Home

HMMER User's Guide - Eddy/Rivas Lab

image

Contents

1. Dx4i and Di Dx transitions are always zero probability and the final Dy gt Mz41 transition is always 0 0 probability 1 0 Finally the last line of the format is the record separator Stockholm the recommended multiple sequence alignment format The Pfam and Rfam Consortiums have developed a multiple sequence alignment format called Stockholm format that allows rich and extensible annotation Most popular multiple alignment file formats can be changed into a minimal Stockholm format file just by adding a Stockholm header line and a trailing terminator That is the first two lines after the optional COMPO line Don t be confused by the presence of an optional COMPO line here The COMPO line is placed in the model section below the residue column headers because it s an array of numbers much like residue scores but it s not really part of the model 105 STOCKHOLM 1 0 seql ACDEF GHIKL seq2 ACDEF GHIKL seq3 EFMNRGHIKL segl MNPOTVWY seq2 MNPOTVWY seq3 MNPOT Pe The first line in the file must be STOCKHOLM 1 x where x is a minor version number for the format specification and which currently has no effect on my parsers This line allows a parser to instantly identify the file format In the alignment each line contains a name followed by the aligned sequence A dash period un derscore or tilde but not whitespace denotes a gap If the alignment is too long t
2. ee ee eee Options Controlling Relative Weights 00002 eee eee OtherOptionSs 6 4s da e ii ee ed PM Vek A ge pt hmmalign align sequences to a profile HMM 0 0000 eee eee eee SINOPSIS 10 savy og Fete ee eter et a A EA A Fhe aetna DOSCHPUON x ic hh lp ee Wa a ake eh ho ee ee eee See ee as Options RA at yah ae te eee eon ee hmmbuild construct profile HMM s from multiple sequence alignment s SINOPSIS ra a a ci de Be ahaha a dace eb ke Ai ede nay id ia De SCription kk LN ca oe Bed be eg a lagar a are x Options A A teats ath on aNd Options for Specifying the Alphabet o o Options Controlling Profile Construction 0 0 00 0 eee ee ee ee Options Controlling Relative Weights 2 oo Options Controlling Effective Sequence Number 0000 00002 eee Options Controlling Priors 2 aa Options Controlling E value Calibration oaoa ee Other Options eri ie oes sees ty aie ro Dice fag woe a Gay aE ad Ra en ee eS es aie Poe hmmconvert convert profile file to a HMMER format o o SY NOPSIS Par att it da a O naa rad oat adh on NE a DESCUPUIOM nia ll ana Sete de af A Gr bp ae ee OPINAS sit scotia Sa A a ema een ey ave ies ao de ROP Pe aT ie h 8 Be hmmemit sample sequences from a profile HMM 0002 eee eee SINOPSIS Hjem oy chic a ia a a ok ee he ELL ara ee ee dee ee a DescrpliOr 2 ad ok SB Dice a
3. GS lt seqname gt lt tag gt lt s gt Per sequence annotation lt s gt is a free format text line of annotation type tag associated with the sequence named lt seqname gt For ex ample GS seql SPECIES_SOURCE Caenorhabditis elegans Can occur anywhere in the file but in single block formats e g the Pfam distribution will typically follow on the line after the sequence itself and in multi block formats e g HMMER output will typically occur in the header preceding the alignment but following the cr annotation GC lt tag gt lt s gt Per column annotation lt s gt is an aligned text line of annotation type lt tag gt GC lines are associated with a sequence alignment block lt s gt is aligned to the residues in the alignment block and has the same length as the rest of the block Typically Gc lines are placed at the end of each block GR lt seqname gt lt tag gt lt s gt Per residue annotation lt s gt is an aligned text line of annotation type lt tag gt associated with the sequence named lt seqname gt GR lines are associated with one sequence in a sequence alignment block lt s gt ls aligned to the residues in that sequence and has the same 106 length as the rest of the block Typically GR lines are placed immedi ately following the aligned sequence they annotate semantics of Stockholm markup Any Stockholm parser will accept syntactically correc
4. noali Omit the alignment section from the main output This can greatly reduce the output volume notextw Unlimit the length of each line in the main output The default is a limit of 120 characters per line which helps in displaying the output cleanly on terminals and in editors but can truncate target profile description lines textw lt n gt Set the main output s line length limit to lt n gt characters per line The default is 120 Options Controlling Reporting Thresholds Reporting thresholds control which hits are reported in output files the main output tblout and dfamtblout Hits are ranked by statistical significance E value E lt x gt Report target sequences with an E value of lt lt x gt The default is 10 0 meaning that on average about 10 false positives will be reported per query so you can see the top of the noise and decide for yourself if it s really noise T lt x gt Instead of thresholding output on E value instead report target sequences with a bit score of gt lt x gt Options for Inclusion Thresholds Inclusion thresholds are stricter than reporting thresholds Inclusion thresholds control which hits are con sidered to be reliable enough to be included in an output alignment or a subsequent search round or marked as significant as opposed to questionable in hit output incE lt x gt Use an E value of lt lt x gt as the inclusion threshold The defa
5. 0 0316434 0 0043048 0 00205688 expected 10783 3 0 02 expected 10783 3 0 02 expected 539 2 0 001 expected 5 4 le 05 actual number of targets Domain search space domZ 1108 number of targets reported over threshold CPU time 6 50u 0 11s 00 00 06 61 Elapsed 00 00 02 59 Mc sec 11014 32 This gives you some idea of what s going on in HMMER s acceleration pipeline You ve got one query HMM and the database has 539 165 target sequences Each sequence goes through a gauntlet of three scoring algorithms called MSV Viterbi and Forward in order of increasing sensitivity and increasing com putational requirement MSV the Multi ungapped Segment Viterbi algorithm essentially calculates the HMM equivalent of BLAST s sum score an optimal sum of ungapped high scoring alignment segments Unlike BLAST it does this calculation directly without BLAST s word hit or hit extension step using a SIMD vector parallel algorithm By default HMMER is configured to allow sequences with a P value of lt 0 02 through the MSV score filter thus if the database contained no homologs and P values were accurately calculated the highest scoring 2 of the sequences will pass the filter Here about 4 of the database got through the MSV filter A quick check is then done to see if the target sequence is obviously so biased in its composition that its unlikely to be a true homolog This is call
6. tformat lt s gt cpu lt n gt stall mpi Sets the sequence length in simulation that estimates the location parameter mu for Viterbi filter E values Default is 200 Sets the number of sequences in simulation that estimates the location parameter mu for Viterbi filter E values Default is 200 Sets the sequence length in simulation that estimates the location parameter tau for Forward E values Default is 100 Sets the number of sequences in simulation that estimates the location parameter tau for Forward E values Default is 200 Sets the tail mass fraction to fit in the simulation that estimates the location param eter tau for Forward evalues Default is 0 04 Turn off the null2 score corrections for biased composition Assert that the total number of targets in your searches is lt x gt for the purposes of per sequence E value calculations rather than the actual number of targets seen Assert that the total number of targets in your searches is lt x gt for the purposes of per domain conditional E value calculations rather than the number of targets that passed the reporting thresholds Seed the random number generator with lt n gt an integer gt 0 If lt n gt is gt 0 any stochastic simulations will be reproducible the same command will give the same results If lt n gt is 0 the random number generator is seeded arbitrarily and stochastic simulations will vary from run to run of the same comma
