level Blending should be disabled before performing Keystone adjustments ADJUSTING AN IMAGE FOR KEYSTONE CORRECTION 1 6 7 8 9 10 11 Enable keystone adjustments by selecting Keystone from the Geometry Correction drop down list NOTE This will enable the controls for performing 1D or 2D keystone adjustments Select a Test Pattern NOTE t is recommended to use the Grid test pattern Perform coarse keystone adjustment by using the Horizontal or Vertical Adjust setting Use the left and right arrow keys to make the adjustment NOTE The corner cursors are a guide as to how the image will be adjusted The outside edge of a cursor will be the outside edge of the image It may not be possible to exactly match the screen dimensions with the Horizontal and Vertical Keystone controls but these settings can be refined when the 2D keystone settings are adjusted When adjustment of the corners is complete select OK NOTE A message will be displayed indicating that the projector is Processi
63. 009 CHKISTIE Appendix C DMX ArtNet Channel Name Description Value Notes 60 RTE cont Triggers RTE for DMX channel 75 100 60 Cancel current running RTE 0 25 61 RTE No Action 25 75 Triggers RTE for DMX channel 75 100 61 62 Reserved 63 Reserved 64 Reserved M Series Setup Guide 020 100011 04 Rev 1 10 2009 c 9
64. 0109 did sBumes 129d did Z sBumes ewweg did L 6 6 uojonpey asion oynbsoyy SRUIRES OPE Hil POSUEAPN did lt oqeua 089 11 sBun s uononpay SION did wR Ped OL i uolleoo1 duel 6 lqeu3 10109 olnv g9 JOoysiang 118100 p aA 1ndul lt qq gt nig plous uu IIel d jeaapoelg lt qq gt nig 9 ju uu ocuguu3 AN x Z BAU 1ndul lt A gt UBBI G ered L J AB IC G lt A gt u 1o y sBumes 112120 did ee eet lt lt ld gt I A 11ndul ony L sBum s ewj p 52ueApv did 9 dols ewweg SI A 11ndul did k S A 1ndu did S uonounq guuuueS suondo o piA did r BWWESD gz oeds 10 09 Uuolno uo9 ewweg aBuey uoyezquend g LL ssoujublig Z sBum s ewweyd did la 1JsenuoO Andepv OL 1senuoo L Aejaq eunT euuouuo 6 sbunjes Beuu did y09 9q pol Wily g apoy Bulj dwes J 4 4 9 UIL S HRD t Bulyaieas 1ndul gny yoelg o piA ndul a Aa a Auei la PJepueys o piA Z awi epe4 6 99y 1 poo q aiqeuz L 1O oO sapiog did 9 Suondo o plA did UIPIM 49piog did Z s6um s Beuil did 9 uolllsod 8 8ZIS did S lqeu3 did Y Sunueld did 2 s ewl did pue uien dems UuolllsOq A did Z Idul atd Z yuejg 14b r UOHISOd H did 9 dure yueig 427 seyd I xId S ee bo oti L yuejg wopog Z YORI OXI F did 9 Dulyoyms MAUI yuejg doy L u9 91 S BOYS MOpUI ndul AloV 8ZIS dld Z Buryuelg did S S Jd uonisod did L u Od 8 9ZIS did lt Aosiy Z dwe
65. 09 IUM lt wo14 do9 9 ang Jo ped anig S anjg Jo Hed u 1o p anid Jo Hed pay g9eds 10109 PIILA jugjeainba A x Ag nyes dw 1009 Z 1u unsn pv 10109 93S sjuawjsn py 10109 nlg wo14 do9 9 u 19 Jo Wed anig S UBBID JO Hed UBBID p UBB1D JO Hed Psy goeds 10109 PIILA jugjeainba A x Ag nyes dw 1009 Z 1u unsn pv 10109 D l S sju unsn pv 10109 u io uuoiq do9 9 pay JO ped nlg S Pay JO Wed U39319 y Poy JO Wed pay goeds 10109 PIILA yuajeanb A x Ag nyes dw 1009 Z 1u unsn pv 10109 158l S syuauysn py 10109 poy lt 1utodpII puajg woyog adeus pu lg woyog quiodpiyjy pu lg dol deus pu jg dol 1ulodpiIIN pu lg 34y deus pu lg fy yuiodpi puajg 497 adeys pu lg 497 9 AIND p oueApv lqeu3 GN c fr LO O DD ss unuBiig 1uBra wopog GL ss uluBug Yo woog pL ss unuBiig yyBiy doy ssoujybug ye dol Z ss u uBug uuonog L L sseujybBug dol OL ss unuBug 1uBiu ss u yfug yo ss u yfug 1 lu o UIPIM puajg uuonog UIPIM pu lg dol UIPIM puajg 1uBix UIPIM puajg 11 uj ned 1s81 lqeua pu lg yl Buipu Il8 19497 y9eIg GN c r LO O OD dwe 404 y abed 29S dweq 11 wo Adod OL jqeuz 10 09 lqeu3 10 09 Ony 1 1l d U91ON MOII A siu unsn pv 10 0
66. 1 Recommended for heaviest lenses such as 0 73 1 and 1 2 1 2 Security screws MUST be installed when hoisting the projector overhead or installing the projector in an overhead position 7 Remove the front lens cap M Series User Manual 2 1 020 100009 04 Rev 1 10 2009 Section 2 Installation and Setup CHRISTIE PAAA Use of the lens security screws is required if the projector is hoisted or installed in an overhead position FIGURE 2 1 LENS INSTALLATION FIGURE 2 2 SECURITY SCREW LOCATION FIGURE 2 3 LENS PLACEMENT 2 2 M Series User Manual 020 100009 04 Rev 1 10 2009 CHAISTIE Section 2 Installation and Setup STEP 2 Positioning the Projector ANT fe 2 people are required to safely lift and install the projector Place the projector on a sturdy level surface and position it so that it is perpendicular to the screen at a suitable distance The further back the projector is positioned for the screen the larger the image will be To level the projector adjust its 3 feet With the projector positioned perpendicular to the screen the image will appear rectangular instead of keystoned For more detailed instructions on positioning the projector refer to 2 2 3 Projector Position and Mounting later in this section STEP 3 Connecting a Source Located at the back of the projector is the input panel where all source connections are made Each input is clearly labeled for easy identification Depending on the
67. 10 Convergence Convergence zones A B C are as defined in Figure 2 Zone A has a diameter 4 of the image height Zone B has a diameter of full image height All specified convergence errors are between any two colors after a minimum warm up of 30 minutes Convergence is specified with a 1 4 1 8 HD lens part number 118 100112 01 in the 1 4 1 position with zero offset Bore sight alignment must be adjusted for zero angular error Note convergence error includes the effects of lateral color in the projection lens Measurements must be done on horizontal and vertical test pattern lines that intersect the center of the image M Series User Manual 7 3 020 100009 04 Rev 1 10 2009 Section 7 Specifications 7 1 11 Blemishes CHRISTIE Blemishes are to be observed at 1 full screen height distance from the image for a period of 30 seconds Screen size 10 foot wide for 350W models 8 foot wide for 200W models Blemishes are defined as per TI Specification 2506811 Red screen Green screen Blue screen White screen Black screen 7 1 12 Pixel Defects Red Green Blue 7 1 13 Image Artifacts Evaluate on multi burst or fine grid test pattern No blemishes No blemishes No blemishes No blemishes No blemishes 0 bright 1 dark 0 bright 0 dark 0 bright 2 dark non adjacent No visible artifacts with observer at 1 full screen height from image 7 1 14 Picture Centering with 1 4 1 8 1 HD lens 1080p centering
68. 2 1 Troubleshooting If the projector is not operating properly note the symptoms and use this section as a guide to resolve the problem If the problem cannot be resolved contact your dealer for assistance NOTE A Christie accredited service technician is required when opening an enclosure to diagnose any probable cause Power Projector Does Not Power ON 1 Ensure projector is plugged in Check power switch above power cord is in the ON position 2 Check that the Status LEDs are ON While the projector is busy initializing the LEDs should be cycling When finished initializing the Power and Shutter LEDs the two on the right should be on 3 Check the LCD display While the projector is busy initializing the display should show Please wait When finished initializing the display should show Standby mode 4 Check the LCD display for any warnings or errors NOTE A condition occurs on the first power on after a software upgrade and is indicated by all the following The Status LEDs are cycling green e The LCD displays the warning Image Processor Upgrading The LED on the Image Processor card flashes green The Web page shows a warning that the Image processor card is upgrading When this occurs the projector should not be AC power cycled and the Image Processor card should not be removed This operation may take as long as 5 minutes to complete Lamp Lamp Does Not Ignite 1 Is there an int
69. 2009 CHAISTIE Section 3 Operation e FRAME DELAY This control delays the output signal timing relative to the input signal timing by a fraction of a frame and up to several frames The minimum latency can vary based on the amount of scaling applied to the image When using keystone or warping an additional latency is required depending on the amount of warp The control is only available when the input signal is frame locked In free run mode or in cases where the signal cannot be frame locked the minimum latency defined by the scaling and keystone warp is applied to the signal e FREE RUN FREQUENCY This control sets the output video vertical frequency e HDMI OUTPUT LOOP SOURCE This control is used to configure the HDMI output options Selecting Direct Loop will directly pass through the HDMI input signals on the same Twin HDMI Input Card the Input signal is looped to Output and the Input2 signal is looped to Output2 Selecting Main PIP Loop will loop the Main amp PIP video to the outputs regardless from which card these signals originate The Main video signal is looped to Output and the PIP video signal is looped to Output2 Selecting Disable will shut off the HDMI outputs completely e FADE TO BLACK TIME This control sets the amount of time in seconds that it takes to fade the image to from black NOTE The OSD only allows the fade time to be set To initiate a Fade to Black the Christie Serial command should be used LE
70. 3 3907947 eiqileO OL dems 1o oO wayed 1s81 Keano oey yadsy plous uu 1o o l q 19497 10 99 9q I A9811ndul J0 99 9q ye q 1ndul lqeu3 10 09 B6euu z 13 I A81 1o ulayjed 1S 1 N c r LO O DOD uoneuiqile9 sonsouberq W JojoD 9 Aqawioay g weu urewoq 9 Jol bebe cae uugu JSOH S 40J S V ADE 89S 025284 p lqeu3 ped y pau OL CSS PS E p lqeu3 wl 129 6 IL p lqeu3 ull joy 8 SSOJPPV dl L skoey seopeolg sBun s J ui u 3 La s6um s J uj u13 9 Bulynoy YIOMJON S ZZp SH 1090 01d JeUAS y ssaippy 1o o loid Y r Sul poN eas suondo ZZp Su Ieu s Zr Sul IonuoO Molq BLES Z suondo LNO ZEZ SY Ieu S Z ZZp Su BEY pneg suondo NI ZEZ SH Ieu S L suondo zzr Szi eaS suoneoiunuuuoo LNO ZEZ SH loooloid IPu S y snuaw BulpeoseO Z LNO Z Z SU apon uaalog uselds L LNO ZEZ SY IonuoO old Ieu S Z d L nua OL LNO Z Z Suy 32y pneg Aouasedsues ASO 6 suondo LNO Z z Su enas tus u 1os sars 8 soabessa 10113 Ae LZ sieq pliis Aejdsiq NI ZEZ S 10904014 EUS sea cue hodan S NI Z Z SU poN Ieu S UIUS EMEA P NI ZEZ SH Io uoO Moy Ieu S Z UIUS Ieluozuori E NI Z 2 S4 a1ey pneg uoneoo1 nu N Z suondo NI ZEZ SH lees je Sun Z juo nueyy e627 ayeq L s Su i
71. 3 Refer to 3 1 1 Remote Keypad Commands AUTO Blue Pb Blacklevel 256 Blue Pb Input Drive 256 Auto Color Enable I Clamp Location Back Porch v 0 Input Peak Detector Iv 1 Color Enable White Y FIGURE 3 28 INPUT LEVELS O Go Sep Ol o PS a M Series User Manual 3 25 020 100009 04 Rev 1 10 2009 CHRISTIE Section 3 Operation Good RGB or input levels that is the drives and black levels for each of the three colors red green and blue ensure that images from analog sources other than decoded video have maximum contrast without crushing black or white By default and in an Auto Setup the projector automatically determines the best input levels by monitoring image content and adjusting the controls appropriately further adjustment is typically not required to obtain proper blacks or whites NOTE This automatic adjustment requires at least 6 12 consecutive white pixels in the image Without these pixels input levels may produce skewed colors particularly in non video images For a source exhibiting overly high black levels typically caused by a noisy source causing black level spikes use the Input Levels menu shown above These adjustments serve as a calibration process compensating for differences in sources and cabling to perfect the source image input levels and eliminate the overshoot and undershoot NOTES 1 Input Levels are of limited use with digital signals but do offer some
72. 6 Troubleshooting 6 1 POWER aasan asan asas Setaces aoneraced anieetetaaitales saudetadidacasedaucuatede asas wqwqaqasa tasqa sasusss 6 1 6 11 Projector Does Not Power ON ua sasa aaqaayaacaaqpaaskuwassqsaawasqakasyaasa qaya a asaqasqhaaaqq 6 1 6 2 BE a 1 o PO a aasayaukashataywsaqapayaaqhusqhuqaaqyayqaqayaasahayphasaqhusqasasshas qwaqasaahaqucapashaqqa 6 1 6 2 Lamp Does Not lenite resnaniiensir noian T ERE RT ERE 6 1 6 2 2 Lamp Suddenly Turns OFF s sssssnssesesssesseesesseesseestesresseessesrrsstesteseesersseessesrssresseserssressesst 6 2 6 2 3 Flicker Shadows Or Dimness cccccccccccccccssssccscccceseessssssseccesssesssssssssscessessessssesssesceseeeens 6 2 0 3 E E D E E E AE E quan a T E 6 2 6 3 1 Blank Screen No Menu Displaying n n nasus 6 2 6 4 Remote Keypad sectei enna aE eN eE E AEE EEEN E EEE qanqa EREE EERE TE 6 2 6 4 1 Remote Keypad Does Not Seem to WolIk n 6 2 0S OSDrnoreenei anen a E E N AA A E es 6 3 6 5 1 The OSD Menu does not display cscs ccsscessaccesotsscasaascecasensscnsssesancsnunsssonnenssaussenaneessnnpesssnncss 6 3 6 6 Aele oT E E E qapa E E 6 3 6 6 1 Trouble Establishing Communication with ProjJector 6 3 6 7 Di Sp aySuu uu aaa nuansa aaa nan Sanda stand enn san E RE EE 6 3 6 7 1 The projector is on but there is no display a 6 3 6 7 2
73. 8 100111 XxX 40 384 pixels ALL OTHER LENSES 42 403 pixels Table 2 6 SXGA Horizontal Offset Ranges SXGA Lens Description Lens Part Number Minimum Offset Above or Below Lens Center Lens ILS 0 73 1SX 0 67 1HD 118 100110 XX 13 91 pixels Lens ILS 1 25 1 6SX 1 16 1 49HD 118 100111 XX 45 315 pixels ALL OTHER LENSES 50 350 pixels NOTES 1 Offsets are subject to 7 centering tolerance 2 Offset of pixels of offset half horizontal panel resolution x 100 2 12 M Series User Manual 020 100009 04 Rev 1 10 2009 Examples of Vertical Offset SXGA pixels represented Where Shaded area projected image Area within solid line projected image area with no offset applied 1 In this example no offset is applied Half of the image appears above lens center 525 pixels and half of the image appears below above lens center 0 Offset 525 pixels below lens center 2 In this example 100 offset is applied therefore all of the image appears above lens center 1050 pixels of display above lens center OR 525 pixels of shift above lens center 100 Offset 3 In this example 75 offset is applied therefore 7 8 or 88 of the projected image 75 Offset appears above lens center 75 Offset 394 525 100 919 pixels of display above lens center OR 394 pixels of shift above lens center 131 p
74. 9 luAA sju unsn pv 10109 nig sjuawsn py 10 09 u 1o siu unsn pv JojoD pay mye dw 1o oO y yu unsn pv 10109 15 l S uoneginies 1olo5S GN c r LO O OD uuoiq Adod p4 lqeu3 10 09 lqeu3 Jojod oyny ZL J l 4 YON MOIIBA L L A SUM OL X SHUM Aang x nlg A u 1o X u 1o A PON X peu oedS 10109 pIIPA mes dw 10 09 Z juawysnipy 10109 15 l S Ax Aq syuawjsn py 10109 c r LO O lt O gt lt Buipu lg e6py pasueapy lt Buipu lg 6p3 paouenpy 6 duue 7 404 v 95ed 29S iuuuojiun 1yInej p 310 S Y Y UIES e1340 EL 1 lu O 1uBiz Z 1 Ju9O HOT LL Jausog 4Siy wopog OL apis bry 1 u109 4y doll JOUIOD 437 uuonog PIS 437 1 u109 437 dol dwe juowjsnipy sieoo usayed 1s 1 lqeu3 Qiuuojun ss unu6ug Apunopun ss uluBiig QN c r LO ON OD lt _ deli AO Bulpuajg mous g due YIPIM pu lg woog 9 UIPIM pu lg dol UIPIM pu lg IUBIY y UIPIM PUZIg YO uj ned 1s 1 Z Bulpu lg 6p3 Buipu lg 6p3 su 9luueu dq ZL sBunl S pled uondo L BIIMIS OL uoneiqed 9 saysouBbelq 6 SUONCIIUNUWIWUOD Z sooualajalg Nuayy u 1 9 Aeq juawabeueyy JaMOd sunas su 7 suoydo ndino benbue7 UO p V 95ed 29S SANOO A 5 ANA UM 1lu unsn pv 1010
75. 9 1Inej dq s6um s uols y S Y 9 auojshay qz 1sn lpv uo s y Ie9IN A 1sn pV y uols y jezuozuoH ysnipy uj ned 1s 1 Z uono uoS An uuo o L uono2 iuioS An uio o juauysnipy 10109 1In j q Bulpu lg 13497 yoeIg uoneiuniesS 10 09 Ax Aq sjuewysnipy 10 09 Buipu lg Bp3 Ayuuopun ss uyyfug uono uoS An uuo o uj ned 1s 1 1o o9 9 Asjyawioasy GN r LO O OD su 9luupeu dq ZL sBuijes pieO uondo L L S9IAJ8S OL uolneiqileO 9 sonsouBeiq 1Jo joO A3 uuo o suoneolunuuuuoo s ou 1 J iq nu lN Sul 9 3q 1 u uui Beuel 19M0d sBum s su 7 suondo 1ndinO 6en6ueT1 uomneinBijuoS GN c r LO O OD usayed SO 6 abenbue7 g did 9 Buryoyms ndul Z snes 9 dwe uoneinBijuoo r dn s I uuguo g sBumjes Beuul z uonisoq pue 8ZzIS nua u e BN p nul uo5 nuaw ujeyy p 9ueApy M Series User Manual 020 100009 04 Rev 1 10 2009 CHRISTIE Appendix B GPIO This section explains how to use a GPIO link from the projector to external equipment such as devices for 3D synchronizing B 1 GPIO Port The GPIO connector located on the input panel provides a flexible method of interfacing a wide range of external T O devices to the projector There are 7 GIO pins available on the 9pin D Sub GPIO connector whic
76. CD ensure that OSD menu is enabled scroll down until the item OSD appears The LCD shows OSD off Press and hold the OSD soft key on the built in keypad The LCD now shows OSD on then press the menu key on the remote keypad OR 2 Press and hold the OSD key on the remote keypad for 2 3 seconds then press the menu key 6 6 Ethernet 6 6 1 Trouble Establishing Communication with Projector 1 Ensure any address changes have been saved and reboot to implement If you still have trouble establishing communications with a projector added to an existing Ethernet network the projector s IP address is likely in conflict with another address already in use Contact your network administrator 2 Ensure Ethernet settings are valid for the site All devices should have the same subnet mask yet unique IP addresses 6 7 Displays 6 7 1 The projector is on but there is no display 1 Wasa lens cover accidently left on Remove lens cover 2 On the LCD display check that the shutter is open This will also be indicated by the shutter LED being green Is the correct input selected Check cable connections 4 Check if menus appear on the screen 5 Can you access test pattern Ensure a full black test pattern has not been selected for display press Menu to access test patterns then cycle patterns with keys Check your source connections again 6 7 2 Severe Motion Artifacts 1 Most likely there is a synchronization problem wit
77. Controls if you need help using any of the options and controls Changes made in the Size and Position menu are applied immediately and are saved when you exit the menu press EXIT or MENU RESIZE PRESETS Size and Position 1 Resize Presets No Resizing V 2 Size 0 729 5 Q 3 Vertical Stretch 1 000 4 Pixel Track 858 5 Pixel Phase 0 6 H Position 360 7 V Position 262 8 8 Keep Aspect on Auto Setup F 9 Blanking gt FIGURE 3 17 SIZE AND POSITION MENU NOTE The same resize presets are available to all HD and SXGA screen models However the graphics used to describe each preset in this section are of the SXGA models only Resize Presets will display an image in its Resize Presets native resolution no resizing or will resize x E qe Sasa puda E a e near ng the Pa 3 Full Size fill the screen regardless of source eee ol eig san Wa th OT WIS TOSIZE 4 Full Width fill display width amp keep aspect ratio to the MAUSLA possible while keeping 5 Full Height fill display height amp keep aspect ratio the original aspect ratio 6 Anamorphic retain 16 9 aspect ratio Size Position and Blanking parameters will automatically adjust accordingly or if Blanking is set first which defines an Active Input Area Resize Preset scaling will occur in this region of interest only Resizing options are explained below Custom not selectable non preset values for Size Vertical
78. D menu backgrounds to be transparent M Series User Manual 3 35 020 100009 04 Rev 1 10 2009 CHRISTIE Section 3 Operation e MENU TYPE Select the Basic or Advanced menu type from this list box The Advanced menu setting will give the menu options The Basic menu setting will give a small number of the most frequently used menu items SPLASH SCREEN Choose which splash screen is to be used the default or user downloaded splash screen e CASCADING MENUS Enable or disable cascading menus When disabled a single menu level will be displayed on the OSD at a time Communications Submenu Defines and controls how single or multiple projectors are linked with each other and with a controlling device For detailed information refer to the Serial Command document provided in the Dealer Section of the Christie Website PN 020 100224 XX SERIAL OPTIONS Submenu BAUD RATE Determines the speed of communication to and from the projector on the RS 232 or RS 422 links The maximum rate for the RS 232 is 115200 for RS 422 it is 19200 Set the baud rate to match that of your controlling device such as your PC Refer to the documentation for the controlling device to determine the baud rate In an existing network of projectors if you discover that a projector has a different baud rate use the pull down list and select the correct baud rate using the ENTER key Do not scroll this control with LEFT ARROW KEY or RIGHT ARROW KEY Serial
79. Floor Mount with Mirror Advantages CHRISTIE Considerations Projector is completely hidden Usually good ambient light rejection Requires less space behind screen than otherrear screen installations Requires separate room or enclosure Installation cost is usually higher More involved to perform setup Front Screen Installations In front screen installations the projector and audience are positioned in front of the screen which can be flat or curved Flat screens offer a gain of about 1 0 with a viewing angle just less than 180 This type of screen reflects incident light equally in all directions so the audience can see the display from various angles Curved screens have a gain greater than 1 0 with a viewing angle much less than 180 This type of screen does not reflect incident light equally in all directions instead it is concentrated in a viewing cone The audience sitting within the viewing cone area will see a brighter image than those sitting just outside the area Flat Screen gain 1 7 Ango Angle
80. IL Selecting this check box causes the projector to automatically attempt to start the other lamp if the current lamp experiences problems and is preventing a light on the wall This applies if there is a failure to start a lamp or a failure during operation This feature applies only to systems which have multiple lamps and are currently set to run in a single lamp operating mode A brief period with no light may occur before the other lamp becomes active DYNAMIC IRIS Refer to Section Appendix A Menu Tree M Series User Manual 3 53 020 100009 04 Rev 1 10 2009 Section 3 Operation 3 11 3 12 3 54 CHRISTIE WARN WHEN LAMP REACHES HOURS Enter the maximum number of hours threshold for lamp usage When the threshold set number of hours is reached on either lamp a warning message displays on the status system indicating that the lamp should be changed This setting is user defined only has no bearing on lamp warranty and is not tied to actual lamp life in any way The default setting is 0 which means that the feature is off and no warning will be generated LAMP 1 s n and LAMP 2 s n Enter the serial number for the specified lamp This will apply the serial number to the current lamp statistics file It will not perform the archiving as done by the CHANGE LAMP function Change Lamp Submenu Initiates the lamp change process for the selected lamp and allows the serial number of the new lamp to be entered Lamp
81. M Series USER MANUAL 020 100009 04 CHAISTIE CHIS TIE Table of Contents 1 Introduction 1 1 Labels and MarkI g uua aa naa aa cacuati EA ER nee 1 1 1 1 1 Typographical N tfafionSu xsnrcssasninessdeasessueuendastasiiascnauekendsasteszessastiesluuuisdsnteniesdvenninesunensivveys 1 2 1 2 Purchase Record and Service Contacts nanas 1 2 K3 Projector OVErViEW erimeden ni EAEE nE A qanya EE EEE baga tss qasopasausay hin 1 3 1 3 1 How the Projector Works scars ccssaisvstesnaesaccamncancesantteanedsesuencaesacassenstacunancencunustbeaesnavcarineastavers 1 3 1 3 2 User Interface CIV CLV CW ao ua susunan E E E A aE 1 3 1 3 3 List of COMpOnentS ee eee ne ee eee ee eer eae inais 1 3 1 3 4 Key PQADIIES ost cccesssernsivecszaccsaehsadeda occas E E AAE E E RE E E EEE 1 3 2 Installation and Setup 2 1 Projector Quick Setup and Installation n nasa 2 1 2 2 Detailed S tup and Installation u ua uu nosia aada a iR a ia 2 4 2 2 1 About the ProjeCtOr iiri stantabadccaposihenepaisacenuataseamabanecanni taccuesstancuainemeaiaseeenads 2 5 2 2 2 installation Considerati nS esorcista ean b aaa a EDERSE EEEa NEESER 2 7 2 2 3 Projector Position and Mounting ccceccceeceesceesceceseceeeeeeeeeeseecsaeceeeeeeeeesseecaeeneeseeeenseees 2 10 2 24 Mounting ssie a a EE ee 2 15 2 2 5 Adjusting Projector Height Tilt
82. MENU Use FUNC to enter a negative number IF WITHIN A TEXT FIELD Press FUNC followed by the UP ARROW KEY or DOWN ARROW KEY to convert between capital and lower case letters Press FUNC followed by the LEFT ARROW KEY or RIGHT ARROW KEY to insert or delete a character Press FUNC followed by ENTER to delete all characters IF WITHIN A PRESENTATION Press FUNC followed by two numeric numbers to enable a specific color or colors in the display see right For D Red 6 2 Green example C gt C 6 1 will display only red and OW will display green CX 6 3 Blue data Eliminating one or more colors can help with certain diagnostics and C s C4 Yelow setups such as when accurately overlaying one image on top of another from TXEN 5 Cyan stacked projectors NOTE Color enabling can also be implemented from Da numerous locations within the menu system SEANS AA A ee Press FUNC followed by HELP to disable Keystone Edge Blending and FIGURE 3 3 FUNCTION KEY Brightness Uniformity settings This will disable the features without changing the settings associated with them Projector Press PROJ to access a specific projector within a group of projectors or to confirm if the local projector is listening The number in the Enter Number window indicates which projector is currently listening to commands and will match the projector number that has been defined in the Menu Preferences menu The PROJ check box read only sho
83. NS SETTINGS INTELLIGENT LENS SYSTEM Check this box to enable the Intelligent Lens System ILS When enabled the lens position horizontal vertical focus and zoom offsets are stored per channel If you change channels the lens position will change as the new signal is being displayed When ILS is not enabled the lens is controlled independently of channels or input signals MANUAL ZOOM FOCUS When this control is selected the holding current is removed from the zoom and focus motors so that they can be changed manually NOTE Zoom and Focus should not be adjusted manually when this control is not selected as this will result in damage to the motors CALIBRATE The lens calibration procedure is needed each time a new lens is installed in order for the ILS feature to perform reliably This procedure calibrates horizontal vertical focus and zoom offset movements e LOCK ALL LENS MOTORS Select this check box to prevent all lens motors from moving It will disable the Zoom Focus Horizontal and Vertical Position settings effectively locking out any changes and overriding all other lens features This feature is particularly useful to prevent accidental lens position changes in multi projector installations CALIBRATE ON NEW LENS Check this box to prompt for a lens calibration each time a lens is inserted The user will always be prompted before starting the calibration e CALIBRATE ON STARTUP Check this box to initiate a
84. PbPr LED indicates that a valid component signal has been detected on inputs 4 5 and 6 Component input grouping must also be selected in the projector s menu see Section 3 Operation The remaining LEDs are each associated with one of the inputs and indicate a valid signal has been detected on that input Video Decoder Input 108 310101 01 VEN A A A S aO s PWR O SZ ZF sZ 6 f 1 CVBS 2 SVID 3 SVID 4 Pr R Sy 5 Y G 6 Pb B Sc CVBS CVBS CVBS DMXC Interface Card The DMXC card is a communication interface which allows the projector to be controlled using the standard E1 11 USITT DMX512 A protocol DMX512 A 2008 DMX 512 is a serial protocol which is used for controlling lighting staging equipment from a lighting console or similar host equipment ArtNet defined by Artistic License s Art Net II Specification is an Ethernet implementation of the DMX protocol The M Series projector supports the DMX protocol through 2 data input interfaces 1 a DMX card and 2 ArtNet through the Ethernet connector Unlike the other optional input cards the DMXC card is not an input interface for video signals but it plugs into a standard input card option slot The card can always be active even when the projector is powered down i e in standby mode Only one DMXC card will be allowed per system If more than one is populated the 2nd and subsequent cards will not be activated The card has two Spin XLR connectors 1 input male a