7. it s possible though rare to lose sequences utterly if they no longer even pass the reporting threshold s In the first round everything above the inclusion thresholds is marked with a and nothing is marked with 4If it is in the database it will almost certainly be included in the internal multiple alignment twice once because it s the query and once because it s a significant database match to itself This redundancy won t screw up the alignment because sequences are downweighted for redundancy anyway 27 a For example the top of this output looks like jackhmmer iteratively search a protein sequence against a protein database HMMER 3 1 February 2013 http hmmer org Copyright C 2011 Howard Hughes Medical Institute Freely distributed under the GNU General Public License GPLv3 a as a ee et ag Ge a li ee et ee a y e y a ts el ee de a query sequence file HBB_HUMAN target sequence database uniprot_sprot fasta per seq hits tabular output hbb jack tbl per dom hits tabular output hbb jack domtbl a SA e Aia A as ea a ta A A e Query HBB_HUMAN L 146 Description Human beta hemoglobin Scores for complete sequences score includes all domains full sequence best 1 domain dom E value score bias E value score bias exp N Sequence 3 3e 98 330 5 0 6 3 7e 98 330 3 0 6 1 0 1 sp P68871 HBB_HUMAN he 3 3e 98 330 5 0 6 3 7e 98 330 3 0 6 1 0 1 sp P68872 HBB_PANPA 3 3e 98 33
8. seed lt n gt w_beta lt x gt w_length lt n gt mpi Sets the number of sequences in simulation that estimates the location parameter mu for MSV filter E values Default is 200 Sets the sequence length in simulation that estimates the location parameter mu for Viterbi filter E values Default is 200 Sets the number of sequences in simulation that estimates the location parameter mu for Viterbi filter E values Default is 200 Sets the sequence length in simulation that estimates the location parameter tau for Forward E values Default is 100 Sets the number of sequences in simulation that estimates the location parameter tau for Forward E values Default is 200 Sets the tail mass fraction to fit in the simulation that estimates the location param eter tau for Forward evalues Default is 0 04 Set the number of parallel worker threads to lt n gt By default HMMER sets this to the number of CPU cores it detects in your machine that is it tries to maximize the use of your available processor cores Setting lt n gt higher than the number of available cores is of little if any value but you may want to set it to something less You can also control this number by setting an environment variable HM MER_NCPU This option is only available if HMMER was compiled with POSIX threads support This is the default but it may have been turned off for your site or machine for some reason Declare that the input msafil
9. E lt x gt T lt x gt domE lt x gt domT lt x gt In the per target output report target profiles with an E value of lt lt x gt The default is 10 0 meaning that on average about 10 false positives will be reported per query so you can see the top of the noise and decide for yourself if it s really noise Instead of thresholding per profile output on E value instead report target profiles with a bit score of gt lt x gt In the per domain output for target profiles that have already satisfied the per profile reporting threshold report individual domains with a conditional E value of lt lt x gt The default is 10 0 A conditional E value means the expected number of additional false positive domains in the smaller search space of those comparisons that already satisfied the per profile reporting threshold and thus must have at least one homologous domain already Instead of thresholding per domain output on E value instead report domains with a bit score of gt lt x gt Options for Inclusion Thresholds Inclusion thresholds are stricter than reporting thresholds Inclusion thresholds control which hits are con sidered to be reliable enough to be included in an output alignment or a subsequent search round In hmmscan which does not have any alignment output like hmmsearch or phmmer nor any iterative search steps like jackhmmer inclusion thresholds have little effect They only affect what
10. If this is titin about 40 000 residues it would require 57 6 GB of RAM For this reason currently phmmer and jackhmmer can only handle query sequences of up to a few thousand residues If you see a fatal exception error complaining about failure of a large memory allocation you re almost certainly seeing a prohibitive memory requirement at this stage In a tabular output tblout file the number of domains in envelopes before any significance thresh olding is in the column labeled dom This will generally be the same as the number of envelopes Biased composition score correction null2 An ad hoc biased composition score correction is calcu lated for each envelope using the posterior decoding A corrected bit score and P value for each envelope is calculated These null2 corrected scores are subjected to the reporting and inclusion thresholds at both the full sequence level and per domain Modifications to the pipeline as used for DNA search SSV not MSV In the MSV filter one or more high scoring ungapped segments contribute to a score that if sufficiently high casues the entire sequence to be passed on to the next stage the bias filter This strategy won t work for long DNA sequences it doesn t filter the human genome much to say there s a hit on chromosome 1 now process the whole thing In the scanning SSV Single ungapped Segment Viterbi algorithm used in nhmmer and nhmmscan each comparison
11. See below for the symfrac option This is the default Define consensus columns in next profile using reference annotation to the multiple alignment This allows you to define any consensus columns you like Define the residue fraction threshold necessary to define a consensus column when using the fast option The default is 0 5 The symbol fraction in each column is calculated after taking relative sequence weighting into account and ig noring gap characters corresponding to ends of sequence fragments as opposed to internal insertions deletions Setting this to 0 0 means that every alignment col umn will be assigned as consensus which may be useful in some cases Setting it to 1 0 means that only columns that include 0 gaps internal insertions deletions will be assigned as consensus We only want to count terminal gaps as deletions if the aligned sequence is known to be full length not if it is a fragment for instance because only part of it was sequenced HMMER uses a simple rule to infer fragments if the sequence length L is less than or equal to a fraction lt x gt times the alignment length in columns then the sequence is handled as a fragment The default is 0 5 Setting fragthreshO will define no nonempty sequence as a fragment you might want to do this if you know you ve got a carefully curated alignment of full length sequences Setting fragthresh7 will define all sequences as fragments you might want to do this
12. For each different tail mass a line is generated in the output tmin lt x gt Set the lower bound on the tail mass distribution The default is 0 02 for the default single tail mass tmax lt x gt Set the upper bound on the tail mass distribution The default is 0 02 for the default single tail mass tpoints lt n gt Set the number of tail masses to sample starting from tmin and ending at tmax The default is 1 for the default 0 02 single tail mass tlinear Sample a range of tail masses with uniform linear spacing The default is to use uniform logarithmic spacing Options Controlling H3 Parameter Estimation Methods H3 uses three short random sequence simulations to estimating the location parameters for the expected score distributions for MSV scores Viterbi scores and Forward scores These options allow these simula tions to be modified EmL lt n gt Sets the sequence length in simulation that estimates the location parameter mu for MSV E values Default is 200 EmN lt n gt Sets the number of sequences in simulation that estimates the location parameter mu for MSV E values Default is 200 EvL lt n gt Sets the sequence length in simulation that estimates the location parameter mu for Viterbi E values Default is 200 EvN lt n gt Sets the number of sequences in simulation that estimates the location parameter mu for Viterbi E values Default is 200 EfL lt n gt Sets the sequence lengt
13. W and Lipman D J 1997 Gapped BLAST and PSI BLAST A new generation of protein database search programs Nucl Acids Res 25 3389 3402 Barton G J 1990 Protein multiple sequence alignment and flexible pattern matching Meth Enzymol 183 403 427 Bashford D Chothia C and Lesk A M 1987 Determinants of a protein fold Unique features of the globin amino acid sequences J Mol Biol 196 199 216 Churchill G A 1989 Stochastic models for heterogeneous DNA sequences Bull Math Biol 51 79 94 Durbin R Eddy S R Krogh A and Mitchison G J 1998 Biological Sequence Analysis Probabilistic Models of Proteins and Nucleic Acids Cambridge University Press Cambridge UK Eddy S R 1996 Hidden Markov models Curr Opin Struct Biol 6 361 365 Eddy S R 1998 Profile hidden Markov models Bioinformatics 14 755 763 Eddy S R 2008 A probabilistic model of local sequence alignment that simplifies statistical significance estimation PLoS Comput Biol 4 e1000069 Eddy S R 2009 A new generation of homology search tools based on probabilistic inference Genome Inform 23 205 211 Eddy S R 2011 Accelerated profile HMM searches PLoS Comp Biol 7 e1002195 Finn R D Mistry J Tate J Coggill P Heger A Pollington J E Gavin O L Ceric G Forslund K Holm L Sonnhammer E L L Eddy S R and Bateman A 2010 The Pfam protein families databas
14. and can be turned into Stockholm format with a little editing or scripting Don t forget the stTocKHOLM 1 0 line at the start of the alignment nor the at the end Stockholm alignments can be concatenated to create an alignment database flatfile containing many alignments The hmmbuild command builds a profile HMM from an alignment or HMMs for each of many alignments in a Stockholm file and saves the HMM s in a file For example type gt hmmbuild globins4 hmm tutorial globins4 sto and you ll see some output that looks like hmmbuild profile HMM construction from multiple sequence alignments HMMER 3 1 February 2013 http hmmer org Copyright C 2011 Howard Hughes Medical Institute Freely distributed under the GNU General Public License GPLv3 S A A a a A SS a AA A E a ld ES e ne AER oe input alignment file globins4 sto output HMM file globins4 hmm A Pra A a A A A kg A OA A e e os e or Moh ES idx name nseq alen mlen eff_nseq re pos description A ASS A A A A a ae ee ee ISA See ee eee 1 globins4 4 171 149 0 96 0 589 CPU time 0 24u 0 00s 00 00 00 24 Elapsed 00 00 00 27 If your input file had contained more than one alignment you d get one line of output for each model For instance a single hmmbuild command suffices to turn a Pfam seed alignment flatfile such as P fam A seed into a profile HMM flatfile such as Pfam hmm The information on these lines is almost self explanatory The
15. if you know your alignment is entirely composed of fragments such as translated short reads in metagenomic shotgun data Options Controlling Relative Weights HMMER uses an ad hoc sequence weighting algorithm to downweight closely related sequences and up weight distantly related ones This has the effect of making models less biased by uneven phylogenetic representation For example two identical sequences would typically each receive half the weight that one sequence would These options control which algorithm gets used wpb wgsc wblosum wnone wid lt x gt Use the Henikoff position based sequence weighting scheme Henikoff and Henikoff J Mol Biol 243 574 1994 This is the default Use the Gerstein Sonnhammer Chothia weighting algorithm Gerstein et al J Mol Biol 235 1067 1994 Use the same clustering scheme that was used to weight data in calculating BLO SUM subsitution matrices Henikoff and Henikoff Proc Natl Acad Sci 89 10915 1992 Sequences are single linkage clustered at an identity threshold default 0 62 see wid and within each cluster of c sequences each sequence gets rela tive weight 1 c No relative weights All sequences are assigned uniform weight Sets the identity threshold used by single linkage clustering when using wblosum Invalid with any other weighting scheme Default is 0 62 56 Options Controlling Effective Sequence Number After relative weights are dete
16. in a consensus column or nothing in an insert column The SAM software parses only a subset of legal ambiguity codes for amino acids and nucleotides For amino acids it only reads BXZ in addition to the 20 standard one letter codes For nucleotides it only reads NRY in addition to ACGTU With one crucial exception it treats all other letters as X or N The crucial exception is O SAM reads an O as the position of a free insertion module FIM a concept specific to SAM style profile HMMs This has no impact on nucleic acid sequences where O is not a legal character But in amino acid sequences O means pyrrolysine one of the unusual genetically encoded amino acids This means that A2M format alignments must not contain pyrrolysine residues lest they be read as FIMs For this reason Easel converts O residues to X when it writes an amino acid alignment in A2M format Determining consensus columns Writing A2M format requires knowing which alignment columns are supposed to be considered consensus and which are considered inserts If the alignment was produced by HMMER or Infernal then the alignment has so called reference annotation what appears as a GC RF line in Stockholm format marking the consensus columns Often an alignment has no reference annotation for example if it has been read from an alignment format that has no reference annotation line only Stockholm and SELEX format
17. profile vs sequence comparison depending on how you do the search For domain there then follows a domain table and alignment output just as in hmmsearch The fn3 annotation for example looks like Domain annotation for each model and alignments gt gt fn3 Fibronectin type III domain score bias c Evalue i Evalue hmmfrom hmm to alifrom ali to envfrom env to acc 1 S133 0 0 0 33 0 5 61 TA ate 396 409 395 AL 1 085 2 40 7 0 0 2 6e 14 3 8e 14 2 84 439 DZO e 437 521 0 95 Sect 14 4 0 0 4 1e 06 6 1e 06 13 8 es 836 913 dns 826 914 ve 073 4 Sal 0 0 0 0032 0 0048 10 SOLA a 1209 123 ak 1203 A MS 0 F By A 24 3 0 0 3 4e 09 5e 09 14 80 6 1313 1380 1304 1386 0 82 6 0 0 0 0 013 0 19 58 WD LIA 1754 1768 1739 1769 0 89 eg 47 2 0 9 2 3e 16 3 5e 16 1 85 1799 1890 as 1799 B91 es 05 91 8 17 8 0 0 3 7e 07 5 5e 07 6 TA vac 1904 1966 1901 1976 0 90 Gl 12 8 0 0 1 3e 05 2e 05 1 86 1993 2107 1993 210 T gt 3 5 07 89 and an example alignment of that second domain again domain 2 score 40 7 bits conditional E value 2 6e 14 CEEEEEEECTTEEEEEEE S SS SEEEEEEEETTTCCGCEEEEEETTTSEEEEES TT EEEEEEEEEETTEE E CS fn3 2 saPenlsvsevtstsltlsWsppkdgggpitgYeveyqekgegeewgevtvprtttsvtltgLepgteYefrVqavngagegp 84 saP 1 4 W p tgpitgY t e vpt s L gt Y n gegp 7LESS_DROME 439 SAPVIEHLMGLDDSHLAVHWHPGRFTNGPIEGYRLRLSSSEGNA TSEOLVPAGRGSYIFSOLOAGTNYTLALSMINKOGEGP 520 78999999999 KKK
18. 0 use an arbitrary seed so different hmmemit runs will generate different samples 62 hmmfetch retrieve profile HMM s from a file Synopsis hmmfetch options lt hmmtfile gt lt key gt retrieves HMM named lt key gt hmmfetch f foptions lt hmmfile gt lt keyfile gt retrieves all HMMs listed in lt keyfile gt hmmfetch index options lt hmmfile gt indexes lt hmmfile gt for fetching Description Quickly retrieves one or more profile HMMs from an lt hmmfile gt a large Pfam database for example For maximum speed the lt hmmfile gt should be indexed first using hmmfetch index The index is a binary file named lt hmmfile gt ssi However this is optional and retrieval will still work from unindexed files albeit much more slowly The default mode is to retrieve a single profile by name or accession called the lt key gt For example hmmfetch Pfam A hmm Caudal_act hmmfetch Pfam A hmm PF00045 With the f option a lt keyfile gt containing a list of one or more keys is read instead The first whitespace delimited field on each non blank non comment line of the lt keyfile gt is used as a lt key gt and any remaining data on the line is ignored This allows a variety of whitespace delimited datafiles to be used as lt keyfile gt s When using f and a lt keyfile gt if hmmfile has been indexed the keys are retrieved in the order they occur in the keyfile but if hmmfile isn t indexed keys