85. RIGHT ARROW KEY Press ENTER when the desired choice appears NOTES 1 Press LEFT ARROW KEY or RIGHT ARROW KEY to jump between pages in an extra long pull down list 2 Press EXIT while in a pull down list to cancel any change M Series User Manual 020 100009 04 Rev 1 10 2009 Editing Text Activate the Edit Window To enter or edit text highlight the desired parameter such as a channel name and press ENTER to activate its adjacent edit window Any previously entered text is displayed with its first character highlighted in a square cursor signifying that this character is ready for editing Navigate Within the Edit Window Press RIGHT ARROW KEY to move the cursor forward or LEFT ARROW KEY to move the cursor backwards as desired Cursor highlight Move with 4 show2 AON scroll alphabet Press numbers etc to select and go to next FIGURE 3 9 ENTERING TEXT Edit a character To edit a highlighted character use UP ARROW KEY and DOWN ARROW KEY to scroll through the alphabet numbers spaces and punctuation available When the character you need appears press RIGHT ARROW KEY to select it the cursor will move to the next available character of current text To convert a lower case letter into a capital letter position the cursor on the letter and press FUNC followed by the UP ARROW KEY To convert a capital letter into a lower case letter position the cursor on the letter and press FUNC followed by the DO
86. RN 7 4 7 1 14 Picture Centering with 1 4 1 8 1 HD lens a 7 4 Tce Ne UIE Sebuyau man uu a S DD anay aa huS aa ee oe 7 4 TA AION ulus a2 a guanaascnaspayaakiaaiaamascanaytaypasyasqhaspaqyQusuasasqaayaaqukusyaan aspasqhuakunayaatyyasuuqqiays 7 4 7 2 2 Ait Filters Optional u u u sus amuaanaasahaquhasakuauqakaahayssuiakuyataqhaqawkanalaskaakai 7 4 7 2 3 DSt sacl MINS ua apna unap ipana TEE A E E E REE 7 4 7 2 4 ILS Intelligent Lens System n seereaptetcneereacerensenters 7 5 7 2 5 Projection Lens Compatibility n asset 7 5 7 2 6 Dynamic IIS u uuu u EE EEE a EE R E AEE E E RAEE AREE 7 6 T 2 T A tomatie FANS esiin E E E EEE acess TEEST ERORE 7 6 T28 Automatie Color Filterihp sicsecvsnsiinsesasriedenesatesabannnedeanoinnevedviedeswonslegebannadduesineeuedeunteseuedeseners 7 6 7 2 9 Constant Lamp Output Managemetnt s 7 6 T210 Shutter criscini inaa i S S REE EE R TEE ete es 7 7 2 N amps s n sn EA EE A E AEE E E E A E E N LE E A EE 7 7 Ta Mal Status EE oasis unu uu SOS A O akayta sal usasqa 7 7 72 13 Electromies SW asrccsdatencinsaertuntucexeusaaduncance toncdnataneeeantexunea a oa eee 7 7 M Series User Manual ili 020 100009 04 Rev 1 10 2009 Table of Contents CHAISTIE 7 3 Image Processor Performante xs ccesesstoctussisscovshsdeaasdaianactadapdecspabasactialadiavesta
87. Re type the password in the Re type Password field 5 Click Ok to save or Cancel to ignore Delete User Delete User Are you sure you want to deleted the selected 1 Select the user that you wish to remove from the Users window ser See Figure 4 13 ves mo 2 Click Delete User to open the Delete User window A E TE confirmation message appears SURE Aia DELETE USER WINDOW 3 Click Yes or No to proceed or ignore the action 4 3 7 Advanced Tabbed Page RTE The RTE secondary tabbed page is where you can manage real time events i e add delete edit copy and setup the GPIO as described in the following section RTE Buttons The real time event buttons include the following Add create a new event Delete remove one or multiple existing events Delete All remove all events Edit change or add information for an existing event Copy clone an existing event Stop discontinue the event running GPIO Setup used to configure the GPIO pins as inputs outputs and to set the current state of the output pins M Series User Manual 4 9 020 100009 04 Rev 1 10 2009 CHRISTIE Section 4 Web User Interface To ADD A SCHEDULED EVENT 1 Click Add to open the RTE Wizard 2 Select the Scheduled Event tab NOTE The scheduled tab is always selected by default on add RTE Wizard Scheduled Event System Event GPIO Event Function Key Event DMX Channel Event Start Time O Once 2009 09 15 2009 09 15 e Daily Wee
88. Setup Guide 020 100011 04 Rev 1 10 2009 C 7 Channel Name Description Value Notes 47 2D keystone Scaled as of total control range Top Left H 48 2D keystone Scaled as of total control range Top Left V 49 2D keystone Scaled as of total control range Top Right H 50 2D keystone Scaled as of total control range Top Right V 51 2D keystone Scaled as of total control range Bottom Left H 52 2D keystone Scaled as of total control range Bottom Left V 53 2D keystone Scaled as of total control range Bottom Right H 54 2D keystone Scaled as of total control range Bottom Right V No Action Remove Crosshairs 0 25 Warp select Channel 46 must be on 2D Key 55 2D keystone Apply Show Crosshairs 25 75 stone for this control to work Apply Remove Crosshairs 75 100 Cancel current running RTE 0 25 56 RTE No Action 25 75 Triggers RTE for DMX channel 75 100 56 Cancel current running RTE 0 25 57 RTE No Action 25 75 Triggers RTE for DMX channel 75 100 57 Cancel current running RTE 0 25 58 RTE No Action 25 75 Triggers RTE for DMX channel 75 100 58 Cancel current running RTE 0 25 59 RTE No Action 25 75 Triggers RTE for DMX channel 75 100 59 60 RTE Cancel current running RTE 0 25 No Action 25 75 c 8 M Series Setup Guide 020 100011 04 Rev 1 10 2
89. Slot 6 251 98 Channel 1 5 1 Channel 2 19 7 Channel 3 32 12 Channel 4 45 17 Channel 5 57 22 Channel 6 70 27 Channel 7 83 32 Channel 8 96 37 Channel 9 109 42 ae Channel 10 121 47 Channel 11 134 52 Channel 12 147 57 Channel 13 160 62 Channel 14 173 67 Channel 15 185 72 Channel 16 198 77 Channel 17 211 82 Channel 18 224 87 Channel 19 237 92 Channel 20 250 98 c 4 M Series Setup Guide 020 100011 04 Rev 1 10 2009 CHRISTIE Appendix C DMX ArtNet Channel Name Description Value Notes 10 Lens Horizontal 1 increment 16 steps each This control has 4096 steps to give 1 step reso Absolute position increment is roughly 5 pixels lution it is split between 2 controls This part of Coarse the control represents the upper 8 of 12 bits See restrictions in section Lens Control Limita tions 11 Lens Horizontal 16 increments 1 step approx 1 This control has 4096 steps to give 1 step reso Absolute position pixel per 3 steps relative to lution it is split between 2 controls This part of Fine coarse control the control represents the lower 4 of 12 bits See restrictions in section Lens Control Limita tions 12 Lens Vertical 1 increment 16 steps each This control has 4096 steps to give 1 step reso Absolute position increment is roughly 5 pixels lution it is split between 2 controls This part of C
90. Split screen cannot be used in conjunction with either PIP or Tiling Both PIP and Tiling must be disabled prior to enabling Split Screen control e RGB QUANTIZATION RANGE This control defines the RGB quantization levels for digital DVI and HDMI inputs using the RGB colorspace Typically graphics sources use the full range of levels for the given bit depth i e 8 bit 10 bit 12 bit and consumer electronics CE products typically use a limited range of data within the given bit depth This control must be set to limited to correct the levels for those CE products that use the limited space This adjusts what is considered black and white levels in the image As an example for 8 bit space full range RGB uses levels O black to 255 white Split Screen cannot be used in conjunction with either PIP or Tiling Both PIP and Tiling must be disabled prior to enabling the Split Screen control Input Levels Submenu Input Levels NOTES 1 Because the projector p z m Ui peters automatically optimizes input levels for all but Auto Input Level L the most unusual of sources it is RUE beddau A j Red Pr Input Drive 256 recommended that only experienced users use Green Y Blacklevel 256 m Levels adjust 4 te ticall the Input Levels submenu 2 Before Green Y Input Drive 256 m a es beginning check that overall contrast and brightness settings are near 50 and that color temperature is properly set up on an internal grayscale test pattern
91. TANT For a shared edge all blend procedures and settings should be identical on both projectors 1 Start with two projectors Display full white field test pattern from both 2 Inthe Edge Blending submenu enable Edge Blending by entering a checkmark in the top check box 3 SET STARTING POINTS FOR ADJUSTMENT a Set all blend widths to 0 b Go to More and set everything in the Edge Blending menu to 50 4 SET BLEND WIDTH On one projector increase the Blend Width for an overlapping edge for example if the projector s image is on left its right edge overlaps the adjacent image adjust Right Blend Width Use the same setting on the second projector for this shared edge 5 Re adjust width both projectors until the overly bright band at the midpoint of the overlapping blends disappears or just changes to very light gray For the shared edge use the same Blend Width setting on each projector NOTE If the best blend appears to be between two settings choose the wider setting for both projectors 6 CHECK BLEND If the blended region appears too dark or light in relation to the rest of the image a Increase Blend Midpoint in both projectors to lighten the overall blend decrease to darken the overall blend b Adjust Blend Shape in both projectors to fine tune change the amount of mid gray intensity as opposed to black white in the blend 7 Repeat with remaining projectors overlaps 8 Check completed display wall with t
92. TE TREE FOR MORE DETAILS TOR WHEN MAXIMIZED THE VIR WITHIN THE CURRENT MENU TUAL OSD DISPLAYS OVER THE ENTIRE PAGE SO THAT SUBSE QUENT MENUS CAN BE VIEWED WITHOUT SCROLLING No access to tabbed pages when maximized D OSD SECTION CONTAINS AN ON E AUTO SETUP BUTTON USES THE AND OFF BUTTON ONLY ONE IS MANUFACTURE S DEFAULT SET ENABLED DEPENDING ON THE CUR TINGS REFER TO SECTION 3 RENT STATE OF THE OSD CON OPERATION FOR MORE DETAILS TROL OF THE OSD IS ALWAYS AVAILABLE THROUGH THE REMOTE 4 4 M Series User Manual 020 100009 04 Rev 1 10 2009 Virtual OSD Menu Main Menu By selecting an option from a menu its associated window appears showing related information and input fields To return to the previous menu click the menu s title bar see Figure 4 7 To return to a previous menu click on the current menu s title bar or press ESC NOTE It is recommended to click the Hoson Maximize button to view the full screen size ieee Size amp Position Resize Presets Default Size Vertical Stretch I Keep Aspect On Auto Setup There are various types of menu elements Figure 4 8 and Figure 4 9 which allow you to define various projector settings FIGURE 4 7 VIEW PREVIOUS MENU Blanking These include Field entries e Drop down lists e Check boxes Sliders IMPORTANT When a menu option is modified through the Virtual OSD menu the projector s
93. The projector can be inverted and suspended from the ceiling using a specially designed ceiling mount fixture 118 100108 XX This mounting is recommended for those that want the projector out of plain view or have limited amount of space for the projector For more information contact your dealer IPN Te Use only the Christie approved ceiling mount kit designed for your projector Refer to the installation instructions and safety guidelines provided in the kit Special Mounting The projector can also be rotated front to back up to 360 degrees and fixed in a rotated position without affecting performance However the side to side tilt limit of the projector must not exceed 15 degrees to ensure optimal performance of the projector Adjusting Projector Height Tilt Adjusting Height You can modify the height of the projector to remedy a slightly uneven mounting surface by adjusting the three feet threaded into the bottom chassis Turn each foot clock wise or counter clockwise until the projector is level on all sides The front feet are adjusted by turning the collar see Figure 2 11 Front Foot The front feet do not rotate when adjusted The rear foot is adjusted by turning the entire foot see Figure 2 12 Rear Foot FIGURE 2 11 FRONT FOOT FIGURE 2 12 REAR FOOT M Series User Manual 2 15 020 100009 04 Rev 1 10 2009 Section 2 Installation and Setup CHKISTIE 2 2 6 2 16 Adjusting Tilt 1 Before adjus
94. There are several groups of related functions with each group selectable from the Main menu as shown at right Press MENU at any time to display this Main menu On the remote keypad enter the number corresponding to the function menu you wish to access such as 2 for the Image Settings menu Or use the UP DOWN ARROW KEY on any keypad to highlight the desired option then press ENTER The corresponding function menu or pull down list of further options will appear Size and Position Image Settings Channel Setup Configuration O co 1 5 n gt 5 No LASER RADIATION x DO NOT STARE INTO BEAM LASER DIODE Wavelength 670nm Max Output 1mW CLASS IILASER PRODUCT Main Menu VO AF a m Lamp Status Input Switching amp PIP gt Language English v Test Pattern Off v FIGURE 3 4 MAIN MENU With a function menu displayed enter a menu option number for any numbered option or use the UP DOWN ARROW KEY to highlight the desired option and then press ENTER Long menus have a scroll bar on the right use the arrow keys to access the remainder of the menu Locked items or items that do not pertain to the current action or condition appear dimmed and cannot be selected 3 8 M Series User Manual 020 100009 04 Rev 1 10 2009 CHRISTIE Section 3 Operation When finished with a function menu e Press EXIT to return to the previous screen OR Press MENU to leave the menu system and retu
95. US OF THE PROJECTOR PROJECTOR INFORMATION SECTION IS READ ONLY STATUS INDICATOR DISPLA YS THE OVERALL STATUS OF THE PROJECTOR BASED ON THE 12 CATEGORIES OF INFORMATION AVAILABLE NOTE CLICK THE STATUS INDICATOR LED TO DISPLAY THE STATUS WINDOW AND OBTAIN MORE INFORMA TION ABOUT ANY CURRENT ERRORS AND WARNINGS SEE 4 3 2 MAIN TABBED PAGE STA TUS LOGOUT BUTTON LOCATED AT THE TOP RIGHT CORNER OF THE WEB BROWSER IS USED TO LOG OUT YOU OFF OF THE WEB USER INTERFACE AND THE PROJECTOR POWER SECTION CONTAINS AN ON AND OFF BUTTON ONLY ONE IS ENABLED DEPENDING ON THE CURRENT POWERED STATE OF THE PROJECTOR SHUTTER SECTION CONTAINS AN OPEN AND CLOSE BUTTON ONLY ONE IS ENABLED DEPEND ING ON THE CURRENT STATE OF THE PROJECTOR S SHUTTER OSD ON SCREEN DISPLAY SECTION CONTAINS AN ON AND OFF BUTTON ONLY ONE IS ENABLED DEPENDING ON THE CURRENT STATE OF THE PROJEC TOR S ON SCREEN DISPLAY 4 2 4 2 1 Navigating the Web User Interface It is not recommended that you use the web browser s navigation functionality i e the Back and Forward functions as this will cause you to lose your web connection It is recommended that you navigate using the application interface and related functionality detailed in this section IMPORTANT Internet Explorer V6 0 has known performance issues and is not recommended to be used as the primary web browser for the web user interface It is rec
96. WN ARROW KEY NOTE Also enter numbers directly from the keypad To convert a lower case capital letter position on the letter and press FUNC followed by the UP ARROW KEY To convert a capital letter into a lower case letter position on the letter and press FUNC followed by the DOWN ARROW KEY Add or Delete a Character or Space To insert a space at the cursor location press FUNC then the RIGHT ARROW KEY To delete a highlighted character or space press FUNC then the LEFT ARROW KEY Delete all Characters Press FUNC followed by ENTER show2 show2 A A Press Press Func lt to insert a space before to delete show 2 show FIGURE 3 10 ADD DELETE CHARACTER OR SPACE Press Enter When Finished To accept edits and leave the edit window press ENTER NOTE Press EXIT at any time to cancel changes and return to the previously defined text M Series User Manual 3 11 020 100009 04 Rev 1 10 2009 3 3 3 12 Edit numerical values Enter numbers directly from the keypad to specify numbers representing projectors channels source setups or slots As each digit is entered it is inserted on the right of the field and the numbers already in the field are shifted on the left The channel numbers are defined with two digits for example if you enter only a single digit such as 7 for a channel number the channel will automatically be defined as 07
97. a software upgrade and is indicated by all the following The Status LEDs are cycling green The LCD displays the warning Image Processor Upgrading The LED on the Image Processor card flashes green The Web page shows a warning that the Image processor card is upgrading When this occurs the projector should not be AC power cycled and the Image Processor card should not be removed M Series User Manual 2 25 020 100009 04 Rev 1 10 2009 Section 2 Installation and Setup 2 3 2 26 CHRISTIE Connecting Sources Sources are connected to the Input Panel located at the back of the projector Figure 2 25 Input Panel The Input Panel allows one image processor board and up to 4 input cards to be inserted The input cards are hot swappable i e they may be plugged in and out while the projector is running The image processor should only be replaced when the projector is off or when it is in standby mode There are 6 option Input cards available e High Definition Multimedia Interface Twin HDMI High Definition Multimedia Interface e Analog BNC DMXC e Dual SD HD SDI Serial Digital Interface Dual Link DVI Video Decoder e DMX512 Interface These cards slide into the option slots shown in Figure 2 25 Input Panel The option cards can be used in any slot One or more of the option slots may be used with any combination of option cards including multiples of the same card type There may be up to 2
98. active inputs being displayed at any time either from one card or from 2 cards These 2 inputs can be routed to outputs or to the main or PIP video image NOTE See Section 7 Specifications for more details LEDS LEDs are located on the faceplate of each input card and indicate the following e Power ON Green Signal Valid Green Signal Invalid OFF Twin HDMI Input Card This card accepts one or two HDMI inputs and can route one or both inputs to the card s outputs Any input from any card can be looped out of this card The output label 1 OUT loops out the main image being displayed on the projector The output labelled 2 OUT loops out the image displayed in the picture in picture PIP Any input from any optional input card can be looped out of this card There are 5 LEDs on the module faceplate The PWR on the left side indicates power is applied and that the card is initialized The LEDs to the right side of the corresponding connectors indicate that a valid signal is detected In the case of the output s the LED indicates a signal is currently being looped out Twin HDMI Input 108 311101 01 S eee S 1 IN 2 IN 1 OUT 2 OUT M Series User Manual 020 100009 04 Rev 1 10 2009 Analog BNC Input Card This card accepts several types of sync modes In 5 wire sync mode all 5 BNC connectors are used If H and V connectors are swapped this card will still operate normally An analo
99. agnostic test and download the diagnostic test results to your computer A Interrogator in Progress bar appears Once the download is complete a File Download window appears Click Save to save the diagnostic test results file to your Network drive or hard drive 4 3 6 Admin Tabbed Page Users Under the Admin tabbed page select the User secondary tab Options are provided to add to and delete users from accessing the projector and change passwords NOTES 1 Do not use capitalization for usernames or passwords If capitalization is used for the username or password it will automatically convert it to lower case 2 Usernames can be a minimum of 4 and maximum of 32 characters passwords can be a minimum of 4 and maximum of 128 characters 4 8 M Series User Manual 020 100009 04 Rev 1 10 2009 Creating a User Name and Password asc ear 1 Click Add User to open the Add User window See Figure 4 11 mn 2 Type your username and password in the User name and Password Re type Password i fields respectively Cancel 3 Re type your password in the Re type Password field FIGURE 4 11 ADD USER WINDOW 4 Click Ok to save Change Password Password Change 1 Select the user whose password you wish to change from the Password a Users window See Figure 4 12 Re type Password Sl e 2 Click Change Password to open the Password Change window FIGURE 4 12 PASSWORD CHANGE WINDOW Type the new password in the Password field 4
100. al 4 12 020 100009 04 Rev 1 10 2009 CHRISTIE 5 Maintenance Installers service trained operators and all other users must maintain a safe operating environment at all times Read through this section in its entirety and understand all warnings and precautions before attempting to operate this projector 5 1 Safety Warnings and Guidelines 5 1 1 General Precautions A WARNING A WARNING Do NOT look into the lens Always power down the projector and disconnect all power sources before servicing or cleaning Il faut toujours teindre le projecteur et d brancher l appareil de la prise avant l entretien ou le nettoyage FIRE HAZARD Keep hands clothes and all combustible material away from the concentrated light beam of the projector Position all cables where they cannot contact hot surfaces or be pulled or tripped over All installation and maintenance procedures must be performed by a Christie accredited service technician Projector must be operated in an environment that meets operating specifications as listed in Section 7 Specifications 5 1 2 AC Power Precautions A WARNING A WARNING A WARNING M Series User Manual 020 100009 04 Rev 1 10 2009 Use only the AC power cord supplied Do not attempt operation if the AC supply and cord are not within the specified voltage and power range Refer to the license label on the back of the projector or Section 7 Specifications for rated voltage and power
101. amp 200W DS 6K M HD6K M 003 100856 XX DS 10K M Roadster S 10K M Lamp 350W HD10K M Roadster HD1OK M 003 100857 XX Air Filter Dust M Series Package of 6 118 100104 XX Air Filter Fog M Series Package of 6 118 100105 XX M Series User Manual 020 100009 04 Rev 1 10 2009 7 13 CHRISTIE Section 7 Specifications 7 11 Regulatory This product conforms to the following regulations related to product safety environmental requirements and electromagnetic compatibility EMC e FCC Part 15 Subpart B Class A CISPR22 EN55022 CISPR24 EN55024 e UL 60950 1 First Edition CAN CSA C22 2 No 60950 1 03 First edition e TEC60950 1 2001 e 2002 95 EC RoHS 7 14 M Series User Manual 020 100009 04 Rev 1 10 2009 CHRISTIE Appendix A Menu Tree A 1 M Series Menu Tree M Series User Manual 020 100009 04 Rev 1 10 2009 A 1 Menu Tree Appendix A A 3 CHRISTIE mes dw 10 09 Z sB6um s 10109 dlid f 1u unsn pv 10109 2319S s6um s uononp ti sIoN did sBu n s 1
102. any areas that do not match the center Also decide if any screen exhibits a more obvious color shift than other screens begin with this screen in Step 2b b Return to the Brightness Uniformity menu Beginning with the screen that exhibits the most obvious color shift s for each edge that exhibits a noticeably different color temperature from the center select the corresponding Uniformity adjustment menu Left Right Top or Bottom For example if any part of the left side is too blue too red or too green go to the Left Uniformity menu and adjust the colors i e change their light output until all portions of the left side closely match the center color temperature Adjust an edge first focusing on its center and then adjust its corners Repeat the color adjustment of sides and corners for each edge of the screen that does not yet match the center note that each corner is adjustable in either of its two adjacent side menus When done all areas of a given screen should match Repeat Steps 2a amp 2b for all remaining screens Step 3 Adjust Light Output in Eight Zones a For each screen compare the light output of each edge and corner to that of the center If any of the areas differ use the White Uniformity menu to match edges and corners to the center as described below Begin with the screen exhibiting the most obvious variations in light output Adjust edge White Uniformity first note that each edge adjustment also
103. appears mid gray For most applications this subtle control is best left close to 50 Blend Midpoint determines the white level at the blend midpoint the point equidistant between the beginning and end of the blend Increasing the Blend Midpoint setting creates a blend that appears brighter than the rest of the image Decreasing the Blend Midpoint setting creates a blend that is darker than the rest of the image A setting of 50 means the midpoint is approximately 50 black for best results in most applications keep fairly close to this default Show Blending Overlap turns your defined blend width area to solid gray so that if needed simply overlapping the gray bars can seamlessly align two adjacent images Toggle the Show Blending Overlap off M Series User Manual 020 100009 04 Rev 1 10 2009 CHAISTIE Section 3 Operation to reactivate the blend effect NOTE Blending Overlap appears as Reserved when Christie TWIST is installed Other Functions For convenience the Edge Blending submenu also includes related options for enabling a specific color and or test pattern or for working with colors or the lamp Such functions duplicate those provided elsewhere in the menu system Edge Blending Procedure NOTES 1 Before attempting to work with edge blending software functions align the projectors images by correctly overlapping the displays from your intended external source 2 Match colors and the brightness uniformity IMPOR
104. ast all current settings are collectively stored in the projector s memory as a unique two digit channel such as 09 You can have numerous distinct channels available for the same input any of which can be selected by using the CHANNEL key on the keypad followed by the two digit channel number Shown in Channel List is a sample channel list available from CHANNEL NOTE The CHANNEL key may display a Current Channel Y channel list or not depending on what you have defined Main Channel 01 for Display Channel List see Menu Preferences later 01 1 2 iSVid 15 73kHz i59 94 Hz in this section 02 44 pDig 33 72kHz p29 07 Hz SWITCHING INPUTS There are 4 methods for A A A A A i Channel Signal Horizontal Vertical selecting an Input Sici Type CERIN pies Frequency 1 Press the INPUT key This will display a list of the 4 vee li ead slots with the card type and input signal type in each slot The currently selected input for the main image will be highlighted Scroll up or down through the list and press ENTER to make a new selection Press the INPUT key again to show the list and allow the selection for the PIP image Repeatedly pressing the INPUT key will toggle between the main and PIP image FIGURE 3 11 CHANNEL LIST 2 Press the appropriate direct SLOT key to quickly display one of the inputs on the selected slot to the main image This will not bring up any menu selection and is only applicable for the main image M Se
105. ceives feedback via serial links RS 232 and RS 422RS 422 or Ethernet communications to the projector refer to the Serial Command document provided in the Dealer Section of the Christie Website PN 020 100224 XX 1 Serial Port Connections RS 232 and RS 422 serial ports available on the projector You can connect a device with a serial interface such as a computer to either of these connectors not both and control the projector remotely by entering specific serial communication commands see Section 3 Operation Communications Submenu and the Serial Command document provided in the Dealer Section of the Christie Website PN 020 100224 XX 2 Connecting RS 232 Two nine pin D sub connectors labeled RS 232 IN and RS 232 OUT on the input panel are dedicated to serial communication see Figure 2 19 Connecting RS 232 Using the appropriate serial communication cables connect the controlling source such as a personal computer to the RS 232 IN connector Set the projector baud rate to match that of the computer See Section 3 Operation for details on changing the projector s baud rate RS232 IN To computer FIGURE 2 19 CONNECTING RS 232 3 Connecting RS 422 To control the projector with a computer or other controlling device with RS 422 capability connect a RS 422 serial communication cable between the controlling device and the RS 422 port on the projector see Figure 2 20 Connecting RS 422 RS 422 is better suited t
106. columns indicate horizontal and vertical frequencies or if there is a defined name for a channel it appears here The H amp V frequencies will not appear if a name has been defined for the channel instead the name is only seen The H amp V frequencies are inserted as the name when the channel is first created The vertical frequency is displayed with the sync polarity The remaining columns pertain to each signal type such as Input number slot location a variety of icons indicating access to each channel and an abbreviated description of each signal type NOTE Use UP ARROW KEY and DOWN ARROW KEY to see the remaining channels not visible in the initial display of channels SIGNAL TYPE The channel list or the Channel Setup menu identifies signal types abbreviations as defined below in Table 3 2 Abbreviations for Signal Type Composite Sync on the H C input or the V input 4 wire These abbreviations are preceded by either an i interlaced signals or p progressive signal Table 3 2 Abbreviations for Signal Type The first 5 items in this table is analog RGB with various sync combinations indicating Sync Source when editing the channel Abbrev Signal Type No Sync 4WH Composite 4 wire on HC input 4WV Composite 4 wire on V input SG Sync on green 4 wire 5W Separate H V 5 wire 5WR Separate H V swapped 5 wire SVid S Video CVid Composite Video Dig Digi