19. 4 47826 3 59727 51142 88373 57593 35205 19259 2 68634 4 42241 2 77536 2 73098 3 46370 2 40469 STELA 29370 67757 69331 24706 022163 101553 1 50361 0 25145 0 00000 The HMMER ASCII save file format is defined in Section 8 Step 2 search the sequence database with hmmsearch Presumably you have a sequence database to search Here we ll use the UniProt 2013 02 Swiss Prot FASTA format flatfile not provided in the tutorial because of its large size uniprot_sprot fasta If you don t have a sequence database handy run your example search against tutorial globins45 fa instead which is a FASTA format file containing 45 globin sequences hmmsearch accepts any FASTA file as target database input It also accepts EMBL UniProt text format and Genbank format It will automatically determine what format your file is in you don t have to say An example of searching a sequence database with our globins4 hmm model would look like gt hmmsearch globins4 hmm uniprot _sprot fasta gt globins4 out Depending on the database you search the output file globins4 out should look more or less like the example of a UniProt search output provided in tutorial globins4 out The first section is the header that tells you what program you ran on what and with what options hmmsearch search profile s against a sequence database HMMER 3 1 February 2013 http hmmer org Copyright C 2011 Howard Hughes Medical Institute Freel
20. Backward parser results This number should be about 1 we expect each region to contain one local alignment to the profile In a tabular output tblout file the number of discrete regions identified by this posterior decoding step is in the column labeled reg It ought to be almost the same as the expectation exp If it is not there may be something funny going on like a tandem repetitive element in the target sequence which can produce so many overlapping weak hits that the sequence appears to be a significant hit with lots of domains expected somewhere but the probability is fuzzed out over the repetitive region and few or no good discrete alignment regions can be identified Envelope identification Now within each region we will attempt to identify envelopes An envelope is a subsequence of the target sequence that appears to contain alignment probability mass for a likely domain one local alignment to the profile When the region contains 1 expected domain envelope identification is already done the region s start and end points are converted directly to the envelope coordinates of a putative domain There are a few cases where the region appears to contain more than one expected domain where more than one domain is closely spaced on the target sequence and or the domain scores are weak and the probability masses are ill resolved from each other These multidomain regions when they occur are passed off to an even more
21. GHIKLMNPOTVWY seq3 EFmnrGHIKLMNPOT 108 is encoded in A2M format as gt seql Sequence 1 description ACDEFGHIKLMNPOTVWY gt seq2 Sequence 2 description ACDEFGHIKLMNPOTVWY gt seq3 Sequence 3 description EFmnrGHIKLMNPQT A2M format looks a lot like aligned FASTA format A crucial difference is that the aligned sequences in a dotless A2M file do not necessarily all have the same number of characters The format distinguishes between consensus columns where residues are in upper case and gaps are a dash and insert columns where residues are in lower case and gaps are dots that aren t explicitly shown in the for mat hence dotless A2M The position and number of gaps in insert columns dots is implicit in this representation An advantage of this format is its compactness This representation only works if all insertions relative to consensus are considered to be unaligned characters That is how insertions are handled by profile HMM implementations like SAM and HMMER and profile SCFG implementations like Infernal Thus every sequence must have the same number of consensus columns upper case letters plus characters and may have additional lower case letters for insertions Legal characters ek A2M and SAM do not support some special characters such as the not a residue or missing data characters Easel outputs these characters as gaps either
22. Surface accessibility consensus See Gc SA cons above PP Posterior probability for an aligned residue This represents the probability that this residue is assigned to the HMM state corresponding to this alignment column as opposed to some other state Note that a residue can be confidently unaligned a residue in an insert state or flanking N or C state may have high posterior probability The posterior probability is encoded as 11 possible characters 0 9 0 0 lt p lt 0 05 is coded as 0 0 05 lt p lt 0 15 is coded as 1 and so on 0 85 lt p lt 0 95 is coded as 9 and 0 95 lt p lt 1 0 is coded as Gap characters appear in the PP line where no residue has been assigned A2M multiple alignment format HMMER s Easel library routines are capable of writing alignments in UC Santa Cruz A2M alignment to model format the native input format for the UCSC SAM profile HMM software package To select A2M format use the format code a2m for example to reformat a Stockholm alignment to A2M gt esl reformat a2m myali sto Easel currently does not read A2M format and it currently only writes in what UCSC calls dotless A2M format The most official documentation for A2M format appears to be at http compbio soe ucsc edu a2m desc htm1l You may refer to that document if anything in the brief description below is unclear An example A2M file This alignment seql ACDEF GHIKLMNPOTVWY seq2 ACDEF
23. a single sequence query model to lt x gt The default is 0 02 lt x gt must be gt 0 and lt 0 5 pextend lt x gt Set the gap extend probability for a single sequence query model to lt x gt The default is 0 4 lt x gt must be gt 0 and lt 1 0 mx lt s gt Obtain residue alignment probabilities from the built in substitution matrix named lt s gt Several standard matrices are built in and do not need to be read from files The matrix name lt s gt can be PAM30 PAM70 PAM120 PAM240 BLOSUM45 BLOSUM50 BLOSUM62 BLOSUM80 or BLOSUM90 Only one of the mx and mxfile options may be used mxfile lt mxfile gt Obtain residue alignment probabilities from the substitution matrix in file lt mxfile gt The default score matrix is BLOSUME62 this matrix is internal to HMMER and does not have to be available as a file The format of a substitution matrix lt mxfile gt is the standard format accepted by BLAST FASTA and other sequence analysis software Options Controlling Reporting Thresholds Reporting thresholds control which hits are reported in output files the main output tblout and domtblout In each iteration sequence hits and domain hits are ranked by statistical significance E value and output is generated in two sections called per target and per domain output In per target output by default all se quence hits with an E value lt 10 are reported In the per domain output for each target that h
24. about 40 seconds Step 2 compress and index the flatfile with hmmpress The hmmscan program has to read a lot of profile HMMs in a hurry and HMMER s ASCII flatfiles are bulky To accelerate this hmmscan uses binary compression and indexing of the flatfiles To use hmmscan you must first compress and index your HMM database with the hmmpress program gt hmmpress minifam This will quickly produce Working done Pressed and indexed 3 HMMs 3 names and 2 accessions Models pressed into binary file minifam h3m SSI index for binary model file minifam h3i Profiles MSV part pressed into minifam h3f Profiles remainder pressed into minifam h3p and you ll see these four new binary files in the directory The tutorial minifam example has already been pressed so there are example binary files tutorial minifam h3 m i f p included in the tutorial Their format is proprietary which is an open source term of art that means both I haven t found time to document them yet and I still might decide to change them arbitrarily without telling you Step 3 search the HMM database with hmmscan Now we can analyze sequences using our HMM database and hmmscan For example the receptor tyrosine kinase 7LESS_DRoME not only has all those fibronectin type III domains on its extracellular face it s got a protein kinase domain on its intracellular face Our mini fam database has models of both n3 and Pkinase as well