107. controls are moved below 25 any RTE that is currently running will be told to stop user abort regardless of which RTE or where it was executed from Control Trigger Rules 1 Projector control values are not mapped to slider values in a 1 to 1 mapping where possible i e when a control value has a range from 0 to 1 it is not expected that the slider will only be moved from 0 to 1 A greater range of movement is allowed for on the slider 2 Toggle Controls Due to possible dithering between two values the DMX control values accommodate a hysteresis 1 e must move slider above 75 to turn on and below 25 to turn off 3 Slider Lock This is used to lock out all controls if it is in the enabled state If the slider lock is unlocked all channel changes that have occurred since the lock was enabled will then be applied 4 Apply All Channels will force the set of all values on the board in an effort to synchronize control values with the slider values currently set subject to slider lock restrictions above 5 Lens Controls Values are split between 2 channels to give the full 4100 or 2100 values of resolution The coarse control represents the first 8 bits and the fine control the remaining 4 bits 6 Power Control has a built in timer the control must remain in the on range 75 100 or in the off range 0 25 for 5 seconds before it takes effect 7 Lamp Operation only allows for the selection of 2 items either Aut
108. controls which are expected to be used throughout the course of an actual show ie shutter channel change e Advanced 64 channels This includes all the functionality of the Basic channels plus additional con trols for setup Refer to Appendix C DMX ArtNet for the DMX Channel Allocation BASE CHANNEL There are 512 channels per universe This control specifies the starting channel for this projector If multiple projectors are used on the same universe and are to be controlled independently this value must be changed i e If both projectors are using the basic personality 20 channels projector 1 should start at base channel 1 and projector 2 should start at base channel 21 NOTE The Base channel setting must allow enough space for the channels required by the selected personality i e If the Basic Personality is selected the Base Channel may be in the range 1 492 If the Advanced Personality is selected the Base Channel may be in the range 1 448 SOFTWARE TERMINATION This control supplies a signal to the card to switch termination resistance in out of the circuit It may be necessary to clear this setting upon card removal By default SW termination is disabled The Input termination 2 Watt 120 Ohm is required on the last DMXC card in a loop through configuration i e only on the last projector Termination may be either hardware by plugging in a termination dongle etc or may be switched in by software but should
109. derations Proper installation of your projector will ensure the quality of your display Whether you are installing a projector temporarily or permanently you should take the following into account to ensure your projector performs optimally Choose the installation type that best suits your needs front or rear screen floor mount or inverted mount Front Screen Floor Mount Installations Advantages Considerations Easy to set up Shares floor space with audience Can be moved or changed quickly Easy to access Front Screen Inverted Mount ceiling Installation Advantages Considerations Does not take up audience space Installation is more permanent Projector is unobtrusive Itis more difficult to access the projector Projector cannot be accidentally moved Rear Screen Floor Mount Installation Advantages Considerations Projector is completely hidden Projector is easily accessed Usually good ambient light rejection Requires separate room or enclosure Installation cost is usually higher Rear Screen Inverted Mount ceiling Installation Advantages Considerations Projector is completely hidden Requires separate room e Usually good ambient light rejection Installation cost is usually higher More difficult to access projector M Series User Manual 2 7 020 100009 04 Rev 1 10 2009 Section 2 Installation and Setup Rear Screen
110. dicate their status M Series User Manual 2 5 020 100009 04 Rev 1 10 2009 Section 2 Installation and Setup CHKISTIE 2 6 Cooling and Air Vents There are numerous air vents located around the projector It is important these vents remain unobstructed Adequate airflow through the projector will prevent it from overheating Kensington Lock Attachment Located at the rear of the projector to the left of the AC receptacle is a Kensington lock attachment point This provides the ability to secure the projector against possible theft Lamp Door The lamp doors are located at the side of the projector which provides easy access to the lamp module for replacement Refer to Section 5 4 Replacing the Lamps The lamp doors are fitted with safety interlocks which switch the lamp off when the door is opened The lamp doors are provided with clear windows to indicate when the lamps are on FRONT IR SENSOR BUILT IN KEYPAD COOLING INTAKE AIR gt VENTS COOLING EXHAUST AIR PROJECTION VENT ADJUSTABLE FOOT FIGURE 2 5 ABOUT THE PROJECTOR FRONT VIEW Front amp Rear IR Sensors The two IR sensors located on the projector receive transmissions from the IR remote from up to 100 feet away It is important to keep the transmission path to these sensors unobstructed for uninterrupted communications with the projector The rear IR sensor is located at the back of the projector between the status LEDs and the front IR sen
111. direct slide bar as usual if the display is turned off see OSD or Menu Preferences menu the slide bar just wont be visible 2 A direct slide bar disappears if it is not used within five seconds Check boxes Conditions are present if its adjacent check box contains a oni ate a Gale nae checkmark To toggle the check box highlight and press ENTER or highlight and y use RIGHT ARROW KEY to check and LEFT ARROW KEY to uncheck If a check box FIGURE 3 7 EXAMPLE OF A is numbered enter its number to immediately toggle the check box CHECK BOX Pull down lists To see a pull down list of options available for a given parameter e Highlight the list and press ENTER or Enter the menu option number Use the UP ARROW KEY or DOWN ARROW KEY to navigate up and down within the list Press ENTER to choose an option from the list Communications 1 Serial RS 232 IN Options gt 2 Serial RS 232 OUT Options gt 3 Serial RS 422 Options gt 4 Projector Address 5 Network Routing Separate J gt 4 Separate 6 Ethernet Settings gt 2 RS 232 and RS 422 Joined 7 Broadcast Keys Oly 3 RS 232 and Ethernet Joined 8 Front IR Enabled x 4 All Joined 9 Rear IR Enabled Oly 10 Wired Keypad Enabled Ol 11 DMX ArtNet Settings gt FIGURE 3 8 EXAMPLE OF PULL DOWN LIST If you prefer to quickly scroll through a list without first pulling it down highlight the option and use LEFT ARROW KEY or
112. dress in the address bar assigned to your projector 2 Select the appropriate language from the Language drop down list located in the upper left hand corner See Figure 4 1 3 Type your username and password in the User Name and Password see Figure 4 2 fields respectively Both entries are case sensitive Login User Name Sat Password l FIGURE 4 1 LANGUAGE DROP DOWN LIST FIGURE 4 2 LOGIN 4 Click the Login button The Main window see Figure 4 3 appears E CHAISTIE I Log D Le Himan Hros admin 3advanced td about lt Q Projector Information Power j I J 15 02 09 Main Active Input Window 10216825147 OI OT 06 2050 s4 c PIP Active Input Window B A FIGURE 4 3 MAIN WINDOW M Series User Manual 4 1 020 100009 04 Rev 1 10 2009 Section 4 Web User Interface CHRISTIE The following table describes each area found in the Main window See Figure 4 3 SECONDARY TABS SPECIFIC TO A PRIMARY TAB LOCATED ALONG THE BOTTOM OF THE MAIN WINDOW PIP ACTIVE INPUT WINDOW AND MAIN ACTIVE INPUT WIN DOW SECTIONS ARE READ ONLY C THESE SECTIONS PROVIDE DROP DOWN LIST SELECTIONS REFER TO SECTION 3 OPERATION FOR MORE DETAILS PRIMARY TABS LOCATED ALONG THE TOP OF THE MAIN WINDOW CURRENT STATUS BAR PRO VIDES INFORMATION MESSAGES ACCORDING TO THE CURRENT STAT
113. e or if there is significant color drift This moves the clamping pulse from the normal back porch location which is likely too short to the tip of the horizontal sync pulse Tri Level is typically needed for an HDTV source e INPUT PEAK DETECTOR A tool to assist with defining individual input levels enabling you to accurately set the Input Levels for any particular source with the appropriate image Enabling the Peak Detector activates a special operating mode for detecting only pixels that are considered black or white all other levels are displayed as a mid level gray When used with a smooth grayscale pattern in which black and white are known to be at opposite edges of the image you can watch these isolated areas while adjusting individual black levels and input drives until both black and white edges are just visible and distinguished from neighboring pixels Images from this source will then display correct blacks and whites without crushing See Figure 3 29 Adjusting Input Levels Using the Peak Detector RED EXAMPLE SHOWN 1 Display a 16 level grayscale test pattern from the desired external source and enter a checkmark in the Input Peak Detector check box NOTE The Input Peak Detector will initially render the grayscale as a uniform gray field before adjustment or extreme crushing 2 Display one primary color NOTE Select Auto Color Enable to ensure the correct color is displayed for each setting 3 For the current color adju
114. e filter Wash using mild soap and water NOTE Dry the filter before using 3 Insert the new or cleaned air filter s as C 4 Secure the filter door by tightening the 2 captive screws loosened in Step 1 Se a C T Fog Filter FIGURE 5 1 REPLACE FILTER Fog filters should be replaced after each use of the projector to a maximum of 20 hours The life of the filter is approximately 20 hours based on environmental conditions Leave the filters in their sealed packaging until ready for use NOTE The fog filters cannot be re used or they will clog up with oil and the projector will overheat and shutdown Replace Filters 1 Unscrew the 2 captive screws at the top of each filter door Figure 5 1 Allow the door to rest down away from the projector 2 Slide the filter or dust air filter if fitted out 3 Insert the new air fog filter with ensuring the white layer facing into the projector NOTE Each filter is a two stage filter the black activated charcoal layer faces out and the white layer faces the projector 4 Secure the filter door by tightening the 2 captive screws loosened in Step 1 Maintenance of Optics DANGER Always power down the projector and disconnect all power sources before servicing or cleaning Il faut toujours teindre le projecteur et d brancher l appareil de la prise avant lentretien ou le nettoyage Optical Excluding Lens Unnecessary cleaning of optics increases t
115. e set for projector allowing for automatic scaling of all input images to required output format User definable gamma curves 7 7 Section 7 Specifications 7 3 7 4 Image Processor Performance Min input pixel rate 13 Mpix s Max input pixel rate 165 Mpix s Standard mode Max input resolution 2048x1536 QXGA Min input resolution 640x400 Max input frame rate with Standard Image Processor Card Processing 10 bit throughout Source switching time time less than 1 second 50Hz at 2048x1536 QXGA CHRISTIE With sources that can output minimum blanking otherwise lower vertical rates Except Dual DVI input in dual link mode dual 8 bit input paths into 10 bit processing Seamless switching with switch Input Source Signal Compatibility 7 4 1 Analog Only Input Connectors Color spaces signal types A D conversion 7 4 2 Twin HDMI Input Connectors Color spaces signal types 7 4 3 Dual Link DVI Input Connectors Color spaces signal types A D conversion Frequency 5 female BNC 75 Ohm R Pr G Y B Pb H C V RGB YPbPr 10 bits 2 independent HDMI inputs type A 2 loop out connectors type A RGB YCbCr 4 2 2 YCbCr 4 4 4 HDCP support HDMI 1 3 supported not including audio except 12 bit color dithered to 10 bits 16 bit color not supported 1 dual link DVI I 1 analog 15 pin VGA HDCP support 10 bits for single link DVI input 8 bits for dual link DVI in
116. e to access the lamp compartment NOTE When the door is open the lamps will shut off 3 Wait Wait at least 10 minutes before handling the lamps to allow the lamps to cool FIGURE 5 2 REPLACE LAMP 4 Remove the old lamp a Unscrew the 3 captive screws securing the lamp using a 1 Phillips screwdriver b Carefully remove the lamp from the projector Place the old lamp in a location where it cannot fall or be bumped EN fe Handle lamps with extreme caution Dispose of lamps according to safety regulations for your area 5 To use lamp OFF command a Inthe lamp menu select CHANGE LAMP This will prompt for the old lamp serial number if it was not previously entered b Enter the new lamp serial number NOTE This action is not mandatory it is recommended for accurate lamp statistics to be archived 6 Install the new lamp a Take precaution to align the new lamp properly in the correct orientation inside the projector b Press firmly to seat the lamps ensuring the lamp is secure c Using the Phillips screwdriver and captive screws secure the lamp door and tighten the captive screw NOTES 1 Zf the lamps were turned off with the OFF command in step 1 they will have to be manually turned on 2 If the lamps were turned off by opening the door then they will automatically turn on again when the door is closed M Series User Manual 5 5 020 100009 04 Rev 1 10 2009 CHRISTIE 6 1 6 1 1 6 2 6
117. e used requires separate PC based Arbitrary Gamma software application to create the table and the Web UI to download it NOTE If any of these special user curves have been installed their names will appear in the Gamma Table pull down list e GAMMA FUNCTION Defines the base gamma power curve used when the base gamma table value is set to Gamma Function This value combined with gamma slope setting determines the base gamma table to be used as the custom base table The curve is generally a power curve with a small linear segment at the bottom defined by the slope GAMMA SLOPE This control defines a slope to be used for the base custom gamma table for a small section at the bottom of the curve This slope can be used to bring in or out the low level blacks in the image This slope combined with the gamma function define the custom gamma table DETAIL SETTINGS Adjusts the sharpness of the image Setting detail above the halfway point can introduce noise in the image Lower settings can improve a noisy signal DETAIL Adjust the sharpness of the image Setting detail above the halfway point can introduce noise in the image Lower settings can improve a noisy signal This command does not take effect unless the minimum change required in the Detail Threshold control is reached TEXTURE ENHANCEMENT Applies texture detail enhancement based on adaptive horizontal vertical and diagonal large edge and small edge enhancement p
118. e user to make minor changes and attempt to reapply the corner settings Either the co ordinates must be adjusted or the free run frequency must be changed to fall within the allowed bandwidth M Series User Manual 020 100009 04 Rev 1 10 2009 The FUNC HELP key combination will immediately disable the Keystone Brightness Uniformity Edge Blending and Black Level Blending features This is helpful when in some extreme keystone configurations some image corruption may appear and or the menus may not be readable Although FUNC HELP disables these features it will not overwrite their settings If keystone is simply enabled again the same image corruption may occur After pressing FUNC HELP it is recommend to immediately Reset Keystone Settings which will set all keystone co ordinates to zero BRIGHTNESS UNIFORMITY Brightness Uniformity provides further refinement of displays already matched for their primary colors and overall light output Use Brightness Uniformity to create an exceptionally smooth image in which no area appears brighter than another In the Brightness Uniformity menu enable the Brightness Uniformity Enable check box to access a multitude of adjustments for light output control in specific areas throughout the image Your settings apply as long as the Brightness Uniformity Enable check box is enabled While making adjustments enable the Coarse Adjustment check box to apply Brightness Uniformity settings with a large
119. ect the keypad toward the projector s front or rear IR sensor One of the two IR sensors on the projector will detect the signal and relay the commands for internal processing A laser pointer is built into the remote keypad See Figure 3 1 Remote Keypad e Built in Keypad located at the side of the projector see Figure 3 2 Built In Keypad While each of the keypads provides complete control of the projector they differ slightly in their arrangement of keys and in what functions can be accessed directly with a key press rather than requiring use of the menu system You may find one keypad more convenient than another for your specific installation and application Guide to Keypads Keep these guidelines common to both keypads in mind e Press keys one at a time there are no simultaneous key combinations required NOTE Use POWER SHUTTER and OSD functions by doing one of the following press and hold 2 seconds or press twice quickly followed by pressing either the UP ARROW KEY to switch on or the DOWN ARROW KEY to switch off once See Figure 3 1 Remote Keypad e Arrow keys are held down for continuous adjustment movement in the related key direction NOTE Jn serial networks pause briefly between adjustments to make sure that more distant projectors can keep up with the commands If you press a key while the projector is still responding to the previous action such as during power up the second key press may not take effect
120. ectors If necessary adjust Black Level Blending first with the Black test pattern then use the White test pattern to blend the white levels on the blend edges The final step is to check the blended image with an external source There is a centerline both horizontal and vertical in the Edge Blending test pattern The intersection of these lines is the true center of the projector s display area The Show Blending Overlap control enables or disables edge blending overlap When enabled this will make the size of the Edge Blending regions obvious This control should only be used during setup M Series User Manual 3 43 020 100009 04 Rev 1 10 2009 3 44 What is a Blend Blend In simple terms a blend appears as a gradient strip along an edge of a projected image It is darkest along the extreme edge of the image and lightens nearer to the rest of the image see right How Are Blends Used In multiple projector walls complementary blends between neighboring images can compensate for the extra brightness or intensity where these edges overlap By controlling blend width and other properties you can achieve uniformity across the group of images Visible overlaps will disappear Figure 3 37 Edge Blending Concept FIGURE 3 36 EDGE BLENDING For best results use the same projector model and type throughout your display wall In addition avoid high gain screens whenever With edge blending Overlap Blend possible the op
121. ellow notch filter Only available on HD models 7 2 9 Constant Lamp Output Management LiteLOC 7 6 CHRISTIE Scene controlled motorized iris automatically adjusts to image content 20 Hz Within ambient noise level of projector Configurable per channel Fans automatically adjust to required speed to maintain projector at proper operating range as function of outside ambient temperature All fans are off when projector is in standby and not running active loop through on a Twin HDMI option card 5 to 40 degrees C Smooth speed transitions with no abrupt audible changes User selectable optical color switch in or out to enhance color space Configurable per channel Automatically adjusts lamp output to maintain constant lumens setting within operating range of lamp M Series User Manual 020 100009 04 Rev 1 10 2009 CHRISTIE 7 2 10 Shutter Open Closed Activation 7 2 11 Lamps Dual Mercury lamp system 7 2 12 Status LED Status LED s Lamp 1 Lamp 2 Section 7 Specifications Light transmitted to projection lens All light blocked no light on screen Operation in less than 0 25 seconds Lamps are accessed from side of projector Lamps are individually swappable while the projector is running Located at back of projector LED STATES Off Lamps are off Yellow Lamp time has expired and lamp should be replaced Green Lamp is on and operating correctly Flashing red La
122. en viewed online the text appears in blue indicating a direct link to that section For example refer to Service Manual e References to software menus and available options appear bold such as Main menu and available options appear italicized such as Preferences e User input or messages that appear on screen in status display units or other control modules appear in Courier font Forexample No Signal Present Login christiedigital e Error codes LED status codes appear bold e g LP Al etc Operational states of modules appear capitalized such as power ON OFF Purchase Record and Service Contacts Whether the projector is under warranty or the warranty has expired Christie s highly trained and extensive factory and dealer service network is always available to quickly diagnose and correct projector malfunctions Complete service manuals and updates are available for all projectors Should a problem be encountered with any part of the projector contact your dealer In most cases servicing is performed on site If you have purchased the projector fill out the information below and keep with your records Table 1 1 Dealer Dealer or Christie Sales Service Contact Phone Number Projector Serial Number Purchase Date Installation Date The serial number can be found on the license label located on the back of the projector Table 1 2 Ethernet Settings Default Gateway DNS
123. ent x 0 661 y 0 337 Valid Color Space Yes 3 Red Part of Red 1000 mum Set to 1000 4 Green Part of Red 0 Judge by eye and 5 Green Color Adjustment adjust all as needed 6 1 Select Color Adjustment User 1 2 Color Temperature 6500 mwa By x y equivalent X 0 661 y 0 337 Valid Color Space Yes 3 Red Part of Green 0 4 Green Part of Green 1000 lt Set to 1000 5 Blue Part of Green 0 Judge by eye and 6 Blue Color Adjustment adjust all as needed 1 Select Color Adjustment User 1 2 Color Temperature 600 ww By x y equivalent x 0 661 y 0 337 Valid Color Space Yes 3 Red Part of Blue 1000 mum Set to 1000 4 Blue Part of Blue 0 Judge by eye and 5 Blue Part of Red 0 adjust all as needed 6 White Color Adjustment 1 Select Color Adjustment User 1 2 Color Temperature 6500 mmm By x y equivalent x 0 661 y 0 337 Valid Color Space Yes 3 Red Part of Green 1000 mmm 4 Green Part of Green 1000 mmm Set to 1000 5 Blue Part of Green 1000 Judge by eye and 6 Copy From Max Drives Y adjust all as needed FIGURE 3 44 COLOR MATC HING USING COLOR SATURATION MENU 3 57 Section 3 Operation 3 13 3 14 3 58 CHRISTIE Remote Control of the Projector As an alternative to using a keypad most projector functions can be controlled remotely typically at a controller such as a PC via a web interface VIA ASCIT MESSAGING Connect a serial link between your con
124. epending on which personality is used correctly While the DMX specification allows for device overlapping this may cause undesired results Below is a table of how projectors should be configured assuming that all projectors are to be controlled independently and use the same personality Table C 1 Basic Correct Example Table C 2 Advanced Correct Example Base Channel All projectors using Basic Base Channel All projectors using Advanced Personality Correct Personality Correct 1 Projector 1 20 ch 1 Projector 1 64 ch 21 Projector 2 20 ch 65 Projector 1 64 ch 41 Projector 3 20 ch 129 Projector 64 ch Table C 3 Basic Incorrect Example Base Channel All projectors using Basic Personality Incorrect Projector 1 20 ch Projector 2 20 ch Projector 3 20 ch M Series Setup Guide 020 100011 04 Rev 1 10 2009 CHAISTIE Appendix C DMX ArtNet DMX Channel Layout Channel Name Description Value Notes Locked 0 75 No Channel changes will be applied when this 1 Slider Lock control is locked Channel changes made while Unlocked 75 100 the slider is locked will be applied once the slider becomes unlocked No Action 0 75 Sets all channel values may take quite a few 2 Apply All Channels seconds Only applied when slider l
125. erlock failure Check the LCD display for an error If the other lamp has ignited and an image can be seen use the remote keypad and check the Status menu for any errors and for the Lamp door interlock status If not lamp has ignited use the Virtual OSD on the web interface to check these items The interlock failure could be an open lamp door or a failed lamp fan 2 Using the remote keypad or Virtual OSD as above check the lamp mode in the Lamp menu This may be set to a single lamp or dual lamp mode Check in the Status menu what the reported mode is 3 For suspected communication failures power down the projector and try again 4 Ifthe lamp does not ignite after the second attempt and after powering down and up again complete AC power down then replace the lamp M Series User Manual 6 1 020 100009 04 Rev 1 10 2009 Section 6 Troubleshooting CHRISTIE 6 2 2 Lamp Suddenly Turns OFF 1 Check lamp power through the remote keypad checking the Lamp menu or from the web user interface Advanced Lamp menu Try increasing lamp power Check for an alarm condition on the LCD keypad display Replace the lamp 6 2 3 Flicker Shadows Or Dimness 1 Check lamp power through the remote keypad checking the Lamp menu or from the web user interface Advanced Lamp menu Try increasing lamp power 2 Replace the lamp 6 3 LCD 6 3 1 Blank Screen No Menu Displaying 1 Press any arrow key on the built in keypad The backlight on t
126. error SXGA centering error WUXGA centering error WXGA centering error 7 2 Feature Set 7 2 1 Airflow Air intakes Air exhaust 7 2 2 Air Filters Optional Filter media types Filter access 7 2 3 Dust Sealing Dust sealed DMDs Dust sealed illumination system t5 of vertical offset 32 pixels t5 of vertical offset 26 pixels 5 5 of vertical offset 32 pixels t5 of vertical offset 26 pixels Right side of projector Hot lamp exhaust rear of projector Cool light engine exhaust left side of projector Coarse foam filter Fog filter Service interchangeable via access panel Gasket sealed Sealed from lamp input to entrance face of prism when lamps are installed M Series User Manual 020 100009 04 Rev 1 10 2009 CHAISTIE 7 2 4 ILS Intelligent Lens System Motorized lenses and lens mount with position encoding Accuracy Manual control Calibration User Configurable Calibration Modes Calibration time Bore sight Travel time stop to stop Zoom and Focus Offsets Manual Lens Movement 7 2 5 Projection Lens Compatibility Lens type Section 7 Specifications Zoom focus horizontal and vertical offsets 2 pixel 1 3 pixel fine movement control per button press on any applicable User Interface e g remote Automatic calibration on lens change detection Automatic calibration on power up Manual calibration lt 10 secs when required 3 point 4 degrees adjustment and loc
127. ess level over time As the lamp ages the projector will increase power as needed to closely maintain the required output from the lamp Select Constant Power to specify the power level supplied to the lamp Both Constant Intensity and Constant Power modes extend lamp life NOTES 1 On DLV projector models the power control is fixed at 150W to maximize lamp life In Constant Power mode use the Iris Position slider Dynamic Iris Menu see Appendix A Menu Tree to adjust brightness Make sure that Iris is set to Manual mode In Constant Intensity mode use the Intensity slidebar to adjust brightness 2 Constant Intensity mode cannot operate correctly if the LiteLoc calibration has not been performed POWER Set the lamp s power in Watts The Power control represents the amount of power sent to the lamp s Power increases when operating in Intensity mode until it reaches its maximum The value remains stable when in Max Brightness or Power mode If using Power mode setting a lower power level reduces brightness and extends lamp life INTENSITY Adjust the lamp intensity to of full This value is used as a target value by the LiteLOC system to maintain constant intensity NOTE When operating in Constant Intensity mode on DLV projector models the Intensity slidebar will adjust both the lamp intensity and the Iris position to maintain the required intensity YELLOW NOTCH FILTER Refer to 3 7 Image Settings Menu SINGLE LAMP SWITCH ON FA