25. ad hoc resolution algorithm called stochastic traceback clustering In stochastic traceback clustering we sample many alignments from the posterior alignment ensemble cluster those alignments according to their overlap in start end coordinates and pick clusters that sum up to sufficiently high probability Consensus start and end points are chosen for each cluster of sampled alignments These start end points define envelopes These envelopes identified by stochastic traceback clustering are not guaranteed to be nonoverlapping It s possible that there are alternative solutions for parsing the sequence into domains when the correct parsing is ambiguous HMMER will report all high likelihood solutions not just a single nonoverlapping parse Its also possible though rare for stochastic clustering to identify no envelopes in the region In a tabular output tb1out file the number of regions that had to be subjected to stochastic traceback clustering is given in the column labeled clu This ought to be a small number often it s zero The number of envelopes identified by stochastic traceback clustering that overlap with other envelopes is in the column labeled ov If this number is non zero you need to be careful when you interpret the details of alignments in the output because HMMER is going to be showing overlapping alternative solutions The total number of domain envelopes identified either by the simple method or by stochastic tr
26. also reproducible results A choice of 0 uses an arbitrarily chosen seed Assert that the query sequence file is in format lt s gt Accepted formats include fasta embl genbank ddbj uniprot stockholm pfam a2m and afa The default is to autodetect the format of the file Window length tail mass The upper bound W on the length at which nhmmer ex pects to find an instance of the model is set such that the fraction of all sequences generated by the model with length gt W is less than lt x gt The default is 1e 7 This flag may be used to override the value of W established for the model by hmmbuild Override the model instance length upper bound W which is otherwise controlled by w_beta It should be larger than the model length The value of W is used deep in the acceleration pipeline and modest changes are not expected to impact results though larger values of W do lead to longer run time This flag may be used to override the value of W established for the model by hmmbuild Only search the top strand By default both the query sequence and its reverse complement are searched Only search the bottom reverse complement strand By default both the query sequence and its reverse complement are searched Set the number of parallel worker threads to lt n gt By default HMMER sets this to the number of CPU cores it detects in your machine that is it tries to maximize the use of your available processor cores Setti
27. and aligned are the same thing a one to one correspondence between a residue and a consensus match state in the model But there may be one or more residues assigned to the same insert state Don t be confused by the unaligned nature of profile HMM insertions You re sure to see cases where lower case inserted residues are obviously misaligned This is just because HMMER isn t trying to align them in the first place it is assigning them to unaligned insertions Enough about the sequences in the alignment Now notice all those pp annotation lines That s posterior probability annotation as in the single sequence alignments that hmmscan and hmmsearch showed This essentially represents the confidence that each residue is assigned where it should be 7By default hmmalign removes any columns that are all deletion characters so the number of apparent match columns in a displayed alignment is lt the actual number of match states in the profile To prevent this trimming and see columns for all match states use the allcol option This can be helpful if you re writing some postprocessor that s trying to keep track of what columns are assigned to what match states in the profile 8A2M format is the exception 35 Again that s assigned not aligned The posterior probability assigned to an inserted residue is the probability that it is assigned to the insert state that corresponds to that column Because the same ins
28. and optional description The most important number here is the first one the sequence E value This is the statistical significance of the match to this sequence the number of hits we d expect to score this highly in a database of this size if the database contained only nonhomologous random sequences The lower the E value the more significant the hit The E value is based on the sequence bit score which is the second number This is the log odds score for the complete sequence Some people like to see a bit score instead of an E value because the bit score doesn t depend on the size of the sequence database only on the profile HMM and the target sequence The next number the bias is a correction term for biased sequence composition that has been applied to the sequence bit score For instance for the top hit wyc_pxyca that scored 222 7 bits the bias of 3 2 bits means that this sequence originally scored 225 9 bits which was adjusted by the slight 3 2 bit biased composition correction The only time you really need to pay attention to the bias value is when it s large on the same order of magnitude as the sequence bit score Sometimes rarely the bias correction isn t aggressive enough and allows a non homolog to retain too much score Conversely the bias correction can be too aggressive sometimes causing you to miss homologs You can turn the biased composition score correction off with the nonu112 option and if you re doin
29. as the per domain inclusion threshold in targets that have already satisfied the overall per target inclusion threshold The default is 0 01 incdomT lt x gt Instead of using E values use a bit score of gt lt x gt as the per domain inclusion threshold By default this option is unset Options Controlling the Acceleration Pipeline HMMERS searches are accelerated in a three step filter pipeline the MSV filter the Viterbi filter and the Forward filter The first filter is the fastest and most approximate the last is the full Forward scoring algo rithm slowest but most accurate There is also a bias filter step between MSV and Viterbi Targets that pass all the steps in the acceleration pipeline are then subjected to postprocessing domain identification and scoring using the Forward Backward algorithm Essentially the only free parameters that control HMMER s heuristic filters are the P value thresholds controlling the expected fraction of nonhomologous sequences that pass the filters Setting the default thresholds higher will pass a higher proportion of nonhomologous sequence increasing sensitivity at the expense of speed conversely setting lower P value thresholds will pass a smaller proportion decreasing sensitivity and increasing speed Setting a filter s P value threshold to 1 0 means it will passing all sequences and effectively disables the filter Changing filter thresholds only removes or includes targets from consider
30. between a query and target is scanned for high scoring ungapped alignment segments and a window around each such segment is extracted merging overlapping windows Each window is then passed on to the remaining filter cascade where it is for the most part treated as described above As with the MSV filter the default P value threshold is 0 02 and can be controlled with the F1 flag The max flag also controls the amount of the sequence database that passes the SSV filter but instead of the threshold being set to 1 0 as described for the protein pipeline it is set to 0 4 There are no domains but there are envelopes In HMMER s protein search programs multiple matches of the model to a target sequence are treated as domains contained within a single hit for that sequence In the DNA search programs each match of the model to a subsequence is treated as an independent hit there s no notion of a domain This is largely a difference in reporting both pipelines rely on essentially the same envelope detection code envelopes lead to domains in protein search and hits in DNA search Biased composition DNA sequence is littered with regions containing tandem simple repeats or other low complexity sequence Without accounting for such composition bias we see many cases in which one part of a hit is obviously legitimate and serves as the anchor for a neighboring alignment segment that is clearly low complexity garbage one form of a pro