128. f NTSC PAL SECAM If HDTV If HDTV 10800 eae oat i i _ x a x 800 variable borders image cropped at sides image cropped all around FIGURE 3 20 NO RESIZING If PC or non HDTV For all sources anamorphic signal FULL SIZE uses all pixels for displaying the image 1050 Image ies my regardless of source or original aspect ratio Incoming source material having a different aspect ratio than 1400 1400 the projector will be stretched for display FIGURE 3 21 FuLL SIZE M Series User Manual 3 19 020 100009 04 Rev 1 10 2009 3 20 e FULL WIDTH fills the projector s display from left to right without changing the original aspect ratio of the eee coe image Depending on the source data at the top and bottom may be discarded cropped or the display may mm pey eee have black borders at the top and bottom called letterboxed gt gt FIGURE 3 22 FULL WIDTH e FULL HEIGHT fills the display from top to bottom Depending on the source this may create borders incoming anamorphic if video 1050 Image 1050 Cropped 1400 Cropped 1400 FIGURE 3 23 FULL HEIGHT e ANAMORPHIC displays an anamorphic image in its native 16 9 aspect ratio The image will fill the screen from side to side and be centered between black bars at top and bottom For non HDTV anamorphic only Controls both the image width and height in ta
129. fail option is enabled the projector will always attempt to turn on the selected lamp first but if that lamp fails all attempts to strike it will cause a switch to the other lamp This option is not enabled for DLV models which are restricted to operate in Dual Lamp Use mode only Dual Lamp Use mode will use both lamps together After 3 failed attempts to stay in Dual Lamp Use mode the projector will switch to Single Lamp operation however the user selected mode remains as Dual Lamp Mode M Series User Manual 020 100009 04 Rev 1 10 2009 CHRISTIE Section 3 Operation Auto Select a Single Lamp mode will choose the best lamp for single lamp operation The lamp selection is based on e The lamp that will be the fastest to turn on a lamp can be chosen if it is currently on or if it has been off for at least the minimum hot re strike period The lamp that has been least used determined by the lamp voltage which increases as the lamp ages The lamp with the fewest hours this attempts to balance the lifetime of the two lamps In Auto Select Single Lamp mode a failure of a lamp to strike will cause a switch to the other lamp This option is not enabled for DLV models which are restricted to operate in Dual Lamp Use mode only LAMP MODE Determines how the lamp s power and intensity are controlled If Maximum Brightness the lamp burns as brightly as possible Select Constant Intensity mode to maintain a specific brightn
130. fic files change the Logo position background color gamma properties and select the interrogation level m T G Ce TALS AT HEM t power OFF the projector Sf yos wish to upgejde C gt Backup f Gamma Properties 3 oe L Upgrade tM I B gt Restore Projector Date and Time Ma y J Hide 4 Brows 2009 05 06 10 42 44 YX J FIGURE 4 10 ADMIN WINDOW 4 6 M Series User Manual 020 100009 04 Rev 1 10 2009 CHRISTIE Section 4 Web User Interface The following table describes each area found in the Admin window See A INTERROGATOR SECTION RESTORE SECTION ALLOWS C BACKUP SECTION ALLOWS ALLOWS YOU TO SELECT A YOU TO SELECT THE FILE YOU TO SELECT THE FILE AND INTERROGATOR LEVEL FROM AND FILE TYPE THAT YOU FILE TYPE THAT YOU WISH TO THE INTERROGATOR LEVEL WISH TO RESTORE BACKUP DROP DOWN LIST D UPLOAD SECTION ALLOWS LOGO POSITION AND BACK F GAMMA PROPERTIES SEC YOU TO SELECT THE FILE GROUND COLOR SECTION IS TION IS ENABLED WHEN YOU AND FILE TYPE THAT YOU ENABLED WHEN YOU SELECT SELECT A GAMMA FILE TYPE WISH TO UPLOAD A LOGO FILE TYPE FROM THE FROM THE UPLOAD SECTION UPLOAD SECTION G SYNC BUTTON IS USED TO UPLOAD BACKUP UPGRADE BUTTON REFER TO SET THE PROJECTOR DATE AND TIME TO MATCH THAT ON YOUR COMPUTER RESTORE AND INTERROGA TOR BUTTONS PERFORM THEIR RESPECTIVE FUNC TIONS AFTER THE SETTING
131. filter will decrease the fine control precision of some slider controls By default this filter is set to 0 Off It is not recommended to use this feature unless you are experiencing problems with your DMX input HOST NAME This will be used to respond to ArtNet polling queries Christie will be the short name Christie HostName will be our long name By default the host name is composed from the projector name and serial number Default lt unit name gt lt serialno gt Note that the Host name is also defined at Configuration gt Communications gt Ethernet Settings gt Host Name Geometry amp Color Submenu In the Configuration menu select the Geometry and Color submenu when you need to modify overall color performance and or image geometry for all sources e TEST PATTERN Choose the desired internal test pattern or select OFF to turn off a test pattern Alternatively use the TEST key for cycling through test patterns GEOMETRY CORRECTION Submenu Keystone is typically caused by tilting the projector in relation to the screen so that the lens surface and screen are no longer parallel to each other Vertical keystone is used to correct a keystoned image shape in which the top and bottom borders of the image are unequal in length and both sides of the image are inclined toward the top or bottom edge see Figure 3 33 Vertical Keystone i FIGURE 3 33 VERTICAL KEYSTONE M Series User Manual 3 39 020 10
132. g graphic source such as a VGA from a PC can be connected The card can operate in 4 wire sync mode which accommodates 4 wire RGBC sources The composite sync cable can be connected to either the H C BNC or the V BNC The card supports 3 wire RGB or YPBPr sync modes sometimes called sync on Green SOG In this mode the H C and V connectors are not used The sync is connected to the Green Y BNC connector This card offers no loop out capability There are 2 LED s on the module faceplate PWR indicates power has been applied and the card is initialized signal indicates a valid signal has been detected Analog Input 108 309101 01 Red Pr Green Y Blue Pb Dual SD HD SDI Input Card This card accepts both standard definition SD and high definition HD serial digital interface SDI signals from 1 of 2 standard definition SD or high definition HD SDI sources Both single link HD and dual link HD signals are accepted The card has two SD HD SDI outputs each of which is loop through for its respective input There are 3 LEDs on the module faceplate PWR indicates power has been applied and the card is initialized and the two signal LEDs indicate a valid signal has been detected on the respective input Dual SD HD SDI Input 108 313101 01 Dual Link DVI Input Card This card accepts a single DVI signal with or without High Bandwidth Digital Content Protection HDCP video signal over a DVI I connector and analog video s
133. g to the network A controller or PC must also be connected to the hub see Figure 2 23 Ethernet Network Setup NOTE A wireless router can be used to communicate to the projectors via 802 11b g 2 22 M Series User Manual 020 100009 04 Rev 1 10 2009 To other Ethernet devices FIGURE 2 23 ETHERNET NETWORK SETUP SETTING THE PROJECTOR S IP ADDRESS SUBNET MASK AND GATEWAY See Section 3 8 Configuration Adjusting System Parameters and Advanced Controls CHANGING THE PORT On some Ethernet networks firewall restrictions may require that the port number of the projector be changed from its default of 3002 If so enter a new port number in the Ethernet Settings menu or include the new port Separating Networks By default communications originating from one type of serial controller RS 232 vs RS 422 vs Ethernet stay on the corresponding network path A Separate setting indicates this separation for Network Routing in the Communications menu see Section 4 Web User Interface If you are using an RS 422 controller for example it will communicate only with the projector to which it is connected unless you change this setting to either RS 232 and RS 422 Joined or All Joined Communicating to all Ports To relay all messages to all ports RS 232 RS 422 and Ethernet set the Network Routing option in the Communications menu for each projector to All Joined see
134. granularity Coarse Adjustment helps identify brightness changes and accelerates projector response time while adjusting settings To disable the Brightness Uniformity function delete the Brightness Uniformity Enable checkmark WHAT IS BRIGHTNESS UNIFORMITY When used to refine screens already matched for their primary colors see 3 12 Using Multiple Projectors Matching Colors in Multiple Screens and overall light output proper adjustment of Brightness Uniformity can create an exceptionally smooth screen in which e No area of the screen appears more red green or blue than another No area of the screen appears brighter than another e Color and light output from one screen closely matches adjacent screens Although the Brightness Uniformity control can be used for a stand alone projector it is particularly useful for setting up and maintaining tiled images that form a cohesive display wall in which the color cast and light output appear uniform throughout each image as well as throughout the entire wall The procedure provided here assumes a multiple screen application IMPORTANT Before You Begin Read through the entire procedure before attempting to adjust Brightness Uniformity controls and keep in mind the following checklist of prerequisites and guidelines O ADJUST COLORS FIRST AIlways adjust the primary colors as described in 3 72 Using Multiple Projectors Matching Colors in Multiple Screens procedure before attempting t
135. h are configurable via RS 232 commands See Figure B 1 GPIO Connector The other two pins are reserved for ground and power see table below for pin identifica tion Table B 1 GPIO Pin FIGURE B 1 GPIO CONNECTOR GPIO PINS SIGNAL Pin 1 12V 200mA Pin 2 GPIO 2 Pin 3 GPIO 4 Pin 4 GPIO 6 Pin 5 Ground Pin 6 GPIO 1 Pin7 GPIO 3 Pin 8 GPIO5 Pin 9 GPIO 7 The serial cable required for connecting the external device to the projector s GPIO connector must be compatible with the external device M Series User Manual 020 100009 04 Rev 1 10 2009 Configuring the GPIO The GPIO connector can be configured to automate any number of events using the serial command code GIO Each Pin is defined as either an input or output depending on the desired outcome Configure the pin as an input if you want the projector to respond to something the device does and as an output if you want the external device to respond to an action taken by the projector For example configure the pin as an output if you want the lighting in a room to automatically dim when the projector is turned on By using the GIO command you can also set the state of each output pin as high or low By default the state of each pin is high The voltage applied to pins in the high state is 3 3V A low state or value of 0 will be read on an input pin if the circuit attached to the pin is open A high state or value of 1 will
136. h reversed 3 2 pull down in 60Hz to 24Hz film to digital conversion in your source Correct at the source 2 Set the projector to run in Free run Open OSD menu and go to Input Switching amp PIP Ensure that running mode is set to Free run not to Frame Lock 3 Display a test pattern on the screen pressing the Test button on the remote keypad The test pattern should be displayed correctly If not contact your dealer for assistance M Series User Manual 6 3 020 100009 04 Rev 1 10 2009 6 7 3 Image Appears Squeezed or Vertically Stretched into Center of Screen 1 Run auto setup pressing Auto button on the remote keypad 2 Check your Resizing selection 6 7 4 The Display is Jittery or Unstable 1 Ifthe display is jittery or blinking erratically ensure that the source is properly connected and of adequate quality for detection With poor quality or improperly connected source the projector will repeatedly attempt to display an image however briefly 2 The horizontal and vertical scan frequency of the input signal may be out of range for the projector Refer to Section 7 Specifications for scan frequency ranges 3 The sync signal may be inadequate Correct the problem at the source 6 7 5 The Display is Faint 1 Brightness and or contrast and or gamma may be set incorrectly 2 The source may be double terminated Ensure the source is terminated only once 3 The source if non video may need a different sync ti
137. han RS 232 for serial communication over distances greater than 50 feet ANAT eqUse the RS 422 port only if your device had RS 422 capability always consult the literature provided with your equipment before connecting 2 20 M Series User Manual 020 100009 04 Rev 1 10 2009 9 pin D style Connector GPIO RS422 IN To computer or device with RS422 capability FIGURE 2 20 CONNECTING RS 422 Ethernet Communications Refer to Section 3 Operation for further information about setting up and using a projector connected via Ethernet and the Serial Command document provided in the Dealer Section of the Christie Website PN 020 100224 XX Connecting Multiple Projectors RS 232 NETWORK To connect multiple projectors in a network with serial communication 1 Connect the controlling source to the RS 232 IN connector of the first projector in the network 2 Using another serial communication cable connect one end to the RS 232 OUT connector and the other end to the RS 232 IN connector of the next projector 3 Continue this pattern of connection with all projectors in the network NOTE The last projector in the network will only have a connection to the RS 232 IN connector see Figure 2 21 RS 232 Network FIGURE 2 21 RS 232 NETWORK M Series User Manual 2 21 020 100009 04 Rev 1 10 2009 CHRISTIE Section 2 Installation and Setup MIXED NETWORK To control multiple projectors with a computer controller having an RS 422
138. hannel is automatically created if you adjust an image from a new source NOTE CHANNEL key behavior during a presentation depends on whether or not the Display Channel List option is enabled in the Menu Preferences menu You can choose to use a scrollable list of channels when you press CHANNEL or you may prefer to enter the desired channel number blind i e without on screen feedback See Menu Preferences ater in this section Slot 1 2 3 4 Press to display the next active input on the card in the slot Input Displays all inputs in all slots both active and inactive Scroll through the list to select an input for the main image Press Input again to show the list and select the picture in picture PIP image PIP Turns PIP ON or OFF Swap Swaps the main and PIP images Contrast Changes the level of peak white in your images Use LEFT RIGHT ARROW KEY until you reach the desired level of contrast for best results start low and increase so that whites remain bright but are not distorted or tinted and that light areas do not become fully white 1 e crushed Conversely low contrast causes dim images Bright Increases or decreases the black level in the image Use LEFT RIGHT ARROW KEY until you reach the desired level of brightness For best results start high and decrease so that dark areas do not become fully black i e crushed Conversely overly high brightness changes black to dark gray caus
139. he LCD and the backlight for the built in keypad should turn on If the LCD is still blank restart the projector 6 4 Remote Keypad 6 4 1 Remote Keypad Does Not Seem to Work l 2 6 2 Replace the batteries Check if IR signals are received by the projector Pressing any key on the remote control towards the front or rear sensor the Status LED will blink regardless if any command is executed If the LED does not blink restart the projector Ensure the remote keypad is enabled If the projector is powered using the built in keypad open the OSD menu and go to the Main Menu gt Configuration gt Communication submenu and check the check boxes for Front IR Enabled and Rear IR Enabled are checked Enable them if they were disabled and try again Projector is busy If the projector is busy in a warm up mode or in a cool down mode the commands from the remote keypad may be ignored Wait until the projector reaches a stable state Power ON or Stand By and try again Press the PROJ key on the remote keypad If this brings up a pop up box on the OSD ensure that the check box is marked to enable the projector Using the XLR connector use the remote as a wired keypad If it does work and all the IR sensors have been enabled then there may be a problem with the IR sensors M Series User Manual 020 100009 04 Rev 1 10 2009 CHRISTIE Section 6 Troubleshooting 6 5 OSD 6 5 1 The OSD Menu does not display 1 Using the L
140. he desired external signal 9 Ifnecessary adjust the mechanical alignment to maintain perfect pixel on pixel alignment over time In applications where you are projecting only white or light images the Blend Width may be slightly higher set according to how much overlap you have between images Use the following as a guide examples show overlapping width only values for overlapping height will differ NOTE Recommended overlap is 12 5 25 M Series User Manual 3 45 020 100009 04 Rev 1 10 2009 Section 3 Operation 3 46 CHRISTIE COLOR ADJUSTMENTS BY X Y Enter known x y coordinates from the chromaticity graph NOTES 1 For defining or changing a User 1 2 3 or 4 color i i i gt gt 1 Max Drives performance or gamut Sometimes known as Comprehen Predefined 2 Color Temperature Slidebar sive Color Adjustment 2 Factory defined primary color 3 SD Video levels which ensure a specific color performance from L gt 4 HD Video projector to projector can be calibrated in the Service menu 5 User1 only The factory settings can be recovered with selection of A djustable 6 User 2 Reset to Factory Defaults in the Color Primary Settings 7 User 3 submenu accessed via the Service menu password 8 User 4 protected From the factory the projector can utilize any of the three pre defined color performance settings identified at right default Max
141. he projector is changing its state from powered down to standby The message Standby Mode appears in the display when the projector has completed its initialization and is ready for power up The 2 lamp status LEDs will go off to indicate that the lamps are off The Power status LED will show amber indicating that the projector is in standby mode The shutter LED will display amber indicating the shutter is closed Press and hold the power button on the keypad or remote for 2 seconds or press twice quickly The lamps will power on and the fans will come on NOTE See Section 3 Operation for a full description of the status indicators NOTE The default settings for the projector are to perform a lens calibration after the insertion of a new lens If this is the first time the projector has been powered up with the lens expect a short period about 15 seconds where the lens will move slightly STEP 6 Selecting a Source Press one of the input keys on the remote or built in keypad to select and display the image for the source you connected in Step 3 STEP 7 Adjusting Image Adjust the image settings such as Brightness Contrast Gamma Focus Zoom etc using the direct keys on the remote or built in keypad NOTE Refer to Section 3 Operation for more details Detailed Setup and Installation yey N eldi Always power down the projector and disconnect all power sources before servicing or cleaning PANAON Refer to Safety Warnings
142. he risk of degrading delicate coatings and surfaces Only clean optics when dust dirt oil fingerprints or other marks are obvious and are causing performance problems Maintenance of optical components requires a qualified service technician Inspect exposed optical surfaces periodically in a clean dust free environment using a flashlight Never touch an optical surface with your bare hands Always wear latex lab gloves M Series User Manual 5 3 020 100009 04 Rev 1 10 2009 Section 5 Maintenance 5 3 2 5 4 5 4 CHRISTIE Supplies or Cleaning Optical Surfaces Soft camel hair brush e Dust free blower filtered dry nitrogen blown through an anti static nozzle e Dust free lens tissue such as Melles Griot Kodak tissues 18LAB020 Optowipes 18LAB022 Kim Wipes or equivalent e For lens only Lens cleaning solution such as Melles Griot Optics Cleaning Fluid 18LAB011 or equiva lent e Cotton swabs with wooden stems only e Lens cleaning cloth microfibre such as Melles Griot 18LAB024 or equivalent Cleaning the Lens Check periodically A small amount of dust or dirt on the lens has minimal effect on image quality To avoid the risk of scratching the lens clean only if absolutely necessary Dust 1 Brush most of the dust from the lens with a camel hair brush and or blow dust away with a dust free blower 2 Fold a microfibre cloth smooth and gently wipe remaining dust particles from the lens Wipe evenly with t
143. he smooth portion of the cloth that has no folds or creases Do not apply pressure with your fingers use the tension in the folded cloth itself to collect dust 3 Ifsignificant dust is still bound to the surface dampen a clean microfibre cloth with coated optics cleaning solution damp not dripping Wipe gently until clean Fingerprints smudges or oil 1 Brush away most of the dust with a camel hair brush and or blow away using a dust free blower 2 Rolla lens tissue around a swab and soak it in coated optics cleaning solution Tissue should be damp but not dripping 3 Gently wipe the surface using a figure 8 motion Repeat this motion until the blemish is removed Replacing the Lamps A DANGER LAMPS MAY EXPLODE POSSIBLE BODILY HARM OR DEATH The lamps are under pressure and may explode causing physical injury and or property damage Allow the lamps to cool before handling or unplugging the projector Lamp replacement to be done by qualified service personnel consult User Manual or lamp kit for instructions 1 To turn off the lamps Turn off the lamps using the remote keypad or the built in keypad with the lamp OFF command see Step 5 or by opening the lamp door NOTE The lamps will turn off automatically when the lamp door is open M Series User Manual 020 100009 04 Rev 1 10 2009 2 To open the lamp door Remove Screw Using a Phillips screwdriver turn the captive screw on the lamp door counter clockwis
144. his document is accurate and reliable However due to constant research the information in this document is subject to change without notice Christie Digital Systems assumes no responsibility for omissions or inaccuracies Updates to this document are published regularly as required Please contact Christie Digital Systems for availability 1 1 Labels and Marking Observe and follow any warnings and instructions marked on the projector yey NA eai Indicates a hazardous situation which if not avoided will result in death or serious injury This signal word is to be limited to the most extreme situations An ONN Indicates a hazardous situation which if not avoided could result in death or serious injury Wee Uel indicates a hazardous situation which if not avoided could result in minor or moderate injury It may also be used without the safety alert symbol as an altermative to NOTICE M Series User Manual 1 1 020 100009 04 Rev 1 10 2009 1 1 1 Typographical Notations 1 2 1 2 The following notations are used throughout this manual e Keypad commands and PC keystrokes appear in bold small caps such as POWER INPUT ENTER etc e References to specific areas within the current document appear italicized and underlined When viewed online the text appears in blue indicating a direct link to that section For example Section 2 Installation and Setup e References to other documents appear italicized and blue Wh
145. icceushcdecimebasaciauamasohancs 7 8 7 4 Input Source Signal Compatibility s esssenseeseneseessesessseessessssseessessrssresseesersresseeseesensseeseseesseesse 7 8 TAA Analog Only WB xs cevsesutadenneteacecnsesvscasnessacenunsdeassagseacdnanardtonedndseasuavaeeusacvendoeamiratennageaisnun 7 8 Deke Twin HDMI puterine nena E E ante meaner 7 8 7 4 3 Dual Link DVI Input nsn eee ee 7 8 TAA Video Decoder Ipputzuu u sun aun a na E EER E EE EAE ERE EEE 7 9 TAD D al SDYBD SDIL L uuu asas asusaas aspayaaywasQakuqagaqduascansaaaasacqhhawaasupataykaqisqahaqqa 7 9 Teo Control Signal Compatibility uuu ua ul ieni aaeei ae E EE EE EN EEEE ERE 7 9 75 1 Projector Controls siiis ir a e EARE NEE EE A E i 7 9 13 2 CONTOR ECCEIVET rosessi reisais nesr Q ahua isa hasan qsqa aa TEENE EEEa OEE 7 9 KLI RS I a A E A E A assia a aspas 7 9 TIA RS 422720e u annaba AET CREE AE EE AE E EA SA 7 10 Teor EMMGIICE sgsceiciadssarmencntondniencninnseaaiad ae shana Riemann Ran E E EEE E Ra EEEE 7 10 TOO USB 210 DEVICE POL uuu ua as saawass akawa akaptaqqatayaqaahaswasyaakkuska qasykacsaqayaqiska quas qayaqa q sasaqa 7 10 ZS OPIO us sunan a n u un a e a ce Pere aus asa mun tuan G 7 10 7 5 8 Built In Keypad and Display n nn usnssnasaas a 7 10 7 5 9 AMX Crestron Suppott n nsn annss 7 10 7 6 Power Reg irementS pccsscssaccansiatessnaiancconsinnccnrabasdesub
146. ignals over the DVI I or 15 pin VGA connector The module can simultaneously support a digital signal on the DVI input and an analog signal on the VGA port however it does not support 2 analog signals at the same time There are 4 LEDs on the module faceplate PWR indicates power is applied and the card is initialized and the other 3 on the right side of the corresponding connectors indicate that a valid signal has been detected Dual Link DVI Input 108 312101 01 Analog SmO EE O feo e O Signal 1 Dual Link DVI I Digital 2 VGA 9 M Series User Manual 2 27 020 100009 04 Rev 1 10 2009 Section 2 Installation and Setup CHKISTIE Video Decoder Input Card This card accepts and decodes standard definition SD video This includes CVBS composite video S Video and component sources This card supports as many as 6 video signals four of them on BNC connectors and two on 4 pin mini DIN connectors Each mini DIN connector accepts 1 S Video signal The first BNC accepts composite video only while the remaining three BNC s can be grouped to allow one of the following combinations e 3 CVBS sources on 4 5 amp 6 e 1 CVBS source 1 S Video source Luma Y connected to 4 Sy and Chroma C connected to 6 Sc 1 YPbPr source component signal on 4 Pr 5 Y amp 6 Pb The video decoder input card has 8 LED indicators The PWR LED indicates that the module is installed properly and has been successfully configured The Y
147. ilation Vents and louvers in the projector covers provide ventilation both for intake and exhaust Never block or cover these openings Do not install the projector near a radiator or heat register or within an enclosure To ensure adequate airflow around the projector with a minimum clearance of 25cm 10 on the left right and rear sides of the projector from any walls or other obstructions NOTE Do not obstruct the air exchange to the projector Optional Filters WAG Use only special high efficiency Christie approved filters we This projector is not equipped with fan finger guards Keep fingers away from the fan blades when replacing filter Dust Air Filter CHECK Monthly Check projector air dust filters at minimum every month Dust air filters if fitted should be replaced whenever the lamp is replaced or between 200 500 hours depending on use A clogged air filter reduces air flow and can lead to overheating and failure of the projector Check monthly by inspecting its color through the side vent grille with a flashlight Replace grey colored filters Leave the filters in their sealed packaging until ready for use M Series User Manual 020 100009 04 Rev 1 10 2009 5 3 5 3 1 Replace Filters 1 Unscrew the 2 captive screws at the top of each filter door Figure 5 1 Allow the door to rest down and away from the projector Remove Screws 2 Slide the air filter out and replace vacuum or wash th
148. ilt in keypad has a LCD status display window which displays all states of the keypad controls The LCD displays status information when the projector is powering up Warm up Lamp is warming up and when the projector is cooling down Cool down Lamp is cooling down The display shows the state of the keys menu structure and menu items Overview of LED and Key States The LED color of the keys indicates that the key is in one of these states e Amber a functionality is available that will affect the displayed image of the projector Blue a functionality is available that is relevant to the built in LCD only and will not affect the displayed image from the projector Off the key is disabled in the current context e Power Key used to switch from Standby mode to ON and from ON to Standby mode LED always remains Amber M Series User Manual 3 3 020 100009 04 Rev 1 10 2009 Section 3 Operation 3 1 1 3 4 CHRISTIE Help Key only available in the On Screen Display OSD context LED is Amber when the menu is being displayed on the projected image display when no menu is being displayed the Help key is still enabled if the OSD is enabled It is only disabled when the entire OSD is set to OFF Auto Key enabled state when the power is ON and there are no test patterns on the screen If the power is OFF or a test pattern displays the Auto key is disabled Exit Key is determined in the specific context of the sc
149. imary 11 Color Enable White v oor atatime FIGURE 3 29 ADJUSTING INPUT LEVELS USING THE PEAK DETECTOR RED EXAMPLE SHOWN e COLOR ENABLE Select which color or colors you want to see in the display useful while working with color temperature white levels or input levels NOTES 1 Input levels apply for the current source only but for any color temperature used 2 If color temperature is set up based on the internal test patterns you can set up input levels for a given source so that it matches the color temperature of the internal test patterns Advanced Image Settings Submenu Use the Advanced Image Settings submenu to make the adjustments necessary for lesser used but more specialized applications on your projector GAMMA SETTINGS The system offers two types of gamma correction Gamma correction can be applied to a specific source to correct for luma encoding This is a channel setting and reapplied every time the same signal is detected This is the Gamma control On the other hand the system also provides a global Gamma Correction control The global control offers an offset applied to all channels This offset is used to compensate for changes in ambient conditions such as ambient light in the room and projected material e GAMMA CORRECTION Applies a global offset to all gamma settings for each channel It affects the shape of the curve by performing a linear transform toward a gamma curve of 1 0 while the control i
150. ing washed out images M Series User Manual 3 5 020 100009 04 Rev 1 10 2009 Section 3 Operation 3 6 CHRISTIE Gamma Determines how gray shades are displayed between minimum input black and maximum input white for a given amount of signal The proper setting helps maintain optimized blacks and whites while ensuring a smooth transition for the in between values utilized in grays Unlike brightness and contrast controls the overall tone of an image can be lightened or darkened without changing the two extremes and your images will be more vibrant yet with good detail in dark areas when using the Gamma control The nominal setting for Gamma Correction of 0 is correct for most signals and conditions If excess ambient light washes out the image and it becomes difficult or impossible to see details in dark areas increase the gamma correction setting to compensate NOTE The range for this control has changed After an upgrade from version 1 2 or earlier to version 1 3 or later the setting for Gamma Correction must be set again Number Keys Press to 9 to enter a value in a text box or to select a menu item 10 Press 0 before pressing another number to enter a number greater than 9 e g press 0 then 2 to enter the number 12 as a menu selection NOTE When entering numbers in a text field this button acts as 0 Help Press HELP to display context sensitive help Press HELP again to toggle the help window OFF Menu
151. iniis orinis siaaa en eN EE EEEE EAER EA EA EAEE EE eE EEE EEEE 6 5 6 8 1 After upgrading the projector software the Web pages do not display correctly 6 5 6 8 2 A backup file cannot be saved nsn 6 5 7 Specifications 7 1 Image Performante renses eea AR A EE EEEE EEE E ER R 7 1 Foi Lee Pix l Format uuu aayqa ananassa hb awas REN 7 1 7 1 2 Brightness ANSI Lumens s ssnssesessssessesssssressessrssresstesessessteseestssensstestestesseesseserssessesee 7 1 Jl CONTAS er e E a asp ae 7 2 FAA VATA CS UQIHO rBWNtiy uu nu unladncienacua E E A iwa A ERNE quihua qaspas 7 2 TAD Color Uniformiby ss sc aadessedevecesadicasesebsacencsknemsansanncasoonvndcvadesauassshietasenaseceapiantanancnneinsaeaaocantes 7 2 7 16 Color PANNA ES vancdsacosseacetunnccuanssnussasunedensayucsubaapnedsanoiausnsstineseswoynlaieavmedunsiedeyeienheteatiioncenitoes 7 2 L U Me MME choc cece ea ieee ees ee be tun E tae nvm deme tivo ase Gm Gee 7 2 7 1 8 Grayscale Color RESGlUUOMy crisis cnuesevanccuulecsiecsdarvatvtnnedraeeancunieneaaluenianemaenieiames 7 2 1 1 9 Color Pemperalureus uu a u uu acwnne teases es aerer aigcostaieaeosenees uscantevenanteseoeuareacmnanecacies 7 3 FLAG Converge sirieias rane a E EE E EAE ESEA E EITAS 7 3 Te Mall 1 TALS TING h s uu esere inae iE ERE E E TEE EEA atop ase EG EE aqu as 7 4 T 1 12 Pixel Deft tS ncnian nerne uqa E EAE E EEE A T Eai 7 4 T113 Image ArtifaglS u u u u n E A E E R
152. isconnect from AC Then plug in again and power up as usual 6 7 12 Colors in the Display are Inaccurate The color tint color space and or color temperature settings may require adjustment at your input source Try Auto Setup Ensure signal connections are correct Bo OON Ensure the proper channel for this source is being used 6 7 13 Display is Not Rectangular 1 Check leveling of the projector Ensure the lens surface and screen are parallel to one another 2 Is the vertical offset correct Make the necessary adjustments to the vertical offset on the lens mount 6 7 14 Display is Noisy 1 Display adjustment at the input source may be required Adjust pixel tracking phase and filter Noise is particularly common on YPbPr signals from a DVD player 2 Ensure the video input is terminated 75 ohms If it is the last connection in a loop through chain the video input should be terminated at the last source input only The input signal and or signal cables carrying the input signal may be of poor quality 4 Ifthe distance between the input source device and the projector is greater than 25 feet signal amplifica tion conditioning may be required 5 Ifthe source is a VCR or off air broadcast detail may be set too high 6 8 Web Interface 6 8 1 After upgrading the projector software the Web pages do not display correctly 1 After upgrading the temporary internet files and cookies must be cleared from the Web Inte
153. ixels of display below lens center FIGURE 2 9 VERTICAL OFFSET EXAMPLES M Series User Manual 2 13 020 100009 04 Rev 1 10 2009 Section 2 Installation and Setup Examples of Horizontal Offset SXGA pixels represented 700 pixels 700 pixels display to left display to right of lens center of lens center I I ee N As 0 Otfset TMASIARD 1 In this example no offset is applied therefore half of the image appears to the left or lens center and half appears to the right CHAISTIE Where Shaded area projected image Area within solid line projected image area with no offset applied 350 pixels to 1050 pixels displayed left of lens to right of lens center center or 350 pixels of shift to right of lens center L n 50 Otfset FLSVALD 2 In this example 50 offset is applied therefore 3 4 or 75 of the image appears to the one side of the lens center FIGURE 2 10 HORIZONTAL OFFSET EXAMPLES 2 14 M Series User Manual 020 100009 04 Rev 1 10 2009 2 2 4 2 2 5 Mounting There are several methods for mounting the projector In typical front and rear screen installations the projector can be mounted to a secure and level surface such as a table or cart Carts are useful when the projector has to be moved often Lock the wheels on a cart when it is in position to prevent accidental movement during a presentation Ceiling Mount
154. k of the projector the LEDs represent from left to right Lamp 1 Lamp 2 Power and Status The LEDs will display the colors as sho wn below Projector State LEDs LED State Hard Boot All All LEDs amber means please wait Standby Mode Lamp amp 2 Off lamps are off Power Amber AC is present but projector is off or standby Green shutter is open Shutter Amber shutter is closed Warm up Powering ON from standby All LEDs cycle green from left to right Normal Operation Lamp 1 amp 2 Amber lamp time has expired and lamp should be replaced Power Green projector is powered up and operating normally Green shutter is open Shutter Amber shutter is closed Cool down All LEDs cycle amber from left to right Error Amber lamp time has expired and lamp should be Lamp amp 2 replaced Flashing Red lamp has malfunctioned Power Flashing Red error has occurred Details are displayed on the status display Projector State LEDs LED State Software Upgrade in progress All The pattern will alternate between Amber Off Amber Off and Off Amber Off Amber Lamp Regeneration in progress Lamp amp 2 Flashing Green the lamp is being switched off for its regeneration period to extend lamp life typically 15 min utes every 24 hours Power Green on or Amber standby Shutter Green shutter is open NOTE A condition occurs on the first power on after
155. kable without removing covers 10 sec nominal depends on lens type 5 sec nominal depends on lens type Manual over ride permissible for zoom and focus Reverse Telecentric Internal focus Motorized zoom and focus with position feedback NOTE Calculated Throw distance values are subject to a 5 lens tolerance Lens Throw Ratio Throw Ratio Lens Description Part Number WXGA SXGA HD WUXGA Fixed Lens ILS 0 73 1SX 0 67 1HD 118 100110 xx 0 75 0 73 0 67 0 67 Lens ILS 1 2SX 1 1HD 118 100117 xx 1 23 12 1 1 1 1 Lens ILS 1 25 1 6SX 1 16 1 49HD 118 100111 xx 1 28 1 64 1 25 1 6 1 16 1 49 1 16 1 49 Lens ILS 1 5 2 0SX 1 4 1 8HD 118 100112 xx 1 54 2 05 1 5 2 0 1 4 1 8 1 4 1 8 Zoom Lens ILS 2 0 2 8SX 1 8 2 6HD 118 100113 xx 2 05 2 87 2 0 2 8 1 8 2 6 1 8 2 6 Lens ILS 2 8 4 5SX 2 6 4 1HD 118 100114 xx 2 87 4 61 2 8 4 5 2 6 4 1 2 6 4 1 Lens ILS 4 5 7 5SX 4 1 6 9HD 118 100115 xx 4 61 7 69 4 5 7 5 4 1 6 9 4 1 6 9 Lens ILS 7 5 11 2SX 6 9 10 4HD 118 100116 xx 7 69 11 48 7 5 11 2 6 9 10 4 6 9 10 4 M Series User Manual 7 5 020 100009 04 Rev 1 10 2009 Section 7 Specifications 7 2 6 Dynamic Iris Motorized iris with position feedback Max frequency open close open Sound level 7 2 7 Automatic Fans Temperature sensitive fan speed control Standby Temperature range for variable fan speed Transition steps 7 2 8 Automatic Color Filtering Motorized y
156. kly 10 25 52 e Monthly Projector Date and Time 2009 09 15 10 31 49 Description o Command String GPIO Output Helper Help Serial Representation RTE T 2009 09 15 10 25 52 S EBED FIGURE 4 14 SCHEDULED EVENT WINDOW 3 Select the frequency option for the event by selecting either Once Daily Weekly or Monthly NOTE End Date is enabled when Daily Weekly or Monthly repeat options are selected 4 Click within the Start Time field to open a calendar pop up window Navigate to and choose a desired date The selected date will populate the Start Time field In the field below the Start Time field enter a start time in the format hr min sec The default is the current time 7 Click Sync to set the computer and projector time to be the same otherwise the event will run based on the projector time NOTE Synching the projector time to be that of your system time Enter a description of the scheduled event in the Description field NOTE Maximum of 100 characters 9 Enter a serial command or a sequence of serial commands with which you wish the projector to perform in the Command String box Ifa GPIO command string is needed click the GPIO Output Helper button for instructions on how to create the command structure NOTES 1 The Output field contains 7 blocks which refer to the 7 I O pins on the GPIO connector Pin 1 12V and Pin 5 Ground These are not included 2 Clicking a block toggle
157. l 01 Enter amok chantal hidden the first channel in the list is 01 1 2 iSVid 15 73kHz 159 94 HZ Move nightighted and highlighted 2 Channels created 02 4 1 pDig 33 72kHz p29 07 Hz press q automatically do not appear in the channel a A E or a a A RE list unless a parameter for the channel has Sit OPO Frequency Frequency been changed Input p Progressive FIGURE 3 12 USING A CHANNEL M Series User Manual 3 13 020 100009 04 Rev 1 10 2009 3 4 3 14 Channel Setup Menu All available channels are listed in the Channel Setup menu which describes how each channel can be accessed and provides access for editing copying and deleting channels Press MENU from the presentation level to display the Main menu To display the Channel Setup menu press 3 or move the highlight to the Channel Setup option and press ENTER The Channel Setup menu will appear see sample below Channel Setup Appears in Chan list 01 E A 1 2 iSVid 15 73kHz i59 94 Hz A Auto source 02 EA 4 1 pDig 33 72kHz p29 07 Hz Locked A A A A A 1 Slot Input Signal Horizontal Vertical Type Frequency Frequency Channel Setup Icons i Interlaced p Progressive An unlocked auto source that appears in the channel list A locked auto source that appears in the channel list FIGURE 3 13 CHANNEL SETUP MENU The channel setup icons list all defined channels The far left column lists channel numbers defined The values in the far right
158. le and 1 output female If there is active communications on the DMX512 Interface card the power LED will blink between low intensity and high intensity Refer to Section 2 3 Connecting Sources for more details STEP 4 Connecting the Line Cord IMPORTANT Use the line cord provided with the projector or ensure you are using a line cord power plug and socket that meet the appropriate rating standards NOTE Voltage and current requirements are listed on the license label located at the back of the projector Connect the projector s line cord to the AC receptacle at the AC inlet of the projector then push the wire clip over the plug to retain it This prevents the line cord from inadvertent disconnection Plug the 3 pronged plug end into a suitably rated grounded AC receptacle Switch the projector ON The switch is located just above the AC receptacle M Series User Manual 2 3 020 100009 04 Rev 1 10 2009 Section 2 Installation and Setup CHKISTIE 2 2 2 4 NAANA Do not attempt operation if the AC supply and cord is not within the specified ratings On power down wait 5 10 minutes for the fans to turn OFF before unplugging the projector Always switch off the projector before unplugging the AC line cord STEP 5 Power up After the AC Power has been switched on the LCD display above the keypad indicates Please wait and the 4 LED status indicators on the top cover window switch on to amber These indicate that t
159. lors NOTE A Color Saturation adjustment defines the corresponding x y coordinates shown in the Color Adjustment by X Y submenu These x y coordinates will remain stable for this User gamut until they are changed again via either menu Values displayed in the Color Saturation menu will fluctuate as you use the projector and will be different when you return to this menu in the future These floating changes do not affect the x y coordinates or gamut BLACK LEVEL BLENDING Eliminates the differences between black levels when edge blending multiple projectors The Black Level Blending submenu provides many controls to allow the edges of adjacent images to be smoothly overlapped creating a seamless image Edge blending smooths white levels and if edge blending is not in use Black Level Blending is disabled NOTES 1 Adjust white levels before adjusting black levels 2 Blinders are recommended for fixed installations Similar to Edge Blending Black Level Blending allows you to adjust the black level intensity of multiple adjacent projected images to create one large seamless display Edge blending must be enabled in order to use the Black Level Blending features M Series User Manual 3 47 020 100009 04 Rev 1 10 2009 Section 3 Operation 3 48 CHRISTIE The use of Black Level Blending feature and the use of Christie Twist module are mutually exclusive If Christie Twist is installed and Black Level Blending is desired 1
160. lors under the current environmental conditions This essentially calibrates a projector to its surroundings compensating for factors such as screen type lamp and or ambient lighting and will improve color accuracy and consistency in a group of projectors It ensures a good starting point for further customizing and matching however is not critical for all installations To access the Service menu password protected return to the factory set color primaries Select the Reset to Factory Defaults option in the Color Primaries submenu Then repeat the calibration process describe above and continue with matching of colors Color Adjustment Procedure Once the Color Primary Settings are calibrated for the site see above use the Color Adjustments by X Y or Color Saturation menu to further refine each projector s fundamental colors so that the hue and intensity of each color appears the same from one display to another Once matched you will have created a single new shared range of colors or color gamut that all of your projectors can produce This palette named User 1 2 3 or 4 can be applied or disabled for a source at any time throughout a bank of adjacent displays simplifying both the setup and maintenance of a seamless wall 1 Set up and optimize all projector settings You can ignore color temperature since you will be redefining color performance in this procedure but do optimize each projector in every other as
161. lqeu3 10 09 ony ZL plous uu1 J0 99 9q 9497 4 10 99 q 18497 Ndu OL seud I XId JOSHO 9SEUd 1 X d PPO UlES X d PPO eng UlES I XId PPO U93919 uleg I 9XId PPO P Y SHO I xId PPO nlgq I SHO l X d PPO U93919 I SHO 1 X d PPO P t Bulpunolg 1oljo uuoo pies Jndul Ng Boleuy QN c r LO O lt OD Buipunoio 9 1o o uuoo Buipunoio G 1oljo uuoo Buipunoio p 1o o uuoo Buipunoio 1oljo uuoo Buipunoio z 1ol o uuoo Buipunoio 1o o uuoo polN syndu p dnou9 GN c r tO OM pae Jndul i3po5 dq o p A poN JUT end L p129 Jndul 14a 3ur1 eng PON Ju enq L pues ndul IqS qH Ienga woJ4 do9 uolss iduioO 1IUAA p ds sol o p ds u do iAnisu s s6un s sui Siuueu q poN UO ISOd sui p jqeuq si 3iuueu dq GN c r LO ON OD ul p 6BniId spiue2o yoyew zey s d YUM pail q IIIA NU W pieO yndu ONS Boreuy y pieO ynduy INAH UML pieO 1ndul IqS qH Iena Z pieo 1ndul 19p099q o piA h sBun s pie5 uodo nu ui s 1 9 u 0 pomssed zIA19S au s iinb z w wayed 1s 1_ ul6Bu3 yy6rq plous uu 1ol5 1 dq 19497 40 99 9q I A811ndinO Z Jopajeq 428d IndinO L sonsoubeig p avueapy lt ssalppy OVI sonsoubeiq paouenpy ZL dn s ony Suung ebew z 1
162. ls For some types of video you can override the setting The control is disabled for other types of video and all graphics sources Generally if black appears crushed when brightness 50 choose 0 IRE If black appears excessively elevated use 7 5 IRE COLOR This slide bar adjusts the color saturation level Lower settings produce less saturated colors for example a setting of 0 produces a black and white image If the color level is too high colors will be overpowering and unrealistic TINT Adjusts the red green color hue for true color reproduction of video and HDTV signals For best results adjust tint while displaying an external test pattern it is recommended that tint remain at its default setting FILTER If grays are black select _1 0 IRE If blacks are gray select 2 7 5 IRE The proper filter setting is automatically set for virtually all signals and rarely needs to be changed Override only if standard pixel tracking and phase adjustments do not adequately clear up a noisy video signal or if a graphics signal appears overly soft Both instances indicate that Filter may be set to the wrong option 3 24 M Series User Manual 020 100009 04 Rev 1 10 2009 CHRISTIE Section 3 Operation e SAMPLING MODE Sets the color sampling mode for a digital signal to either YCbCr 4 4 4 RGB or YCbCr 4 2 2 The proper sampling mode is determined automatically by the projec
163. lt the projector can automatically locate this channel when an incoming input signal matches If not checked the projector can locate the selected channel only when it is directly selected via CHANNEL on the keypad and a change in input signal will not result in a channel change M Series User Manual 020 100009 04 Rev 1 10 2009 CHAISTIE Section 3 Operation 3 5 LOCKED If checked all of the image settings for this channel are locked If unchecked default all available image settings can be adjusted as desired You cannot use Auto Setup with a locked channel e PREVIOUS CHANNEL Select this option to see or change Channel Edit settings for the previous channel in the Channel Setup list e NEXT CHANNEL Select this option to see or change Channel Edit settings for the next channel in the Channel Setup list Adjusting the Image The most commonly used options for image adjustments are accessed through two menus Size and Position MENU 1 and Image Settings MENU 2 both of which appear in the Main menu From either of these two menus You can change settings affecting the image from the current channel by working with the appropriate slide bars check boxes and pull down lists EXIT will return to the previous menu or to the presentation if from the Main menu and accept any changes you may have entered Settings are saved with the current channel From your presentation you can access any of the individual options in these
164. m that source A new channel can be created automatically or it can be copied from an existing channel and then edited as necessary refer to Copy A Channel and Delete a Channel When you select a direct input SLOT 1 SLOT 2 SLOT 3 or SLOT 4 any existing channels in the projector are searched for matching input and signal parameters this only occurs if Auto Source is enabled on these channels If no match to the incoming input signal is found in currently defined channels a new channel is temporarily created based on factory defined defaults for this type of signal The channel number assigned is the lowest available number from 01 99 NOTES 1 An automatic channel will be discarded unless one or more of its parameters are changed and will not appear in the channel list see below 2 If 2 channels have the same distinguishing source characteristics except for the reversal of sync connectors i e H sync and V sync are switched they are still defined as distinct channels 3 You cannot define a new channel without an incoming signal USING A CHANNEL You can normally select a channel at any time by pressing CHANNEL see below If you want to hide a channel from appearing in this list you must edit the channel refer to Channel Edit Such a channel can still be selected by entering its number as shown below Current Channel NOTES 1 The current channel is highlighted Y in the channel list or if the current channel is Main Channe
165. mes M Series User Manual 3 31 020 100009 04 Rev 1 10 2009 Section 3 Operation 3 8 3 32 CHRISTIE e CLOSE SPEED The close speed of the iris represents the maximum iris change per frame Increasing this value will allow the iris to travel further in a frame Decreasing this value will allow for a more gradual change A slower value will reduce any flicker in the image but it will also mean that the iris will not react quickly to a scene that suddenly becomes much darker resulting in an image that does not have as much contrast as it could for several frames WHITE COMPRESSION The level of white compression adjusts amount of detail in bright parts of dark scenes It does not eliminate the detail in affected areas as the sensitivity control does but merely reduces it The amount of detail reduction depends on the average level of brightness in the scene and the setting of this control The brighter the scene the less impact this control will have It is often best to adjust the sensitivity and white compression together to find the optimal settings e COPY FROM This control allows you to copy the Dynamic Iris Settings from an existing profile to the current profile Configuration Adjusting System Parameters and Advanced Controls Use the Configuration menu to define general operating Contiguration parameters and communications with other projectors and 4 Language English equipment and to access other adva
166. mp has malfunctioned Power Off AC power is off Yellow AC is present but projector is in standby Green Projector is powered up and operating normally Flashing green yellow Projector communication in progress Flashing red Error has occurred Details are displayed on the status display Shutter Green shutter is open Yellow shutter is closed 7 2 13 Electronics SW FEATURE Video Format Re Sizing Picture in Picture Seamless Switching Built in 2D keystone and geometry correction Auto scaling Auto de interlacing Edge blending Warping Tiling support for up to 3x3 arrays Blanking and Image positioning Brightness contrast color and uniformity user settable control Image orientation Electronics HW access Number of option cards Number of processor cards Number of option slots Native format adjustment Arbitrary Gamma M Series User Manual 020 100009 04 Rev 1 10 2009 COMMENTS All video formats can be resized to fill screen either horizontally or vertically while maintaining aspect ratio Black level edge blending not available on WX models Can display image front rear normal inverted ceiling All accessible electronics are mounted from the back of the projector 6 user inter changeable hot swappable 2 user inter changeable 4 located at back of projector for option cards 1 located at back of projector for processor card Optional global aspect ratio setting can b
167. mperature Allows you to specify a color temperature between 3200 and 9300 based on the setting of the color temperature slidebar Expressed in degrees Kelvin 3200K 5400K etc Lower numbers appear reddish white and higher numbers appear bluish Standard settings are O 9300K is close to the white of many computer monitors 6500K is the standard for color video in both standard and high definition forms o O 5400K is a standard for graphics and black and white video g 3200K is useful if the projected image is to be filmed or shot as part of a studio set illuminated with incandescent lights For all color temperatures the color primaries red green and blue are unchanged and reflect the native colors of the projector SD Video and HD Video Sets the output color to a specific standard value Adjusts the colors red green blue and white User Select 1 of 4 user defined sets of color adjustments defined in the Configuration menu 3 30 M Series User Manual 020 100009 04 Rev 1 10 2009 DYNAMIC IRIS The Dynamic Iris adjusts the aperture to allow more or less light through This will allow for deeper blacks in dark scenes e ENABLED Enable either Manual or Per Channel operation of the Dynamic Iris If set to Manual set the Iris Position control to set the iris to a fixed position as a percentage of fully open If set to Off the position of the iris will be fixed at fully open If set to Per Channel the iris
168. n the image 0 100 For best results keep close to 50 Start with a high value and decrease so that dark areas do not become black Conversely high brightness changes black to dark gray causing washed out images YELLOW NOTCH FILTER YNF YNF is a channel based control with an additional global control It works on a last request gets served basis i e Enable YNF in the global control YNF will be enabled Thereafter switch to a channel which does not use YNF the YNF filter will be removed or disabled Then change the global control the YNF filter will do whatever is requested last request is honored COLOR SPACE Determines how the color components of an analog input signal are decoded for accurate color in the display Useful only for analog signals and certain digital sources Although color space for these analog signals is automatically determined by the projector You may wish to override this and manually set a specific color space NOTE For some signals the color space function is entirely automatic and the pull down list is disabled The current color space appears in the Image Settings menu Press ENTER to select a different option Select RGB unless you are using component video Select YPbPr Video with a standard definition televised signal SDTV Select YPbPr HDTV with a high definition televised signal HDTV NOTE When certain RGB signals are first connected the projector may not recognize them as
169. n which edge of the projector you are working with has been edge blended The blend width can be adjusted to line up properly but by default it corresponds to the edge blending setting determined for that edge 6 The brightness and black hues of the blended region can be adjusted in more detail in case fine tuning is needed may be only necessary for blending a 2 x 2 projector display because of blending differs for the sides and center NOTES 1 The menu options vary depending on the edge blending parameters 2 You may need to re adjust the black level hues following the overlap adjustments on each blended edge 3 When adjusting six or more projectors you need to ensure that the hue and brightness of each target area is matched at closely as possible Default Color Adjustments amp Default Color Adjustment with YNF Select the default values for the color adjustment without the Yellow Notch Filter The value selected is the default to be used by the system during auto setup or initial detection of a new source Refer to 3 8 Configura tion Adjusting System Parameters and Advanced Controls gt Geometry amp Color Submenu Color Adjustments by X Y for description M Series User Manual 020 100009 04 Rev 1 10 2009 CHAISTIE Section 3 Operation TILING Image tiling allows a single input image to be displayed spread over multiple screens with each screen displaying a fraction of the image The image is displayed by the mxn array of