31. but assuming an edge corrected lambda using current procedures in H3 Eddy 2008 and 4 using both parameters determined by H3 s current procedures The standard simple quick and dirty statistic for goodness of fit is E 10 the calculated E value of the 10th ranked top hit which we expect to be about 10 In detail the columns of the output are name Name of the model tailp Fraction of the highest scores used to fit the distribution For Viterbi MSV and Hybrid scores this defaults to 1 0 a Gumbel distribution is fitted to all the data For Forward scores this defaults to 0 02 an exponential tail is fitted to the highest 2 scores mu tau Location parameter for the maximum likelihood fit to the data lambda Slope parameter for the maximum likelihood fit to the data E 10 The E value calculated for the 10th ranked high score E 10 using the ML mu tau and lambda By definition this expected to be about 10 if E value esti mation were accurate mufix Location parameter for a maximum likelihood fit with a known fixed slope param eter lambda of log_2 0 693 E 10fix The E value calculated for the 10th ranked score using mufix and the expected lambda log_2 0 693 mufix2 Location parameter for a maximum likelihood fit with an edge effect corrected lambda 76 E 10fix2 pmu plambda pE 10 The E value calculated for the 10th ranked score using mufix2 and the edge effect corrected lambda Locat
32. but it is almost always smaller than that The default entropy weighting method eent reduces the effective sequence num ber to reduce the information content relative entropy or average expected score on true homologs per consensus position The target relative entropy is controlled by a two parameter function where the two parameters are settable with ere and esigma eent Adjust effective sequence number to achieve a specific relative entropy per position see ere This is the default eclust Set effective sequence number to the number of single linkage clusters at a spe cific identity threshold see eid This option is not recommended it s for experi ments evaluating how much better eent is enone Turn off effective sequence number determination and just use the actual number of sequences One reason you might want to do this is to try to maximize the relative entropy position of your model which may be useful for short models eset lt x gt Explicitly set the effective sequence number for all models to lt x gt ere lt x gt Set the minimum relative entropy position target to lt x gt Requires eent Default depends on the sequence alphabet for protein sequences it is 0 59 bits position esigma lt x gt Sets the minimum relative entropy contributed by an entire model alignment over its whole length This has the effect of making short models have higher relative entropy per position than ere
33. database Synopsis hmmescan options lt hmmdb gt lt seqfile gt Description hmmscan is used to search protein sequences against collections of protein profiles For each sequence in lt seqfile gt use that query sequence to search the target database of profiles in lt hmmdb gt and output ranked lists of the profiles with the most significant matches to the sequence The lt seqfile gt may contain more than one query sequence It can be in FASTA format or several other common sequence file formats genbank embl and uniprot among others or in alignment file formats stockholm aligned fasta and others See the gformat option for a complete list The lt hmmdb gt needs to be press ed using hmmpress before it can be searched with hmmscan This creates four binary files suffixed h3 fimp The query lt seqfile gt may be a dash character in which case the query sequences are read from a lt stdin gt pipe instead of from a file The lt hmmdb gt cannot be read from a lt stdin gt stream because it needs to have those four auxiliary binary files generated by hmmpress The output format is designed to be human readable but is often so voluminous that reading it is impractical and parsing it is a pain The tblout and domtblout options save output in simple tabular formats that are concise and easier to parse The o option allows redirecting the main output including throwing it away in dev null Option
34. description of target The remainder of the line is the target s description line as free text tblout fields for DNA search programs In the DNA search programs there is less concentration on domains and more focus on presenting the hit ranges Each line consists of 15 space delimited fields followed by a free text target sequence description as follows 1 2 3 4 5 6 7 8 9 10 11 12 13 target name The name of the target sequence or profile accession The accession of the target sequence or profile or if none query name The name of the query sequence or profile accession The accession of the query sequence or profile or if none hmmfrom The position in the hmm at which the hit starts hmm to The position in the hmm at which the hit ends alifrom The position in the target sequence at which the hit starts ali to The position in the target sequence at which the hit ends envfrom The position in the target sequence at which the surrounding envelope starts env to The position in the target sequence at which the surrounding envelope ends sq len The length of the target sequence strand The strand on which the hit was found when alifrom ali to E value The expectation value statistical significance of the target as above 45 14 score full sequence The score in bits for this hit It includes the biased composition correc tion 15 Bias fu
35. different profiles have slightly different expected score distributions Options for Model specific Score Thresholding Curated profile databases may define specific bit score thresholds for each profile superseding any thresh olding based on statistical significance alone To use these options the profile must contain the appropriate GA TC and or NC optional score threshold annotation this is picked up by hmmbuild from Stockholm format alignment files For a nucleotide model each thresholding option has a single per hit threshold lt x gt This acts as if T lt x gt incT lt x gt has been applied specifically using each model s curated thresholds cut_ga Use the GA gathering bit score threshold in the model to set per hit reporting and inclusion thresholds GA thresholds are generally considered to be the reli able curated thresholds defining family membership for example in Dfam these thresholds are applied when annotating a genome with a model of a family known to be found in that organism They may allow for minimal expected false discovery rate 94 cut_nc cut_tc Use the NC noise cutoff bit score threshold in the model to set per hit reporting and inclusion thresholds NC thresholds are less stringent than GA in the context of Pfam they are generally used to store the score of the highest scoring known false positive Use the NC trusted cutoff bit score threshold in the model to set per hit reporting and i
36. domains that were found in the 7LESS_DRomE sequence The single best dom score and E value are the bit score and E value as if the target sequence only contained the single best scoring domain without this summation The idea is that we might be able to detect that a sequence is a member of a multidomain family because it contains multiple weakly scoring domains even if no single domain is solidly significant on its own On TThe method that HMMER uses to compensate for biased composition is unpublished We will write it up when there s a chance 21 the other hand if the target sequence happened to be a piece of junk consisting of a set of identical internal repeats and one of those repeats accidentially gives a weak hit to the query model all the repeats will sum up and the sequence score might look significant which mathematically alas is the correct answer the null hypothesis we re testing against is that the sequence is a random sequence of some base composition and a repetitive sequence isn t random So operationally e if both E values are significant lt lt 1 the sequence is likely to be homologous to your query e if the full sequence E value is significant but the single best domain E value is not the target sequence is probably a multidomain remote homolog but be wary and watch out for the case where it s just a repetitive sequence OK the sharp eyed reader asks if that s so then why in