170. nced processing and 2 Output Options z image adjustments affecting overall performance The 3 Lens Settings lt 4 Power Management gt Configuration menu provides access to diagnostics 5 Date amp Time Rs calibration tools and the Service submenu password 6 Menu Proferances gt protected 7 Communications gt f 8 Geometry amp Color gt The first six options in the Configuration menu are explained o Diagnosis amp Calibration N below 10 Service gt 11 Option Card Settings gt LANGUAGE 12 Dynamic Iris gt Choose the available language to use in the projector s menus FIGURE 3 31 CONFIGURATION MENU The change will take effect immediately Output Options Submenu SCREEN IMAGE ORIENTATION Select the on screen image orientation from Front Rear Front Inverted and Rear Inverted OUTPUT RESOLUTION Sets the output pixel resolution default is the native resolution of the projector FRAME LOCKING Select how the projector controls the output frame timing based on the input signal When set to Framelock output image frames are locked to the input if possible When Locked the output is always locked to the primary input never the PIP image Free Run sets the output to close to 60Hz for all sources NOTE When switching to a new input with framelocking enabled the image will appear black for a short duration while the system locks onto the new input M Series User Manual 020 100009 04 Rev 1 10
171. nceua e E E EE C 1 CIl Control Trigger RUES airneisi eE qaqaia Saya qaa pasas EER C 1 C 1 2 DMX Channel Setup for Multiple ProJectors a C 2 iv M Series User Manual 020 100009 04 Rev 1 10 2009 CHRISTIE 1 Introduction Every effort has been made to ensure the information in this document is accurate and reliable however due to constant research the information in this document is subject to change without notice USERS OPERATORS This manual is intended for trained users operating professional high brightness projection systems Such users may also be trained to replace the lamp and air filter but cannot install the projector or perform any service functions on the M Series projector SERVICE Only Christie accredited technicians knowledgeable about all potential hazards associated with high voltage ultraviolet exposure and high temperatures generated by the lamp and associated circuits are authorized to 1 assemble install the projector and 2 perform service functions inside the projector This manual contains the following sections Section 1 Introduction Section 2 Installation and Setup Section 3 Operation Section 4 Web User Interface Section 5 Maintenance Section 6 Troubleshooting Section 7 Specifications Appendix A Menu Tree Appendix B GPIO e Appendix C DMX ArtNet DISCLAIMER Every effort has been made to ensure the information in t
172. nd 1 output female There are 2 LED s on the faceplate of the card The green Power LED which is on when the card is powered and the green Termination LED which is on when termination is enabled 2 28 M Series User Manual 020 100009 04 Rev 1 10 2009 CHRISTIE Section 2 Installation and Setup Input termination 2 Watt 120 Ohm is required on the last DMXC card in a loop through configuration i e only on the last projector Termination may be either hardware by plugging in a termination dongle etc or may be switched in by software but should not be both Software termination is only in place when the projector has AC applied If there are cases where the network is required to be terminated without AC applied to the last projector then a hardware terminator should be used Refer to Section 3 Operation for information about setting up the ArtNet and DMX interfaces DMX 108 314101 01 DMX512 A Isolated pwr foe NY D Software Terminated OUTPUT Connecting Tiled Projectors Wiring Requirements A distribution box or digital signal switcher may be used to feed the same video signal to all the units of the tiling array See Figure 2 26 Use of Distribution Box Distribution Box From Source ROW 1 COL 1 ROW 1 COL 2 ROW 1 COL 3 Me lt gt lt gt p Wig lt gt lt gt lt
173. ndem maintaining the current aspect ratio of the displayed signal data Anamorphic 1400 VERTICAL STRETCH FIGURE 3 24 ANAMORPHIC Adjusts the height of the image while keeping the width constant Use Vertical Stretch to change the aspect ratio of the display PIXEL TRACK Steady flickering or several soft vertical stripes or bands across the entire image indicates poor pixel tracking Proper pixel tracking ensures that the image quality is consistent across the screen the aspect ratio is maintained and that the pixel phase can be optimized described below Tracking determines the frequency of the pixel sampling clock indicated by the number of incoming pixels per line so that all pixels generated by a particular source are sampled NOTE By default the projector samples at the correct frequency for most sources For best results use a test pattern such as a smooth gray consisting of a clear pattern of black and white pixels or a similar half on half off graphic image such as the Windows 2000 shutdown screen Adjust the slide bar until the vertical stripes broaden to the point where one large stripe fills the image If the image still exhibits some shimmer or noise adjust Pixel Phase below M Series User Manual 020 100009 04 Rev 1 10 2009 CHAISTIE Section 3 Operation PIXEL PHASE NOTE Adjust Pixel Phase after Pixel Tracking Adjust pixel phase when the image usually from an RGB so
174. nds to all edges of the image When AUTO is pressed the auto setup process shall begin In some cases for analog video a menu may appear that presents multiple choices that allows the user to select the format that best suits their source This selection helps the auto setup get the correct settings for the tracking and phase controls for analog sources that contain the same number of active lines but have a different aspect ratios All digital and decoder option cards will not present an additional auto setup menu since digital hardware provides enough information to perform the correct auto setup e Analog PC graphics sources 4 5 wire sync present a list of formats based on the current active lines detected in the video M Series User Manual 3 17 020 100009 04 Rev 1 10 2009 Section 3 Operation 3 6 3 18 CHRISTIE e Analog Video Sources 3 wire sync on green always have the options Default and Advanced Video sources use a look up table to determine their format based on video standards The Advanced auto setup selection measures the start pixel and start line whereas Default uses the table values as is Size and Position Menu Increase or decrease the size of your image change its proportion aspect ratio move the image to a specific area of the screen and refine other related parameters Use Size and Position controls to match the image precisely to the screen used at the site Refer to Using Slide bars and Other
175. ng request The settings are applied to the displayed image and will take approximately 10 seconds If Vertical Keystone adjustments have been made starting to do any Horizontal Keystone adjustments will erase the Vertical settings and vice versa After the Horizontal or Vertical adjustments have been made selecting 2D Keystone adjustments will retain these settings Fine adjustment can now be made by moving any single corner separately Use the arrow keys to move to the required corner NOTE The current corner will be displayed in red Press ENTER to select the corner NOTE The current corner will be displayed in green Use the arrow keys to move the selected corner to match the screen Press ENTER again to save that position for the corner Repeat Steps 6 to 9 to adjust all 4 corners until they match the screen Select OK to apply the new corner positions to the image NOTE A message will be displayed for approximately 10 seconds indicating that the projector is Processing request Under certain combinations of extreme keystone co ordinates and specific signal frequency a keystoned image may result that is outside the bandwidth limitations of the projector When attempting to apply the keystone settings a message will pop up on the OSD indicating that the bandwidth has been exceeded and the keystone cannot be applied The cursor co ordinates for keystone adjustment will remain at the failed keystone position This will allow th
176. nge Operating Altitude 5 to 40 degrees C 40 to 70 degrees C 10 to 80 non condensing 10 000 ft maximum 7 10 Accessories and Service Components Section 7 Specifications Product Name Part Number Sold With Sold Product Separately Standard Image Processor 108 3 15101 XX X Dual Image Processor 108 316101 XX X X Analog Input 108 309101 XX X X Dual Link DVI Input 108 312101 XX X X Video Decoder Input 108 310101 XX X X Dual SD HD SDI Input 108 313101 XX x x Twin HDMI Input 108 311101 XX x x DMXS512 Interface 108 314101 XX x x Air Filter Dust 118 100104 XX x x Air Filter Fog 118 100105 XX x x Stacking Frame 118 100107 XX X Ceiling Mount 118 100108 XX X Lens ILS 0 73 1SX 0 67 1HD 118 100110 XX x Lens ILS 1 25 1 6SX 1 16 1 49HD 118 100111 Xx x Lens ILS 1 5 2 0SX 1 4 1 8HD 118 100112 XX x Lens ILS 2 0 2 8SX 1 8 2 6HD 118 100113 XX x Lens ILS 2 8 4 5SX 2 6 4 1HD 118 100114 XX X Lens ILS 4 5 7 5SX 4 1 6 9HD 118 100115 XX X Lens ILS 7 5 11 2SX 6 9 10 4HD 118 100116 XX X Lens ILS 1 2SX 1 1HD 118 100117 XX x Lens ILS 1 2SX 1 1HD 118 101103 XX x Portrait Adapter 118 116109 XX X Module IR Keypad w Laser 002 100005 XX X X HARN Wired Keypad External 001 100704 XX X X User Manual 020 100009 XX X Service Manual 020 100010 XX X AutoSTACK 108 308101 XX X 7 10 1 Service Components Service Item Part Number DLV1920 DL DLV1400 DL L
177. o Select Single lamp or Dual lamp 8 Static Lists Channel and Signal Input lists are dynamic by nature expanding and decreasing as the valid data changes However they are statically defined for DMX All 24 inputs and 20 channels are selectable at any given time through DMX Lens Control Limitiations WARNING Normal ILS control of the lens horizontal and vertical positions by the projector respects the boundaries of the lens keepout area This area is necessary to prevent damage to components within the projector When the DMX controls are used to set the absolute position of the lens setting values in these keep out areas may result in an unwanted final lens position The user must ensure that any interim or final lens positions at any time during the lens movement do not enter the keep out area Appendix C DMX ArtNet CHRISTIE Facing Screen 2050 0 100 Keep Out Keep Out 2050 2050 400 0 100 2050 FIGURE C 1 LENS CONTROL LIMITATIONS C 1 2 DMX Channel Setup for Multiple Projectors The Basic Personality is a subset of the Advanced Personality The Basic personality is limited to 20 channels to allow for more devices to be placed on the same universe giving the user the most common controls they would want to use during a basic The Advanced personality is a full personality of 64 channels By default the Basic personality will be used It is very important to properly configure the base channel d
178. o work with Brightness Uniformity This ensures that primary colors color temperature and maximized light output are all well matched from one screen to another These matches are needed before you can achieve good brightness uniformity results O RUN LAMP FOR 100 HOURS L ight output and brightness uniformity can vary significantly during the first 100 hours of lamp use For best results with new lamps either set up brightness uniformity after this period or do an initial setup and re check at 100 hours M Series User Manual 3 41 020 100009 04 Rev 1 10 2009 CHRISTIE Section 3 Operation 3 42 m g SET LAMP POWER Ensure that each Lamp Power setting is as high as possible for your application while still maintaining a good overall match of light output from screen to screen By nature achieving a uni form brightness will require a slightly reduced overall brightness this reduction will help ensure that you have enough range of adjustment when examining brightness variables more closely from screen to screen and will help prevent premature maxing out when trying to match to a certain color zone or pro jector NOTE On DLV models the Power control is fixed at 150W to maximize lamp life In Constant Power mode use the Manual Iris Position slidebar to adjust brightness In Constant Intensity mode use the Intensity slidebar to adjust brightness USE A USER COLOR TEMPERATURE Always adjust brightness uniformity
179. oarse the control represents the upper 8 of 12 bits See restrictions in section Lens Control Limita tions 13 Lens Vertical 16 increments 1 step approx 1 This control has 4096 steps to give 1 step reso Absolute position pixel per 3 steps relative to lution it is split between 2 controls This part of Fine coarse control the control represents the lower 4 of 12 bits See restrictions in section Lens Control Limita tions 14 Lens Zoom 1 increment 8 steps This control has 2100 steps to give 1 step reso Absolute position lution it is split between 2 controls This part of Coarse the control represents the upper 8 of 12 bits 15 Lens Zoom 16 increments 1 step relative This control has 2100 steps to give 1 step reso Absolute position to coarse control lution it is split between 2 controls This part of Fine the control represents the lower 4 of 12 bits 16 Lens Focus 1 increment 8 steps This control has 2100 steps to give 1 step reso Absolute position lution it is split between 2 controls This part of Coarse the control represents the upper 8 of 12 bits 17 Lens Focus 16 increments step relative This control has 2100 steps to give 1 step reso Absolute position to coarse control lution it is split between 2 controls This part of Fine the control represents the lower 4 of 12 bits Power Off 0 25 A 5 second timer will be used before executing a power state change If the slider moves out of the 18
180. ock is in Apply All Channels 75 100 enters the unlocked position Picture Mute Off Live Video 0 25 3 Video Mute No Action 25 75 Picture Mute On Black Screen 75 100 4 Fade To From Black 0 10s Scaled as of total control range Time Fade From Live Video to Black 0 25 Fade To From Black 5 Time No Action 25 75 Fade From Black to Live Video 75 100 Unfreeze Image 0 25 6 Image Freeze No Action 25 75 Freeze Action 75 100 Shutter Open Live Video 0 25 7 Shutter No Action 25 75 Shutter Closed Black Screen 75 100 Input 1 Slot 1 4 1 Input 1 Slot 2 16 6 Input 1 Slot 3 26 10 Input 1 Slot 4 37 14 Input 1 Slot 5 48 18 8 Input Input 1 Slot 6 58 22 Input 2 Slot 1 69 27 Input 2 Slot 2 80 31 Input 2 Slot 3 90 35 Input 2 Slot 4 101 39 Input 2 Slot 5 112 43 Input 2 Slot 6 122 47 M Series Setup Guide 020 100011 04 Rev 1 10 2009 C 3 Appendix C DMX ArtNet CHRISTIE Channel Name Description Value Notes Input 3 Slot 1 133 52 Input 3 Slot 2 144 56 Input 3 Slot 3 154 60 Input 3 Slot 4 165 64 8 cont Input Input 3 Slot 5 176 69 Input 3 Slot 6 186 72 Input 4 Slot 1 197 77 Input 4 Slot 2 208 81 Input 4 Slot 3 218 85 Input 4 Slot 4 229 89 Input 4 Slot 5 240 94 Input 4
181. ojection lens shipped separately from the projector must be installed prior to setting up the projector tite Remove the lens plug from the lens opening in the projector before installing the lens Retain the lens plug for projector transportation to protect the projector s optical components from dust and debris IMPORTANT The lens seals the projector preventing contaminants from entering the interior of the projector Never operate a projector without a lens LENS INSTALLATION 1 Remove the rear lens cap from the lens Keep the front lens cap on the lens to protect it during installation 2 Rotate the lens clamp to the OPEN position see Figure 2 1 Lens Installation 3 Remove and retain the 2 security screws from the lens mount see Figure 2 2 Security Screw Location 4 Align the lens interface plate with the lens mount Align the lens electrical connector with the mating connector on the lens mount Fully insert the assembly straight into the lens mount opening without turning Press using your hand see Figure 2 3 Lens Placement NOTE When installing the lens ensure that the lens IS NOT inserted at an angle as this can cause damage 5 While holding the lens flat against the lens mount rotate the lens clamp clockwise to lock the lens assembly in place 6 For added stability such as motion applications fasten the security screws see Figure 2 2 Security Screw Location provided on the lens mount using the tool provided NOTES
182. ojector source switching in the array is not synchronized Therefore some latency can be seen from when the commands are issued to each projector causing switching to not be as seamless when in a tiling config uration When using loop through via the Twin HDMI Input Card to distribute a signal to the tiling array additional latency in the switching can occur during HDCP repeater negotiations with the source player NOTE When the FUNC HELP key combination is pressed the tiling settings will be cleared Diagnostics amp Calibration Submenu TEST PATTERN Choose the desired internal test pattern to display or select OFF to turn off a test pattern Alternatively use the TEST key for cycling through test patterns GREY LEVEL This will set the level of grey for displaying in the full gray field test pattern M Series User Manual 3 49 020 100009 04 Rev 1 10 2009 Section 3 Operation 3 50 CHRISTIE FREEZE IMAGE Enter a check mark to freeze stop an image on a single frame Use this diagnostic tool to examine in detail a still version of an incoming image that cannot be frozen at the source For example in moving images it is sometimes difficult to observe artifacts such as external de interlacing resizing and signal noise Remove the checkmark to return to normal e COLOR ENABLED Select which color s you want to see Use this while working with color temperature input levels or other special setup parameters
183. om operating and could cause damage to the projector This may cause the projector to shut down automatically An example would be a fan not running Both alarm types display the item of alarm the status of the item The item of the alarm can be either physical i e fan or sensor or the alarm can be a software issue i e lamp driver The LCD displays the status of the item and its units if applicable If the status of the item is out of normal range an alarm is created When the status of the item is within normal range the alarm will clear NOTES 1 When an alarm is displayed in the LCD display the built in keypad is disabled To confirm the alarm press the OK soft key to enable the built in keypad 2 The alarm condition can also be viewed using the remote in the read only Status menu M Series User Manual 020 100009 04 Rev 1 10 2009 TYPE OF ERROR INDEX OF ALARM ie ek ys Warning Alarm TOTAL OF ALARMS ALARM ITEM Card Cage Fan ALARM STATUS 1488 RPM Prey SOFT KEY FIGURE 3 45 EXAMPLE OF ALARM CONDITION M Series User Manual 3 59 020 100009 04 Rev 1 10 2009 CHRISTIE 4 Web User Interface 4 1 Logging On IMPORTANT Before logging on to the system ensure that you select the appropriate language required Your language selection only affects the web user interface The language used by the projector 5 on screen display OSD is not affected See Figure 4 1 1 Open your web browser and type the IP ad
184. ommended that you use Internet Explorer V7 0 Help Text You can move your mouse pointer over most buttons or fields to display related help information or click the Help button if available See Figure 4 4 To disable this feature go to Admin gt System gt Tooltip Hide NOTE Help text is not available for a disabled button On Shutter Open and Close Shutter 09 58 09 Close FIGURE 4 4 HELP MOUSE OVER EXAMPLE M Series User Manual 020 100009 04 Rev 1 10 2009 CHAISTIE Section 4 Web User Interface 4 3 4 3 1 4 3 2 Basic Operation This section discusses the primary tabs located along the top of the application window Each primary tab also has related secondary tabs which are located along the bottom of each tabbed page as follows Main e General Status Lens Tools Virtual OSD Admin e System e Users Advanced RTE About e Version e License Main Tabbed Page General Under the Main tabbed page select the General secondary tab to view general information about Inputs Channels Projector Information Test Pattern and Color Enable see Figure 4 3 For detailed information refer to Section 3 Operation Main Tabbed Page Status Under the Main tabbed page select the Status secondary tab to view the 12 Category LED status lights which indicate the projector s highest critical state See Figure 4 5 The LED color of the category indicates that i
185. on Adjusting System Parameters and Advanced Controls 3 32 3 9 Input Switching amp PIP Men aasan n n e E EREE EEE 3 51 3 10 Lamp M BUu u u aaa aayisaanas aaa uqsuy E E NR EEEE NEEE EEE 3 52 j ISIS s n sns eu ea se wt aa pen anna oa Geeta eee 3 54 3 12 Using Multiple Pr0J U0r8 asna ear E E EAA A SEAR TEES EEATT 3 54 3 13 Remote Control of the Proj Octor ccscssccxanseascnenscecacesstanssanss ceavnadeneesncasacenncdsetonnptecnsaareansnensearenn 3 58 3 14 Alarm Condifi nS uu aa aa asasa aqasha anaq anu na quas aa qaa qua EESE EEST 3 58 M Series User Manual 020 100009 04 Rev 1 10 2009 Table of Contents CHAISTIE 4 Web User Interface 41 esa O uy aasan as bd cu es oa ceo cea Goede dee R Ei 4 1 4 2 Navigating the Web User TALCiTAC Gs ixucyesvesscsssusecenssunsseseweore urrwnadindonessenngeiieaeunncscostinedeseentiaataoes 4 2 4 2 1 Help VCRs anu atahay sdecessta EEE E canna EE OEE R 4 2 4 3 BaSIG Op rati nmu un su ana biaqawaa ae ea au i S r E EEEa Nea 4 3 4 3 1 Main Tabbed Page General n nasus 4 3 4 3 2 Mam Tabbed Pate Status Lu nauunawaan REE ERI 4 3 4 3 3 Main Tabbed Page Lens sarc axnaccgces secaiversuaransustaipenecniesdenaaietoroneunnaenceeeutaneetuatentencannneatennrneanens 4 4 4 3 4 Tools Tabbed Page Virtual OSD si ficiseosscocsnocensesndctesesdesvacede Aanessianeeiase acchataunsesoaussatnds 4 4 4 3 5 Admin Tabb
186. onnection to the projector The Web interface provides access to the menu system as a Virtual OSD On screen display and to features that maintain the projector s software and settings List of Components Ensure the following components were received with the projector Projector with Built In Keypad LCD status display IR remote keypad includes two 1 5V AA batteries and an XLR to mini stereo cable conversion to wired Line cord Lens Mount Security Screw M6x10mm long Qty 2 Lens Mount Security Screw 5mm Hex Qty 1 Warranty Card OQoudagaaaoadaoudg Web Registration Form Key Features e Up to 10 000 lumens HD 1080p or SXGA WUXGA or WXGA resolution e Dual Mercury lamp illumination with 200W or 350W options e Dynamic iris contrast aperture providing up to 10 000 1 contrast ratio M Series User Manual 1 3 020 100009 04 Rev 1 10 2009 Section 1 Introduction CHRISTIE Ultra compact design and weighs less than 55lbs 10 bit image processor electronics with modular design Fully sealed optical system Active fan control for minimum noise level Selectable motorized yellow notch filter for expanded color gamut User interchangeable projection lenses with no tool mounting PIP and seamless switching LiteLOC for constant brightness maintenance Intelligent Lens System ILS Motorized lens mount for all models Auto setup feature Integrated ChristieNET Networking ability through RS 232 and RS 422 c
187. onnectors Status LED display on built in keypad for easy projector status monitoring Control with remote keypad wired remote or built in keypad Four input slots for Optional Input Modules Refer to Section 7 Specifications for a complete list of technical specifications Table 1 3 M Series Projectors Model Name Part Number DLV 1400 DL 118 044109 XX DLV 1920 DL 118 042107 XX DS 6K M 118 014106 XX DS 10K M 118 013105 XX HD6K M 118 012104 XX HD10K M 118 01 1103 XX Roadster HD10K M 118 021 104 XX Roadster S 10K M 118 0231 06 XX Roadster WU12K M 118 025108 XX WU7K M 118 016108 XX WU12K M 118 015107 XX WX7K M 118 018100 XX WX10K M 118 017109 XX M Series User Manual 020 100009 04 Rev 1 10 2009 CHRISTIE 2 Installation and Setup This section explains how to install connect and optimize the projector for delivery of superior image quality Illustrations are graphical representations only and are provided to enhance the understanding of the written material 2 1 Projector Quick Setup and Installation The following instructions are for those preferring a quick setup Refer to the remaining subsections for detailed setup instructions Vier A c 3I 2 Always power down the projector and disconnect all power sources before servicing or cleaning WAN Ntey Refer to Safety Warnings and Guidelines in Section 5 Maintenance STEP 1 Installing a Projection Lens The pr
188. open aperture 1080p 2100 1 typical full open aperture SXGA 2100 1 typical full open aperture WUXGA 2100 1 typical full open aperture WXGA 10000 1 typical with dynamic aperture 15 25 25 35 5 5 Negative uniformity shall be between 35 and 0 and positive uniformity shall be between 0 and 35 0 005 cluster on u v chart CIE 1976 Full black ANSI 13 pt 7 1 6 Color Primaries ANSI 9 point measurement without YNF Red Green Blue White ANSI 9 point measurement with YNF Red Green Blue 7 1 7 Gamma Default Gamma all points from 10 to 90 IRE 0 075 cluster on v v chart CIE 1976 x 0 665 025 0 335 025 0 343 040 0 640 040 0 145 020 0 050 025 0 300 050 0 300 050 X y 0 670 025 0 330 025 0 300 040 0 673 040 0 148 020 0 045 025 2 2 linear segment Adjustable Gamma range 1 0 to 3 0 7 1 8 Grayscale Color Resolution Resolution 10 bits non linear min Gamma encoded M Series User Manual 020 100009 04 Rev 1 10 2009 CHRISTIE Section 7 Specifications 7 1 9 Color Temperature White Default CCT without YNF 7700K 2000K 350W Lamp 8900K 2000K 200W Lamp White YNF CCT with YNF activation 6500K 1000K electronically corrected Range of Adjustment 3200 K 9300 K Tracking deviation from normal over full 500 K max range from 10 100 IRE Stability during rated lamp life 500 K max 7 1
189. or a computer controller connected to the first projector In such a network you can choose to broadcast commands to the entire group or use the PROJ key as desired to limit responses to an individual projector Alternatively you may want to add projectors to a hub on an Ethernet network See Figure 2 22 Mixed Network for full routing details Matching Colors in Multiple Screens In a multiple projector wall you will likely want to precisely match color and intensity from image to image so that the full wall is as uniform as possible M Series User Manual 020 100009 04 Rev 1 10 2009 Preliminary Calibration All primary colors in the projector are precisely set to pre established values to ensure that overall color performance is optimized and is as accurate as possible Lighting and other environmental factors may slightly change how these colors appear on your screen While the change is negligible in most cases you may prefer to recover the originally intended color performance before trying to match colors from several projectors To achieve consistency use a color meter to measure the native primary colors ted green blue and white as they appear at the screen Record these as Color Primary Settings in the Service menu password protected for each projector On the basis of these new values which are stored in memory each projector will then automatically calculate any necessary corrections to reproduce the original factory co
190. orm Blanking Submenu This submenu consists of the following options e ACTIVE INPUT WINDOW This read only value indicates the current size of your displayed data or region of interest as defined by the blanking controls By default the projector automatically determines what portion of its full resolution to use and pixels in the surrounding borders are turned off To specify a specific active input window size by adjust one or more Blank settings For example if you have blanked cropped 100 pixels from both the left and right edges of an incoming source of 1400 x 1050 the remaining active input window will be reduced to 1200 x 1050 M Series User Manual 3 21 020 100009 04 Rev 1 10 2009 Section 3 Operation 3 7 3 22 BLANKING TOP BOTTOM LEFT and RIGHT Crop the image so that unwanted edges are removed from the 1059 display changed to black Blanking defines the size of the Active Input Window or area of interest Range of adjustment depends on the source resolution and other factors NOTE Blanking a PIP image resembles zoom For example left Blanking zooms the right side of the PIP image Right Blanking zooms the left side There are no black bars PIP Blanking Active Input Window 720x483 1 Top Blank 0 2 Bottom Blank 0 3 Left Blank 0 4 Right Blank 0 No PIP blanking CHRISTIE Example incoming image x K a 1050 1400 __ E
191. p Enter A 42 iSVid 15 73kHz i59 94 Hz E A 4 1 pDig 33 72kHz p29 07 Hz BA pag Select Channel Operation Edit Copy Delete y Delete Unlocked Only Delete All Channels Do you wish to delete this channel setup default Delete Channel Setup Cancel FIGURE 3 15 DELETE A CHANNEL TO DELETE MULTIPLE CHANNELS highlight any channel in the Channel Setup menu and press ENTER to go to the Select Channel Operation submenu Select Delete Unlocked Only and press ENTER to delete all unlocked channels Select Delete All Channels to delete all channels even those that are locked In either case the current channel will remain but will be redefined from projector defaults NOTE For any deletion a window will appear to confirm the deletion of the desired channel Select CANCEL default if you don t want to delete after all CHANNEL EDIT STEP 1 Press MENU from the presentation level to display the Main menu To display the Channel Setup menu press 3 or move the highlight to the Channel Setup option and press ENTER The Channel Setup menu will appear M Series User Manual 3 15 020 100009 04 Rev 1 10 2009 Section 3 Operation 3 16 CHRISTIE CHANNEL EDIT STEP 2 To edit parameters shown in the Channel Setup menu select the relevant channel and press ENTER The Channel Edit menu will appear similar to the sample shown below Channel Edit 01 Card Type Video Decoder Input Card H Frequency
192. p clamp location 6 7 6 The Upper Portion of the Display is Waving Tearing or Jittering This can occur with video or VCR sources Check your source 6 7 7 Portions of the Display are Cut Off or Warped to the Opposite edge Resizing may need adjustment Adjust until entire image is visible and centered 6 7 8 Display Appears Compressed Vertically Stretched 1 The frequency of the pixel sampling clock is incorrect for the current source 2 Sizing and positioning options may be adjusted poorly for the incoming source signal 3 Use an anamorphic lens for typical HDTV and anamorphic DVD sources that have been re sized and vertically stretched via 3rd party software 6 7 9 Data is Cropped from Edges To display the missing material reduce image size to fill the display area available in the projector then stretch vertically to fill the screen from top to bottom Add the anamorphic lens to regain image width 6 7 10 Display Quality Appears to Drift from Good to Bad Bad to Good 1 The source input signal may be of low quality 2 The H or V frequency of the input may have changed at the source end 6 4 M Series User Manual 020 100009 04 Rev 1 10 2009 CHRISTIE Section 6 Troubleshooting 6 7 11 Display has Suddenly Frozen If the screen blacks out inexplicably it is possible that excessive voltage noise on the AC or ground input has interrupted the projector s ability to lock on to a signal Power down the projector and d
193. pect Closely align all screen edges 2 Assign projector numbers to make communications easier Use desired keypad Use the same lamp mode for all projectors and do the following Set Select Color Adjustment to Max Drives e Display a full white test pattern e Adjust lamp power and Optical Aperture until adjacent white fields appear the same brightness 4 Display the Color Adjustments by X Y menus for all projectors Each menu shows the x y coordinates defining the Max Drives color gamut for this projector NOTE The values shown in one any of the displays Use the Copy From function to copy them into a User gamut in one projector M Series User Manual 3 55 020 100009 04 Rev 1 10 2009 Section 3 Operation PROJ PROJ e PROJ CHRISTIE Color Adjustments by X Y Color Adjustments by X Y Color Adjustments by X Y 1 Select Color Adjustment __Max Drives 1 Select Color Adjustment__Max Drives 1 Select Color Adjustment Max Drives 2 Color Temperature 6521 2 Color Temperature 6521 2 Color Temperature f 3 RedX 0 655 mm 3 Red X 3 Red X 0 626 BEN 4 RedY 0 341 1 4 RedY 4 RedY 0 350 8 5 Green X 0 332 5 Green X 5 Green X 0 331 E 6 Green Y 0 575 6 Green Y 6 Green Y 0 528 M 7 Blue X 044 7 Blue X 7 Blue X 0 133 8 J 8 Blue Y 0 093 8 Blue Y 8 Blue Y 0406 FE 9 White X 0 320 I 9 White X 9 Whi
194. projector Other Considerations Other considerations and tips to improve your installation Keep the ambient temperature constant and below 40 C 104F Keep the projector away from heating and or air conditioning vents Changes in temperature may cause drifts in the projector circuitry which may affect performance Keep the projector away from devices that radiate electromagnetic energy such as motors and transformers slide projectors speakers power amplifiers elevators etc Use a screen size appropriate for the venue but not larger than required Installing a large screen in a small room is similar to watching television at a close range too large a screen can overpower a room and interfere with the overall effect As a rule be no closer than 1 5 times the width of the screen M Series User Manual 2 9 020 100009 04 Rev 1 10 2009 CHRISTIE Section 2 Installation and Setup 2 2 3 Projector Position and Mounting Throw Distance Throw distance is the distance measured from your projector s front feet to the screen This calculation determines if there is enough room to install your projector with a desired screen size and if the image will be of the right size for your screen To estimate the throw distance take the horizontal width of the screen and multiply it by the lens throw ratio The result determines approximately the distance the projector should be positioned from the screen to project a focused image large eno
195. ps the Main anq PIP image Exit e Return to previous menu levelor exits menus if at top level Enter e Select a highlighted menu item change or accept a value Projector e Select a projector in multi projector installations Bright Adjust amount of light in image Contrast Adjust difference between light dark Func e Enter special code such as color enabling or enter for a negative numeric value 10 e Enter 0 digit in a numeric field or add 10 to subsequent number for a menu selection of 10 or more Press and hold to toggle or press twice to toggle or press and release followed by AON or WOFF FIGURE 3 1 REMOTE KEYPAD M Series User Manual 020 100009 04 Rev 1 10 2009 CHAISTIE Section 3 Operation Wired Remote You can convert the remote keypad into a wired remote keypad using the cable provided with the projector Connect one end into the remote and the other to the XLR connector on the input panel labeled as wired keypad The wired remote is recommended when The built in keypad is inaccessible The lighting conditions are unsuitable for proper IR transmission NOTE Leave the batteries in the wired remote for the laser pointer key to work Built in Keypad LCD status display window Soft Keys Power Key Lens Key Menu Key Exit Key Arrow Key an Help Key Shutter Shutter Key Auto Key Enter Key Input Key FIGURE 3 2 BUILT IN KEYPAD The bu
196. puts 165 MPixel s analog M Series User Manual 020 100009 04 Rev 1 10 2009 CHRISTIE 7 4 4 Video Decoder Input Connectors Color space Signal types Video Standards A D conversion 7 4 5 Dual SD HD SDI Connectors Color spaces signal types 7 5 Control Signal Compatibility 7 5 1 Projector Control Number of transmitters Modulation frequency Wavelength peak intensity Range Wired Keypad Wire connection option Max cable length XLR Connections 7 5 2 Control Receiver Number of sensors Coverage Modulation carrier frequency 7 5 3 RS 232 Section 7 Specifications 2 S Video 4 pin miniature DIN 4 BNC 75 Ohm 2 independent decoder channels for PIP Composite video Component video SD and ED only S video NTSC NTSC 4 43 PAL PAL M PAL N PAL 60 SECAM 10 bits BNC 75 Ohm Dual HD input SDI HDSDI 2 IR Dual frequency 38 kHz 455 kHz 950 nm Min 35 m 3 pin XLR 30m Optional boot for remote with XLR connector built in to avoid requirement to use phono to XLR adaptor cable 1 front 1 rear 130 degrees coverage in line with lens at 3 m distance Dual frequency 38 kHz 455 kHz Number of ports Connector Max bit rate Flow control M Series User Manual 020 100009 04 Rev 1 10 2009 2 1 female 9 pin Dsub IN 1 male 9 pin Dsub OUT 115 2 kbps Xon Xoff 7 9 Section 7 Specifications 7 5 4 RS 422 Number of ports Connector Max bit rate Power output
197. r S Sos d e D BS bod oar oj i id i i ROW 3 COL 2 ROW 3 COL 3 FIGURE 2 31 3X3 LOOP THROUGH WIRING SOLUTION M Series User Manual 2 31 020 100009 04 Rev 1 10 2009 CHRISTIE Section 2 Installation and Setup 2 32 M Series User Manual 020 100009 04 Rev 1 10 2009 CHRISTIE 3 1 Operation This section describes the controls and switches used for basic projector operation once it is properly installed aligned and configured by a Christie accredited service technician MPN AI Ntey Refer to Safety Warnings and Guidelines in Section 5 Maintenance Using the Remote Keypad or Built In Keypad The projector is typically controlled using one of the following keypads Remote Keypad for wired or wireless control up to 25 feet 8m away includes cable for use as a wired remote The remote keypad controls the projector by way of wireless communications from a battery powered infrared IR transmitter Use the remote keypad the same way you would use a remote keypad supplied with a TV or VCR When pressing a function key dir
198. r Manual 020 100009 04 Rev 1 10 2009 CHRISTIE 7 Specifications This section provides detailed M Series features including inputs lamp and power requirements NOTE Due to continuing research detailed features are subject to change without notice 7 1 Image Performance 7 1 1 Pixel Format 1080p H x V square pixels SXGA H x V square pixels WUXGA HxV square pixels WXGA HxV square pixels 7 1 2 Brightness ANSI Lumens Projector Model WX7K M WX10K M DS 6K M DS 10K M Roadster DS 10K M HD6K M HD10K M Roadster HD1OK M WU7K M HD12K M Roadster HD12K M DLV1920 DL DLV1400 DL M Series User Manual 020 100009 04 Rev 1 10 2009 1920 x 1080 1400 x 1050 1920 x 1200 1366 x 768 Lamp Mode Dual Dual Dual Dual Dual Dual Dual Dual Default Default Brightness ANSD 5700 9500 6300 10 500 6000 10 000 6300 10 500 2550 2500 7 1 Section 7 Specifications 7 1 3 Contrast ANSI 16 pt checker pattern on black screen Full field 9 pt average ON OFF with background light subtraction Dynamic available for non DLV models 7 1 4 Luminance Uniformity Dual lamp Full white ANSI 13 pt w o electronic corr Single lamp Full white ANSI 13 pt w o electronic corr Full white ANSI 13 pt w electronic corr Full black ANSI 13 pt 7 1 5 Color Uniformity Full white ANSI 13 pt CHRISTIE 650 1 typical 2500 1 typical full
199. reen being displayed Input Key enabled when the power is ON Disabled if the power is OFF Lens Key enabled when the power is ON Disabled if the power is OFF Shutter Key enabled when the power is ON Disabled if the power is OFF Menu Key always remains in the enabled state when the power is ON If the power is off the Menu key is disabled Soft Key used to select an action indicated by text above the key on the LCD If no text is shown the associated key is disabled Remote Keypad Commands Specific keypad commands are explained see Figure 3 1 Remote Keypad Power ON OFF Press and hold POWER for two seconds or press twice quickly to action the projector ON or OFF Or press and release POWER followed immediately by UP ARROW KEY ON or DOWN ARROW KEY OFF to guarantee the correct action useful if you are unsure of the present state NOTES 1 After powering down the lamp cooling fan remains on for approximately five minutes to cool the lamp 2 Avoid turning the projector back on until it has been off for a few minutes Hot re strikes of the lamp will reduce lamp life Test Steps forward through all internal test patterns After stepping past the last test pattern you will return to current input Press TEST and then cycle by using the UP ARROW KEY and DOWN ARROW KEY arrow keys to cycle in either direction through the test patterns Press EXIT to return to the current input Auto Initiates an automated process in which
200. ries User Manual 020 100009 04 Rev 1 10 2009 CHAISTIE Section 3 Operation 3 Use the menu options Menu gt Input Switching amp PIP gt Main Input and Menu gt Input Switching amp PIP gt PIP Input to select the source of the image for the main or PIP image The image will be displayed according to the following If it is the first time you have used the source input or if you used the input but did not define a channel by adjusting anything the projector will recognize the new input signal based on its frequencies and polarities automatically displaying an image according to default settings for that signal In general the image from the new source will be as large as possible without losing its aspect ratio This and other default image settings depend on the incoming source If you used the source once before and changed a display parameter such as contrast V Position etc then a channel was automatically created and still exists in projector memory see CHANNEL below Using one of the input or slot keys will automatically recall this channel and all its setup parameters and update the display accordingly If more than one channel exists for the input the image will be displayed according to the setup parameters for the first channel with matching characteristics Creating a New Channel To use a new source with the projector a new channel must be created so that the projector will respond to an input signal fro
201. riggered by user actions Examples are signal information function limitation or auto calibration message boxes e DISPLAY USER MESSAGE BOXES Enable or disable the pop up of message boxes that are directly triggered by user actions Examples are gamma or lens control message boxes DISPLAY ERROR MESSAGES Choose how you want to be notified of errors detected in either the incoming signal or projector Select Screen or All default to see brief on screen messages This is recommended during setup or testing of the projector Or select Serial Ports to receive messages via RS 232 or RS 422 serial communication only To hide error message displays such as during shows and presentations select Off or Serial Ports SPLASH SCREEN SETUP Choose when to display a special introductory splash screen image such as your company logo graphic or message Always Off A splash screen never appears Start up Only The splash screen logo appears at projector start up only Start up And No Signal A splash screen appears at start up and at any time when there is no signal To add your own splash screen in addition to the default Christie logo splash screen use the Web UI to download the desired bitmap bmp file to the projector This will overwrite any other user splash screen that has been downloaded NOTE Only one user splash screen can be saved in the projector OSD TRANSPARENCY Check this box if you want the OS
202. rn to the presentation NOTES 1 If there is no signal present all source dependent adjustments are disabled 2 After 15 minutes of inactivity the projector leaves the menu system and returns to the presentation 3 The Status menu is read only On line Help Press HELP to display summary information about the current menu or highlighted option Press HELP again to play ry snig p exit Main Menu 3 E x Use this menu to adjust settings affecting current image 3 Channel Setup x size and position such as horizontal and vertical 4 Configuration i placement blanking resizing and others 5 Lamp gt 6 Status gt 7 Input Switching amp PIP gt 8 Test Pattern Off Y 9 Language English Y FIGURE 3 5 ON LINE HELP The Global Icon Menu options that include this icon apply universally Menu options without this icon apply to the selected channel only Using Slide bars and Other Controls Most of the function menus allow you to change settings by using slide bars check boxes and pull down lists Navigating options Enter the menu option number corresponding to the setting you wish to change for example press MENU 1 3 to select Vertical Stretch im the Size and Position menu e Move the highlight to the option desired and press ENTER e Move the highlight to the option desired and press LEFT RIGHT ARROW KEY to adjust immediately You can bypass the menus entirely and use a single key to immediatel
203. rnet Browser to ensure that Web UI changes can take effect 2 Using the Internet Explorer menu bar select Tools gt Internet Options Click Delete from the Browsing history option Click Delete files Once the Delete Files window displays click Yes Then click Delete cookies Once the Delete Cookies window displays click Yes then click Close Click OK to close the Internet Options window 3 Close the browser and re open before connecting to the projector 6 8 2 A backup file cannot be saved Before saving a backup file you may be prompted from a pop up window Disable the pop up blocker from Main gt Tools gt Pop up Blocker NOTE Different types of toolbars have the potential to block pop ups or as shown in Figure 6 1 M Series User Manual 6 5 020 100009 04 Rev 1 10 2009 Section 6 Troubleshooting 6 6 CHRISTIE Using the Internet Explorer menu bar select Tools gt Internet Options to open the Internet Options window Select Internet then click Custom Level to open the Security Settings Internet Zone window Scroll down the list until you see Downloads option setting Ensure the Automatic promting for file downloads and File Download options are enabled then click OK Once the Warning window displays click OK Using the Internet Option window select Local intranet then click Custom Level Repeat Step 3 gt Christie Digital Christie Windows Internet Explorer GTN G s 7 JE http Fie Edit
204. rocesses e DETAIL THRESHOLD Selects a filter sensitivity to noise A higher value may improve noisy sources especially for higher settings of detail e DETAIL OVERSHOOT Minimizes ringing on the enhanced edges detail and texture effects M Series User Manual 3 29 020 100009 04 Rev 1 10 2009 CHRISTIE Section 3 Operation e SPLIT SCREEN Allows a snap shot of the main image to be presented on the right side of the screen to allow evaluation of advanced image processing features All resizing controls are honoured on both images however image processing controls only happen on the left side image Changing inputs channels or test patterns will disable this control NOTE PIP and Tiling operation must be disabled prior to enabling this control NOISE REDUCTION SETTINGS e NOISE REDUCTION Selects a filter sensitivity to noise A higher value may improve noisy sources but it will soften the image BLOCK ARTIFACT REDUCTION Locates and reduces block edges produced by discrete cosine transform DCT based compression processing e MOSQUITO NOISE REDUCTION Reduces mosquito artifacts around sharp edges in DCT based compression by dynamically adapting to image content COLOR SETTINGS e SELECT COLOR ADJUSTMENT Select the output color adjustment most suited to this input signal The options include the following Max Drives All color adjustments are turned off allowing the projector to run at maximum brightness Color Te
205. run at a fixed frame rate frequency The frequency is defined by Free Run Frequency By default the free run frequency is 59 94Hz NOTE Seamless switching is only available when free run is selected When switching to a new input with frame locking enabled the image will be black for the short period while the system locks onto the new input AUTO INPUT SEARCHING When enabled the system will continually search for the next valid signal when no signal is present or when loss of sync occurs on the current user selected input In the case of multiple signals to choose from the order is based on slot followed by inputs on that slot Lamp Menu Fama 1 Lamp Operation Dual Lamp Use Y LAMP OPERATION 2 Lamp Mode Constant Power Y 3 Lamp Power 370 Select the operational mode to be assigned to the a nee Intensity 5 lamp s from the Lamp Operation drop down list If 5 Yellow Notch Filter a lamp fails to strike on the first attempt you can 6 Single Lamp Switch on Fail attempt upto 3 more strikes as prup 8 Warn when lamp reaches hours The Lamp Operation modes are 9 Lamp 1 s n N A 10 Lamp 2 sln N A e Lamp 1 single lamp use or Lamp 2 single lamp 11 Change Lamp use modes will only use the lamp specified If the 12 Lamp 1 History 13 Lamp 2 History selected lamp will not strike then the projector will not turn on If the Single Lamp Switch on FIGURE 3 40 LAMP MENU
206. s between H L and X 3 If the Pulse check box is selected those I O Pins defined will pulse high or low See Figure 4 15 GPIO Output Helper See Appendix B for detailed information GPIO Output Helper Output Add to Command x x x x xix x m ooo Command String Close FIGURE 4 15 GPIO OUTPUT HELPER NOTE Serial Representation box is read only e Click the Help button for a description of special RTE commands available for adding loops and delays to the command sequence 4 10 M Series User Manual 020 100009 04 Rev 1 10 2009 CHAISTIE Section 4 Web User Interface e Click the Test button to test the entered command string NOTE f the test passed or failed a green or red icon appears to the right side of the Test button as shown in Figure 4 16 Test Buttons BE E FIGURE 4 16 TEST BUTTONS 10 Click Finish to create the added event NOTES 1 The added event appears in the RTE Listing window See Figure 4 17 RTE Listing Window Example 2 To activate or deactivate one or more RTEs listed in the RTE Listing window select or clear each check box in the Active column accordingly Active Description Trigger Status T RTE 1 Daily Scheduled Event 2009 09 04 01 01 01 Idle O RTE 2 Weekly Scheduled Event 2009 09 04 02 02 02 Idle O RTE 3 Monthly Scheduled Event 2009 09 04 04 04 04 Idle O RTE 4 No Signal System Event No Signal Idle O RTE 5 LXLHLXL GPIO Event LXLHLXL Idle
207. s increasing and likewise a linear transform toward a gamma of 3 0 as the control is decreasing The control should only be adjusted to compensate for ambient conditions To correct a particular source only use the Gamma control 3 28 M Series User Manual 020 100009 04 Rev 1 10 2009 CHRISTIE Section 3 Operation GAMMA Select the base gamma table for a given source Select from one gt 7 2 22 el andard of the standard tables a custom gamma function or select an arbitrary gamma table that has been downloaded to the projector 2 reaa NOTE A separate PC utility is needed to do this z ee a a The 2 22 curve is a power curve typically used to encode graphics 8 and video sources see Figure 3 30 Gamma Curve The standard Signal Input Level Signal Input Level curve auto setup default is a modified 2 22 curve with a small linear section in the black that enhances the detail in darker areas FIGURE 3 30 GAMMA CURVE of the projected content Typically standard or 2 22 is used for all sources Alternatively if neither default is ideal apply a simple gamma curve by defining a custom power function and slope Select Gamma Function from the drop down list to enable the Gamma Function and Gamma Slope controls For more complex non standard gamma curves a user defined curve created externally and downloaded to the projector can b
208. s recommended 4 Ifblack levels are too high and or whites are too low which is rare you likely have a noisy source that is producing skewed input levels Enable Auto in the Input Levels menu Wait for all six values to stabilize Alternatively do not use Auto reduce black levels manually instead Judge by eye and change one or more of the six levels as necessary to obtain proper blacks and whites You may want to see only a certain color while adjusting use the Auto Color Enable option described below 5 Delete the Auto checkmark and leave the Input Levels menu IMPORTANT Do not use Input Levels to adjust color temperature This will distort contrast and brightness functions as well as color temperature 3 26 M Series User Manual 020 100009 04 Rev 1 10 2009 e AUTO COLOR ENABLE When a checkmark is present selecting a specific black level or drive to adjust will automatically enable the corresponding color in the display Delete the checkmark to see all colors or to enable a different specific color through the Color Enable control e CLAMP LOCATION Brightens the image produced from certain high resolution high frequency graphic sources The projector automatically selects the best clamp location for most sources Use the normal Back Porch location if the image is either sufficiently bright or overly bright Select Syne Tip if the image appears unusually dim if there are horizontal streaks across the imag
209. sisnacsaustdecoeasaiecaielascaveaiaicciesisiccnabesiacmaiamasonanes 7 11 TOA PAmDISDpSCIfICalIIOnB unus aa ayaaasha baka qQahaatamaaqa usa akaqa apussakaqyssusa Pkosysas askisius 7 12 Tel Physical Specificati nS u ascesskextasnsssecksenkundesnbianceyacaer E E E E E E R E EE 7 12 Lr SIZE e a E E E E E E ana aaa 7 12 7 7 2 PN AMIN ereen REE E EEE E kuy E 7 12 TS Welg hterana n va asm aiar EAEN EE A ARTERE ee ee say bs d 7 12 71 4 Operating POSIfI68_ uuu aaa apayaq cansmkayaasasuwaqwqaqaykayaakaaswaypaaypaypaqyasaasyasys ayquyqu 7 12 7 8 Reliability and ServiceabilifV uu a aaa nauasanunaaqahasqaqaqasaqqqaqisqaqyapqyaqhaaqaqsaassssaqaassssq 7 12 1 8 L Reliabililyu y u a u nana hala E waiushatuu Qasa E qa tasaakawahuas aN 7 12 T 8 2 EUV IC CATIA yy ices l Sa a Eat a E aeee ECA E TAERE eves ene 7 12 FI Enyironmmenteur sss Su u ean acca aga SG Sa a dene A a gma gv ae an 7 13 7 9 1 Wemipera tire nad ty Ade cxcsns cdsscannsneecsacndanceceaieaeancaiencasssacacesendeeeieatantentecsieatenanacaeees 7 13 7 10 Accessories and Service Components n n nana 7 13 TAO Service COMPONEN u u uuu isaisa eie EERE E EEEE A TERENE EE 7 13 7 11 Repulse iei E E E E E EEE 7 14 A Menu Tree AA M Seres Ment OO a asnuqa a inan au ayata aqa a a a aa a aE A 1 B GPIO BL GPIO Por m enan cca este cee bate hecho a at ce a tu mm a aus tu wh B 1 C DMX ArtNet C1 DMX and Real Time Eyents faa iacciticc ce phcaseedex eve asetics Sac
210. sor is located next to the projector s front nameplate Projection Lenses Lens Mount and Other Features The projector includes a motorized lens mount that allows automated lens control and adjustment vertical and horizontal offsets zoom and focus The lens mount can be fitted with any one of the available optional lenses see Section 7 Specifications M Series User Manual 020 100009 04 Rev 1 10 2009 CHAISTIE Section 2 Installation and Setup 2 2 2 e Zoom and Focus There are two internal lens motors that allow for quick motorized adjustment of zoom and focus Adjust zoom to fit the displayed image on the screen and adjust focus to improve the clarity of the image NOTES 1 The projection lens is shipped separately from the projector 2 Use the lens cap when transporting the lens to avoid scratching and damaging the lens which could affect your displayed image 3 Motorized lenses should not be adjusted by hand without first setting them for manual operation otherwise the zoom and focus motors may be damaged Set in Menu gt Configuration gt Lens Settings gt Manual Zoom Focus Lens Offset The motorized lens mount allows vertical and horizontal offset of the displayed image Shutter Standard on all models the shutter allows you to turn the screen absolutely black when in the Closed state e Dynamic Iris Contrast Aperture Enables adjustment of light output and contrast ratio Installation Consi
211. st T O i T Pattern g i I d In either Color Adjustments menu select a User color Then If you have created a User 1 color gamut recommended for a well matched wall continue to Step le If you prefer maximum brightness rather than a particular Ls color temperature select Max Drives FIGURE 3 35 13 POINT TEST PATTERN IMPORTANT Do not change User 1 Color Adjustment in color matched applications e Inthe White Uniformity menu and set the Overall output level to 50 0 and all remaining slide bars to 0 0 This decreases the light output just enough throughout the screen so that any color level can then be increased later as necessary for matching light output from zone to zone Do not exceed 50 0 for Overall a higher level will likely interfere with achieving brightness uniformity and is not recommended Ensure that overall light output remains well matched from one screen center to the next Where necessary increase or decrease Lamp Power slightly to recover center matches M Series User Manual 020 100009 04 Rev 1 10 2009 Step 2 Adjust Color level of red green blue in Eight Zones NOTES 1 At this point ignore the brightness of individual zones 2 Always ignore menu colors a On each screen compare the color temperatures in the eight target zones four edges and four corners to that of the color temperature of the center Compare using a white field only and take note of