37. expected to pass the filter F2 lt x gt Set the P value threshold for the Viterbi filter step The default is 0 001 F3 lt x gt Set the P value threshold for the Forward filter step The default is 1e 5 nobias Turn off the bias filter This increases sensitivity somewhat but can come at a high cost in speed especially if the query has biased residue composition such as a repetitive sequence region or if it is a membrane protein with large regions of hydrophobicity Without the bias filter too many sequences may pass the filter with biased queries leading to slower than expected performance as the compu tationally intensive Forward Backward algorithms shoulder an abnormally heavy load 74 Other Options nonull2 Z lt x gt domZ lt x gt seed lt n gt tformat lt s gt cpu lt n gt stall mpi Turn off the null2 score corrections for biased composition Assert that the total number of targets in your searches is lt x gt for the purposes of per sequence E value calculations rather than the actual number of targets seen Assert that the total number of targets in your searches is lt x gt for the purposes of per domain conditional E value calculations rather than the number of targets that passed the reporting thresholds Set the random number seed to lt n gt Some steps in postprocessing require Monte Carlo simulation The default is to use a fixed seed 42 so that results a
38. f gt rather than to stdout O lt f After each model is constructed resave annotated possibly modified source align ments to a file lt f in Stockholm format The alignments are annotated with a reference annotation line indicating which columns were assigned as consensus and sequences are annotated with what relative sequence weights were assigned Some residues of the alignment may have been shifted to accommodate restric tions of the Plan7 profile architecture which disallows transitions between insert and delete states Options for Specifying the Alphabet The alphabet type amino DNA or RNA is autodetected by default by looking at the composition of the msafile Autodetection is normally quite reliable but occasionally alphabet type may be ambiguous and autodetection can fail for instance on tiny toy alignments of just a few residues To avoid this or to increase robustness in automated analysis pipelines you may specify the alphabet type of msafile with these options amino Specify that all sequences in msafile are proteins dna Specify that all sequences in msafile are DNAs rna Specify that all sequences in msafile are RNAs 55 Options Controlling Profile Construction These options control how consensus columns are defined in an alignment fast hand symfrac lt x gt fragthresh lt x gt Define consensus columns as those that have a fraction gt symfrac of residues as opposed to gaps
39. file Only one input source can come through lt stdin gt not both An exception is that if the lt segfile gt contains more than one query sequence then lt seqdb gt cannot come from lt stdin gt because we can t rewind the streaming target database to search it with another query The output format is designed to be human readable but is often so voluminous that reading it is impractical and parsing it is a pain The tblout and domtblout options save output in simple tabular formats that are concise and easier to parse The o option allows redirecting the main output including throwing it away in dev null Options h Help print a brief reminder of command line usage and all available options Options for Controlling Output O lt f gt Direct the main human readable output to a file lt f gt instead of the default stdout A lt f gt Save a multiple alignment of all significant hits those satisfying inclusion thresh olds to the file lt f gt in Stockholm format tblout lt f gt Save a simple tabular space delimited file summarizing the per target output with one data line per homologous target sequence found domtblout lt f gt Save a simple tabular space delimited file summarizing the per domain output with one data line per homologous domain detected in a query sequence for each homologous model acc Use accessions instead of names in the main output where available for profiles and or sequence
40. files being created 63 index Instead of retrieving one or more profiles from lt hmmfile gt index the lt hmmfile gt for future retrievals This creates a lt hmmfile gt ssi binary index file 64 hmmpgmd daemon for searching a protein query against a protein database Synopsis hmmpgmd options Description The hmmpgmd program is the daemon that we use internally for the hmmer org web server and es sentially stands in front of the protein search programs phmmer hmmsearch and hmmscan To use hmmpgma first an instance must be started up as a master server and provided with at least one of a sequence database using the seqdb flag and or an HMM database using the hmmdb flag A se quence database must be in the hmmpgmd format which may be produced using esl reformat An HMM database is of the form produced by hmmbuild The input database s will be loaded into memory by the master When the master has finished loading the database s it prints the line Data loaded into memory Master is ready Only after master is ready one or more instances of hmmpgmd may be started as workers These workers may be and typically are on different machines from the master but must have access to the same database file s provided to the master with the same path As with the master each worker loads the database s into memory and indicates completion by printing Data loaded into memory Worker is ready The master ser
41. formats to from HMMER3 format hmmemit Generate sample sequences from a profile HMM hmmfetch Get a profile HMM by name or accession from an HMM database hmmpress Format an HMM database into a binary format for hmmscan hmmstat Show summary statistics for each profile in an HMM database The quadrumvirate of hmmbuild hmmsearch hmmscan hmmalign is the core functionality for protein do main analysis and annotation pipelines for instance using profile databases like Pfam or SMART The phmmer and jackhmmer programs search a single protein sequence against a protein sequence database akin to BLASTP and PSIBLAST respectively Internally they just produce a profile HMM from the query sequence then run HMM searches The pair nhmmer nhmmscan are new to HMAMER3 1 The program nhmmer can search against a DNA sequence database with a query of a prebuilt HMM built using hmmbuild a multiple sequence alignment or a single sequence The program nhmmscan can search an HMM database with a DNA sequence query The program hmmpgmd is also new to HMMER3 1 It is the daemon that we use internally for the hm mer org web server and essentially stands in front of the protein search tools phmmer hmmsearch and hmmscan As a daemon it starts up loads the target database into memory then performs searches against that database as requested by client programs In the Tutorial section we ll show examples of running each of these programs using examples in th
42. g PF followed by a unique numerical accession One word Unique in file DE lt s gt Description lt s gt is a free format line giving a description of the alignment e g RNA recogni tion motif proteins One line Unique in file AU lt s gt Author lt s gt is a free format line listing the authors responsible for an alignment e g Bateman A One line Unique in file GA lt f gt lt f v Gathering thresholds Two real numbers giving HMMER bit score per sequence and per domain cutoffs used in gathering the members of Pfam full alignments NC lt f gt lt f gt Noise cutoffs Two real numbers giving HMMER bit score per sequence and per domain cutoffs set according to the highest scores seen for unrelated sequences when gathering members of Pfam full alignments TC lt f gt lt f gt Trusted cutoffs Two real numbers giving HMMER bit score per sequence and per domain cutoffs set according to the lowest scores seen for true homologous sequences that were above the GA gathering thresholds when gathering members of Pfam full alignments recognized GS annotations wT lt f gt Weight lt f gt is a positive real number giving the relative weight for a sequence usually used to compensate for biased representation by downweighting similar sequences Usually the weights average 1 0 e g the weights sum to the number of sequences in the alignment but this is not required Either every sequence must have a we