212. st its corresponding Black level slide bar just until a single band of black appears at one edge of the screen This band represents the first band of the grayscale pattern which should be 100 black 4 With the same color still active adjust its corresponding Input Drive slide bar just until a single band of color appears at the opposite edge of the screen This band represents the last band of the grayscale pattern which should be 100 white or the current color if a certain color is enabled 5 Check the black band and adjust the black level slide bar if necessary NOTE Adjusting the black levels affects the gain Only adjust when necessary 6 Repeat Steps 3 5 with the two remaining primary colors When each primary color shows one optimized black band and white or colored band the input levels for this source are correctly set Upon exiting the Input Levels menu the Peak Detector check box will clear M Series User Manual 3 27 020 100009 04 Rev 1 10 2009 Input Levels 1 Auto Input Level O 2 Red Pr Blacklevel 256 m 3 Adjust corresponding Red example 3 Red Pr Input Drive 256 ae 4 Green Y Blacklevel 256 de ae 5 Green Y Input Drive 256 6 Blue Pb Blacklevel 256 PEE EA 7 Blue Pb Input Drive 256 mm input drive red green 8 Auto Color Enable v or blue until one 9 Clamp Location Back Porch Y rate bana appears Red example 10 Input Peak Detector v 2 Choase one pr
213. t is in one of the following states e Green Good Yellow Warning Red Error For more information about each LED click a category for details Alarms Configuration Signal oe f Versions 2 Peripherals System Lamp Info Temperatures Cooling Serials FIGURE 4 5 CATEGORY STATUS EXAMPLE M Series User Manual 4 3 020 100009 04 Rev 1 10 2009 Section 4 Web User Interface CHKISTIE 4 3 3 Main Tabbed Page Lens Under the Main tabbed page select the Lens secondary tab to define your adjustment settings for the lens For detailed information refer to Section 3 Operation 4 3 4 Tools Tabbed Page Virtual OSD Under the Tools tabbed page select the Virtual OSD secondary tab to access to the virtual OSD page See Figure 4 6 CHAISTIE wa tar B gt Maximize so amp Db A gt Main Menu Size amp Position 2 Image Settings Auto Setup 4 E Channel Setup Configuration Lamp Status Input Switching amp PIP Language Test Pattern FIGURE 4 6 TOOLS WINDOW The following table describes each area found in the Tools window See Figure 4 6 A VIRTUAL OSD TABBED PAGE B THE MAXIMIZE MINIMIZE BUT C HELP BUTTON PRESENTS A POP UP PRESENTS THE MAIN MENU TON TOGGLES DEPENDING ON THE WINDOW WHICH PROVIDES INFOR REFER TO APPENDIX A MENU CURRENT STATE OF THE PROJEC MATION TO HELP YOU NAVIGA
214. tal DSDI Digital Dual Link HD SDI DVI Digital DVI HDMI Digital HDMI HSDI Digital HD SDI SDI Digital SDI M Series User Manual 020 100009 04 Rev 1 10 2009 TO COPY A CHANNEL highlight the desired channel in the Channel Setup menu then press ENTER to go to the Select Channel Operation submenu Select Copy and press ENTER a new channel will be created It is identical to original which still remains but it is identified with the next available number from 01 99 If you change your mind and do not want to copy the current channel press EXIT to cancel and return to the previous menu Copying channels is a quick method for creating numerous channels each of which can then be edited and adjusted for a variety of presentations in the future Channel Setup Enter A 1 2 iSVid 15 73kHz i59 94 Hz lt 1 EA 4 1 pDig 33 72kHz p29 07 Hz Select Channel Operation Edit Copy Delete Delete Unlocked Only Channel Setup Delete All Channels E A 4 12 iSVid 15 73kHz i59 94 Hz E 44 pDig 33 72kHz p29 07 Hz 42 iSVid 15 73kHz i59 94 Hz oly New Channel identical mp 3 to Chan 1 FIGURE 3 14 Copy A CHANNEL TO DELETE A CHANNEL highlight the desired channel in the Channel Setup menu then press ENTER to activate the Select Channel Operation submenu Select Delete and press ENTER a window will appear to confirm the deletion of this channel Channel Setu
215. tant Power mode only manual iris control is available DYNAMIC IRIS SETTINGS There are 3 predefined settings Dark Scenes which produces high contrast ratios is for movies primarily consisting of dark content i e thriller or horror scenes Medium Scenes is for video content containing a moderate level of dark scenes i e action movie Light Scenes is for movies containing only a few dark scenes i e animation or a PC source The 4 User settings allow you to fine tune the dynamic iris and save your own settings SENSITIVITY Adjusts how sensitive the iris control algorithm is to small bright objects entering and leaving an image such as stars or candles With a lower sensitivity value these small bright objects are more likely to be ignored producing a more stable light level for the image with the side effect that some detail in those bright objects will be lost It is often best to adjust the sensitivity and white compression together to find the optimal settings e OPEN SPEED The open speed of the iris represents the maximum iris change per frame Increasing this value will allow the iris to travel further in a frame Decreasing this value will allow for a more gradual change A slower value will reduce any flicker in the image but it will also mean that the iris will not react quickly to a scene that suddenly becomes much brighter resulting in a image that will show a significant loss of detail for several fra
216. te X 0 323 gg 10 White Y 0 330 M 10 White Y 10 White Y 0 359 E 11 Yellow Notch Filter 11 Yellow Notch Filter 11 Yellow Notch Filter 12 Auto Color Enable vi 12 Auto Color Enable 12 Auto Color Enable s 13 Color Enable Red Y 13 Color Enable Red y 13 Color Enable Red x 14 Copy From Max Drives yv 14 Copy From ivi y 14 Copy From Max Drives lt Red X 0 64 0 a 0350 Record Max Drives Red Y 0329 x y values from one Green X eth menu Green Y 9 Blue X 0 127 Blue Y 0 100 FIGURE 3 41 JOT DOWN A SET OF MAX DRIVES X Y VALUES 5 In each projector select a User color adjustment 1 4 to enable Color Adjustments by X Y changes Then enter your recorded x y values into each menu PROJ PROJ PROJ 6 Color Adjustments by X Y Color Adjustments by X Y Color Adjustments by X Y 1 Select Color Adjustment User 2 1 Select Color Adjustment User 2 1 Select Color Adjustment User 2 2 Color Temperature 6521 2 Color Temperature 6521 2 Color Temperature 6521 E 3 RedX 0 655 E 3 Red X 0 640 EE 3 Red X 0 626 EE 4 RedY 0341 g _ 4 RedY 0 350 8 4 RedY 0 350 8 5 Green X 0 332 8 1 5 Green X 0 329 8 5 Green X 0 331 8 6 Green Y 0 575 mm 1 6 Green Y 0 560 EEN 6 Green Y 0 528 m 7 Blue X 0 144 7 Blue X 0 129 J 7 Blue X 0 133
217. tical performance of such screens demands minimal image offset thus projectors must be located very close to one another Edge blending software controls are located in Proj 2 1 Proj 2 2 Proj 2 1 Proj 2 2 the two page Edge Blending submenu access via Configuration menu then go to the Geometry and Color menu and select Edge FIGURE 3 37 EDGE BLENDING CONCEPT Blending The Advanced Edge Blending option opens the second page of the Edge Blending submenu Proj 1 2 Proj 1 1 Proj 1 2 ADVANCED EDGE BLENDING Use Edge Blending controls to set the precise width shape and midpoint you need to blend overlapping edges together smoothly Blend Width determines how much area is used for blending along an overlapping edge Slide bar values represent the number of eight pixel steps used for the blend For example a setting of eight creates a blended edge 24 pixels wide A setting of 0 signifies no blending For best results in most applications use a blend width of 16 48 steps 128 384 pixels NOTE Ranges 0 80 horizontal 0 60 vertical Blend Shape determines the rate of roll off across the blend width i e how quickly the white levels across the blend change from light and dark Increasing the Blend Shape setting accelerates the rate of change at both extremes so that less of the region appears mid gray see Figure 3 20 Decreasing the Blend Shape setting slows the rate of change so that more of the region
218. ting tilt ensure the projector is centered NOTE Check with site personnel for the degree of screen tilt or measure this incline with a protractor at the screen 2 Then tilt the projector to closely match the screen tilt angle by extending or retracting the projector s 3 adjustable feet NOTE 1 For an ideal installation the lens surface should be centered and parallel to the screen this orientation helps to ensure optimized lens performance with minimal offset Choose a sturdy mounting surface that allows for this If this position is not possible such as when the projector is significantly higher than the center of the screen it is better to rely on offset rather than extra tilt Basic Optical Alignment Only perform image alignment once the projector is fully assembled and powered up in its final location Basic image alignment ensures the image reflected from the DMDs is parallel to and well centered with the lens and screen This initial optical alignment is the foundation for optimizing images on the screen and must be completed before final boresight adjustments Before beginning ensure the projector is properly positioned relative to the screen Basic Optical Alignment Procedure 1 Display a test pattern Appropriate for analyzing image focus and geometry such as the framing test pattern showing the cross hair centered across the image Press the TEST key on the remote keypad or use the built in keypad and press the soft
219. to Section 3 Operation for detailed information To Add a DMX Channel Event 1 Click Add to open the RTE Wizard 2 Select the DMX Channel Event tab 3 Select a DMX channel DMX 56 to DMX 61 from the drop down list as shown in Figure Refer to Section 3 Operation for detailed information 4 3 8 About Tabbed Page CHRISTIE RTE Wizard Scheduled Event System Event GPIO Event Function Key Event DMX Channel Event GPIO Event Input Condition LJH X L X L x GI GPIO 1 PIO 7 Description Command String GPIO Output Helper Help El RTE G LHXLXLX EPDE FIGURE 4 19 GPIO EVENT Serial Representation RTE Wizard Scheduled Event System Event GPIO Event Function Key Event DMX Channel Event Function Key Event Func 1 Func 2 Func 3 Func 4 L Func 7 Func 8 Func 9 Command String r re Jutput Helper Help E Description Serial Representation Test FIGURE 4 20 FUNCTION KEY EVENT RTE Wizard Scheduled Event System Event GPIO Event Function Key Event DMX Channel Event DMX Channel Event Description Command String GPIO Output Helper Help Serial Representation FIGURE 4 21 DMX CHANNEL EVENT Provides information about the projector s software version model serial number and license information NOTE The information provided on the Version and License tabs are read only M Series User Manu
220. to first scroll through options or navigate within a menu pull down list or text box M Series User Manual 3 7 020 100009 04 Rev 1 10 2009 Section 3 Operation Lens H and Lens V CHRISTIE When adjusting the image for focus zoom or horizontal and vertical positioning use the specific arrow keys LEFT RIGHT ARROW KEY or UP DOWN ARROW KEY related to each function A small window will appear to indicate the type of adjustment taking place For example e Use the FOCUS and the LEFT ARROW or RIGHT ARROW KEY to improve image clarity as desired e Use the ZOOM and the LEFT ARROW or RIGHT ARROW KEY to achieve a desired image size e Use the LENS H and the LEFT ARROW or RIGHT ARROW KEY to position the image horizontally e Use the LENS V and the UP ARROW or DOWN ARROW KEY to position the image vertically Press EXIT to return to a presentation level NOTE Use the LENS key built in keypad with the general UP DOWN ARROW KEY to get the same effect as if using the arrow keys related to Lens V or Lens H on the Remote Keypad All 4 lens settings can be adjusted by using the soft keys Laser Press LASER to activate the laser pointer on the remote Point the remote at the screen to highlight an area of your presentation NOTE Leave batteries in the wired remote keypad for the LASER key to work 3 2 Navigating the Menus Main Menu Most of the projector controls are accessed from within the projector s menu system
221. too far from the eye will be illegible at a distance no matter how sharply and clearly it is displayed To fill a screen with an image the aspect ratio of the screen should be equal to the aspect ratio of the image expressed as the ratio of its width to its height Standard video from a VCR has a 4 3 or 1 33 1 aspect ratio For example to display a VCR output with a 4 3 aspect ratio onto a 10 foot 3m high screen the width of the screen must be at least 13 3 feet 4m Ambient Lighting The high brightness of this projector is well suited for locations where ambient lighting might be considered less than ideal A typical room with ceiling lights and windows rarely requires special attention Contrast ratio in your images will be reduced if stray light directly strikes the screen For example when a shaft of light from a window or floodlight falls on the image Images may appear washed out and less vibrant Avoid or eliminate stray light sources directed at the screen Ventilation The projector vents and louvers provide ventilation both for intake and exhaust Never block or cover these openings Do not install the projector near a radiator or heat register or within an enclosure To ensure adequate airflow around the projector allow free air exchange to the projector with a minimum clearance of 25cm 10 on the left right and rear sides of the projector from any walls or other obstructions NOTE Do not obstruct the air exchange to the
222. tor you can override this setting FILM MODE DETECT Enable or disable film motion detection Only available for interlaced or segmented frame sources e CHROMA LUMA DELAY Affects any incoming composite or S video signal delaying the luma signal intensity in relation to the chroma color In the image increasing the luma delay will move luma seen as a shadow where colors overlap to the right slightly with colors remaining in place Decreasing this delay will move the shadow slightly to the left If necessary for your current source adjust so that no shadows occur with adjacent colors ADAPTIVE CONTRAST Dynamically expands the contrast of the output image producing vibrant images with seamless response to scene changes and fades The slide bar adjusts the amount of adaptive contrast to apply with a setting of 0 producing no change Adaptive contrast is disabled when the Dynamic Iris is operating in Dynamic mode SPLIT SCREEN This control allows a snap shot of the main image to be presented on the right side or lower part of the screen to allow evaluation of advanced image processing features All resizing controls are honoured on both images However image processing controls such as Detail Sharpness Noise Reduction and Adaptive Contrast only happen on the left side or top image Changing inputs channels or test patterns will disable this control PIP operation must be disabled prior to enabling this control NOTE
223. trigger a 41 Yellow Notch Filter Z full field display of the corresponding color 12 Auto Color Enable 7 I 13 Color Enable Red 7 Alternatively use the Color Saturation 14 Copy From Max Drives B menu for these adjustments or to fine tune These coordinate adjustments move the three color points closer together see below to FIGURE 3 43 COLOR ADJUSTMENT establish a shared gamut attainable by all projectors in your group Adjust only as necessary to ensure that the resulting color palette is as large as possible When done you may need to adjust lamp power slightly 7 All screens should now be color matched Apply this new User gamut to a source at any time by selecting it in the Select Color Adjustment list accessed in the Advanced Image Settings menu Using the Color Saturation Menu for Color Matching To use the Color Saturation menu to match colors across multiple screens In the three Color Adjustment submenus Red Green Blue and White see right set all main values to 1000 and the secondary values to 0 if applicable Then judge by eye and adjust the slide bars as needed NOTE Adjustments here define new x y coordinates in the Color Adjustments by X Y menu For best results use this menu after doing the color adjustment procedure M Series User Manual 020 100009 04 Rev 1 10 2009 Red Color Adjustment 1 Select Color Adjustment User 1 2 Color Temperature 6500 mm By x y equival
224. troller and the RS 232 or RS 422 port recommended or open an Ethernet socket i e Telnet between your controller and the valid projector address Valid ASCII codes and messages are documented in the Christie Serial Communications document available at the Christie website VIA WEB INTERFACE Connect the PC to the projector s Ethernet port In the web browser 1 e Internet Explorer enter the IP address of the projector you wish to control This will prompt a login screen The default login ids are admin service and guest Up to a maximum of 3 users can connect at any given time Two users can use the same account to log in Each user will see a different set of tabs The default passwords can be edited by an administrator or a service user in the Admin tab Guest users will not see this tab Basic operations of the projector can be controlled from this interface and the Virtual OSD can be accessed from here Alarm Conditions An alarm condition consists of a message that is on the LCD display located beside the built in keypad see Section Figure 3 45 Example of Alarm Condition There are two types of alarm conditions e Warning Alarm e Critical Alarm A warning alarm is shown when an error or a non optimal condition has occurred That will generally not prevent the projector from operating An example is when a temperature is slightly elevated A critical alarm is shown when a condition occurs that could prevent the projector fr
225. ugh to fill the screen For example using a 0 73 1 lens throw distance would roughly be 0 73 x screen width IMPORTANT Use the lens and screen size to calculate the precise throw distance using the tables provided in the Dealer Section of the Christie Website PN 020 100221 XX Due to lens manufacturing tolerances for lens focal length actual throw distance can vary 5 between lenses with the same nominal throw ratio Measured to center of projector s front feet FIGURE 2 8 THROW DISTANCE Vertical and horizontal position The correct vertical and horizontal position of the projector in relation to the screen depends on the lens type and the screen size Ideally the projector should be positioned perpendicular to the screen This way the image will appear rectangular instead of keystoned trapezoidal The vertical position of the image can be offset that is moved above or below the optical axis by adjusting the motorized lens mount The amount of vertical offset available depends on the type of lens installed in the projector and can be limited if horizontal offset has been applied Vertical offset can be expressed as the percent of half the image height or the number of pixels of shift from lens center Refer to Figure 2 9 Vertical Offset Examples for illustrated examples of vertical offset Table 2 1 Table 2 2 and Table 2 3 specify the vertical offset of each type of lens 2 10 M Series User Manual 020 100009 04 Rev 1 1
226. urce still shows shimmer or noise after pixel tracking is optimized Pixel phase adjusts the phase of the pixel sampling clock relative to the incoming signal Adjust the slide bar until the image stabilizes and each pixel is clearly defined You may notice that you can stabilize the image at more than one point i e you may find that the image appearance at 11 is identical to the image appearance at 38 thus you can use either setting If some shimmer from a video or HDTV source persists use the Filter control to remove high frequency noise from the signal H POSITION Moves the image right or left within the area of available pixels NOTE The value shown represents where the approximate center of the image lies in relation to the total number of pixels available horizontally This varies widely according to the signal watch the image while adjusting V POSITION Moves the image up or down within the area of available pixels NOTE The value shown represents where the approximate center of the image lies in relation to the total number of pixels available vertically This varies widely according to the signal watch the image while adjusting KEEP ASPECT ON AUTO SETUP Ensures that auto setup for any source will maintain the input aspect ratio when the default size is calculated If disabled and the source is not a special case video source where a default stretch is defined the source is scaled to fit the platf
227. will operate as selected by the current channel which may be Off Manual or Dynamic This control is a global setting All other Dynamic Iris controls are applied to channels NOTES 1 Dynamic iris should not be used on blends as this could result in image distortion 2 Dynamic mode is only permitted in Dual lamp mode If the global setting is set to Per Channel while in Dual lamp mode then switching to Single Lamp Mode will ignore the channel settings and will grey out the Per Channel option and set the iris to 100 open If the Dynamic Iris mode is not changed then when switching back to Dual Lamp mode the iris setting will return to Per Channel If the Dynamic Iris mode is changed then when switching back to Dual Lamp mode the iris setting will remain at the current setting The user will have to specifically go and set it back to Per Channel IRIS POSITION Set the fixed manual iris position as a percentage of fully open MODE Set the Dynamic Iris Mode for the current channel Off will place the iris in a fully open position Manual mode allows the user to adjust the level of light to statically increase the black levels Dynamic mode allows the iris to open close based on the frame content and Dynamic Iris Settings control This will produce optimal black levels NOTE On DLV projector models the Dynamic mode of the iris is not available In Constant Intensity mode iris control is disabled on the menus In Cons
228. without Yellow Notch Filter Changing either or both of these numbers will change the hue of the color and relocate the triangle for possible colors For example changing the x y coordinates for red may move the color closer to orange or closer to violet which will in turn affect all displayed colors having a red component Adjust the slide bars or enter new specific coordinates as desired to define or change up to four User color gamuts needed for your environment and applications Apply at any time in the Advanced Image Settings menu M Series User Manual 020 100009 04 Rev 1 10 2009 CHAISTIE Section 3 Operation Factory Green Am Defined FIGURE 3 38 CIE 1931 CHROMATICITY DIAGRAM WITHOUT YELLOW NOTCH FILTER NOTE Keep new x y coordinates within the original color gamut triangle shown here COLOR SATURATION Submenu Adjust color slide bars and judge image color by eye or meter A user defined color adjustment can be applied by selecting it in the Advanced Image Settings menu select Color Adjustment Use this submenu if you do not have specific color coordinates in mind and will judge color performance by eye or meter Like the Color Adjustment by X Y submenu each color control actually defines new x y coordinates for that color and changes its hue Adjust the hue of each primary color red green blue and white by using more or less of it in relation to the other co
229. ws whether or not the projector physically connected to a keypad is listening to commands from that keypad A checkmark means that connected projector is listening if there is no checkmark you are communicating with a different projector To control a specific projector with the keypad press PROJ and then enter the three digit number assigned to the projector you want to use If you switch to a projector other than the one you are currently using the checkmark will disappear To broadcast to multiple projectors press PROJ and then PROJ again without entering a projector number Keypad commands will then effect all projectors present NOTE There is no method of controlling a group of projectors within the same wired configuration using the wired keypad exclusively since there is only one wired protocol available NOTE The projector s address can be set in the Configuration Menu gt Communications Submenu Enter Press ENTER to select a highlighted item to toggle a check box or to accept a parameter adjustment and return to the previous menu or image Exit Press EXIT to return to the previous level such as the previous menu NOTE EXIT does not save changes within text editing boxes including number editing of a slide bar value or within pull down lists It acts as a cancel in these cases Arrow Keys Use the LEFT RIGHT ARROW KEY to change a slide bar value or to select a different option within a pull down list without having
230. xample With Blanking FIGURE 3 25 BLANKING OF A PRIMARY IMAGE PIP Blanking Active Input Window 720x483 1 Top Blank 0 2 Bottom Blank 0 3 Left Blank 30 4 Right Blank 0 FIGURE 3 26 BLANKING OF A PIP IMAGE Image Settings Menu Use the Image Settings menu to alter your main image without affecting its size or position Changes made are applied immediately and are saved when you exit the menu press EXIT or MENU Options not available for the projector model or source are disabled and appear dim gray CONTRAST Contrast increases or decreases the perceived difference between light and dark areas of your image 0 100 NOOO WD 1400 Left PIP blanking Similar to a zoom function Image Settings Contrast Brightness Yellow Notch Filter Color Space Video Options Input Levels Advanced Image Settings Image E Blankin unus q pixels 50 0 m 50 0 mm Oo YPbPr SDTV Y FIGURE 3 27 IMAGE SETTINGS MENU For best results keep close to 50 For best results start with a low value and increase so that whites remain bright but are not distorted or tinted and that light areas do not become white NOTE If the environment lighting changes an adjustment of Gamma is recommended see below M Series User Manual 020 100009 04 Rev 1 10 2009 CHAISTIE Section 3 Operation BRIGHTNESS Increases or decreases the amount of black i
231. y access an adjustment during your presentation applies only to options having their own key such as Contrast Brightness Gamma etc For blind access hide the entire menu system see OSD key above and access using the proper sequence of key presses M Series User Manual 3 9 020 100009 04 Rev 1 10 2009 3 10 Slide bars in menus The current value for a given parameter such as size or vertical stretch appears to the left of its slide bar icon adjustment window This Filter SE number often expresses a percentage or it may have units associated with it such FiGure 3 6 EXAMPLE OF as pixels depending on the specific option Press LEFT RIGHT ARROW KEY to SLIDE BAR gradually adjust the setting up or down both the number and the length of the bar change accordingly Hold for continuous adjustment Or press ENTER to activate a slide bar text box for specific number entry via the keypad and then press ENTER to save or press EXIT to cancel Direct slide bars For quick access to Gamma Brightness and Contrast slide bars without traveling the menu system Press Gamma Brightness or Contrast to display the contrast slide bar Use the arrow keys to adjust a direct slide bar or press ENTER and enter a specific number from the keypad then ENTER or LEFT ARROW KEY or RIGHT ARROW KEY to save or EXIT to cancel When you are done press EXIT to save and return to your presentation NOTES 1 You can still adjust a
232. ypad Press and hold POWER OR e Press POWER twice OR e Press POWER once then immediately press the DOWN key NOTE For Step 2 and 3 if the second key is not pressed immediately a confirmation window will appear The second key press must be pressed within 1 second of the window appearing NOTE After powering down the Status LEDs cycle and the LCD displays the message Cooling Down until cool down is complete Web User Interface UI CHRISTIE 1 From the Main Tab Select Power gt OFF NOTE 4 Tools Admin About window will display for confirmation on powering iy sa sa down see Figure 2 18 Power On Lamp On Power Off 2h ee F Yes 1 No B Test Pattern Color Enable General FIGURE 2 18 POWERING DOWN WEB USER INTER M Series User Manual 2 19 020 100009 04 Rev 1 10 2009 2 2 9 Connecting Communications Remote Keypads To control the projector direct the projector s IR remote towards the display screen or the projector s IR sensors Alternatively connect a wired tethered version of the remote to the XLR connector labeled as WIRED KEYPAD on the projector s input panel NOTE The response to a wired keypad must also be enabled in the Communications menu see Section 4 Web User Interface for more information As an alternative to the projector s keypad or remote you may wish to communicate with the projector using a PC or other controller Such a device sends commands and re

Download Pdf Manuals

Related Search

Related Contents

Cámara Digital de Lentes Intercambiables Câmara Digital de  Micromax X252  ficheiro pdf  PRÉSENTATION ET « MODE D`EMPLOI » DE L`OUVRAGE  Machine à barbe à papa    Mode d` emploi    AireRyder LK40112AW Instructions / Assembly  Samsung ARN-CP153A User Manual  

Copyright © All rights reserved. Failed to retrieve file