43. globins4 alignment consisted of 4 se quences with 171 aligned columns HMMER turned it into a model of 149 consensus positions which 19 means it defined 22 gap containing alignment columns to be insertions relative to consensus The 4 se quences were only counted as an effective total sequence number eff nseq of 0 96 The model ended up with a relative entropy per position re pos information content of 0 589 bits The new HMM was saved to globins4 hmm If you were to look at this file and you don t have to it s intended for HMMER s consumption not yours you d see something like HMMER3 f 3 1 February 2013 NAME globins4 LENG 149 ALPH amino RF no MM no CONS yes CS no MAP yes DATE Thu Feb 14 16 44 36 2013 NSEQ 4 EFFN 0 964844 CKSUM 2027839109 STATS LOCAL MSV 9 9014 0 70957 STATS LOCAL VITERBI 10 7224 0 70957 STATS LOCAL FORWARD 4 1637 0 70957 HMM A Cc D E F G H I K L M m gt m m gt i m gt d i gt m i gt i d gt m d gt d COMPO 2 36553 4 52577 2 96709 2 70473 3 20818 3 02239 41069 90041 55332 35210 67329 2 68640 4 42247 2 77497 2 73145 3 46376 2 40504 72516 29302 67763 69377 24712 0 57544 1 78073 1 31293 1 75577 0 18968 0 00000 1 1 70038 4 17733 3 76164 3 36686 3 72281 3 29583 27570 40482 29230 54324 63799 2 68618 4 42225 2 77519 2 73123 3 46354 2 40513 72494 29354 67741 69355 24690 0 03156 3 86736 4 58970 0 61958 0 77255 0 34406 23405 149 2 92198 5 11574 3 28049 2 65489
44. in C elegans HMMER 1 8 the first public release of HUMMER came in April 1995 shortly after moved to Washington University in St Louis A few bugfix releases followed A number of more serious modifications and improvements went into HMMER 1 9 code but 1 9 was never released Some versions of HMMER 1 9 inadvertently escaped St Louis and make it to some genome centers but 1 9 was never documented or supported HMMER 1 9 collapsed under its own weight in 1996 HMMER 2 was a nearly complete rewrite based on the new Plan 7 model architecture Implementation was begun in November 1996 thank the Washington University Dept of Genetics the NIH National Human Genome Research Institute and Monsanto for their support during this time Also thank the Biochemistry Academic Contacts Committee at Eli Lilly amp Co for a gift that paid for the trusty Linux laptop on which much of HMMER 2 was written The laptop was indispensable Far too much of HMMER was written in coffee shops airport lounges transoceanic flights and Graeme Mitchison s kitchen The source code still contains a disjointed record of where and when various bits were written HMMER then settled into a comfortable middle age like its primary author still actively maintained though dramatic changes seemed increasingly unlikely HMMER 2 1 1 was the stable release for three years from 1998 2001 HMMER 2 2g was intended to be a beta release but became the de facto stable releas
45. of single sequences the consensus is the same as the query sequence For models of multiple align ments the consensus is the maximum likelihood residue at each position Upper case indicates that the model s emission probability for the consensus residue is gt an arbitrary threshold 0 5 for protein models 0 9 for DNA RNA models cs lt s gt Consensus structure annotation flag lt s gt is either no or yes case insensitive If yes the con sensus structure character field for each match state in the main model see below is valid if no these characters are ignored Consensus structure annotation is picked up from a Stockholm file s 103 GC SS_cons line and propagated to alignment displays Optional assumed to be no if not present map lt s gt Map annotation flag lt s gt is either no or yes case insensitive If set to yes the map annotation field in the main model see below is valid if no that field will be ignored The HMM alignment map annotates each match state with the index of the alignment column from which it came It can be used for quickly mapping any subsequent HMM alignment back to the original multiple alignment via the model Optional assumed to be no if not present DATE lt s gt Date the model was constructed lt s gt is a free text date string This field is only used for logging purposes Optional COM lt n gt lt s gt Command line log lt n gt counts command line numbers and lt s g
46. out of your system wide directories like usr local bin which might be desirable Of course if you do it that way you d also want to add usr local hmmer bin to your PATH usr local hmmer share man tO your MANPATH etc These variables only affect make install HMMER executables have no pathnames compiled into them Staged installations in a buildroot for a packaging system HMMER S make install supports staged installations accepting the traditional DESTDIR variable that packagers use to specify a buildroot For example you can do gt make DESTDIR rpm tmp buildroot install Workarounds for some unusual configure compilation problems Configuration or compilation fails when trying to use a separate build directory If you try to build in a build tree other than the source tree and you have any trouble in configuration or compilation try just building in the source tree instead Some make versions don t support the VPATH mechanism needed to use separate build trees Another workaround is to install GNU make Configuration fails complaining that the CFLAGS don t work Our configure script uses an Autoconf macro AX_cc_MAxoPT that tries to guess good optimization flags for your compiler In very rare cases we ve seen it guess wrong You can always set crLacs yourself with something like gt configure CFLAGS O Configuration fails complaining no acceptable grep could be found We ve seen this happen on our Sun Sparc Sola
47. output in addition to the top scoring domain per significant sequence hit By default this option is unset domZ lt x gt Declare the number of significant sequences to be lt x gt sequences for purposes of conditional E value calculation for additional domain significance Normally con ditional E values are calculated relative to the number of sequences passing per sequence reporting threshold Options Controlling Inclusion Thresholds Inclusion thresholds control which hits are included in the multiple alignment and profile constructed for the next search iteration By default a sequence must have a per sequence E value of lt 0 001 see E option to be included and any additional domains in it besides the top scoring one must have a conditional E value of lt 0 001 see domE option The difference between reporting thresholds and inclusion thresholds is that inclusion thresholds control which hits actually get used in the next iteration or the final output multiple alignment if the A option is used whereas reporting thresholds control what you see in output Reporting thresholds are generally more loose so you can see borderline hits in the top of the noise that might be of interest incE lt x gt Include sequences with E values lt lt x gt in subsequent iteration or final alignment output by A The default is 0 001 incT lt x gt Use a bit score threshold for per sequence inclusion instead of an E value thresh
48. rae fa ea Lea bao ban Lenta ta a RI ds ANA oes 97 Options for Controlling Output 2 ee 97 Options Controlling Scoring System aoaaa 98 Options Controlling Reporting Thresholds 0 000 eee ee ee ees 98 Options Controlling Inclusion Thresholds o e 99 Options Controlling the Acceleration Pipeline 0 o eee eee 99 Options Controlling E value Calibration 0 100 OherOpions era Taaa a o aE rd da la do be Bee a a a Ga ia 100 8 File formats 102 HMMER profile HMM files 0 o e 102 header Sections ii ayya e o ee ee A TO A EN de a E E DE 102 main model section aie wor EE e dt E A ee ee 105 Stockholm the recommended multiple sequence alignment format 105 syntax of Stockholm markup oo 106 semantics of Stockholm markup o o e 107 recognized GF annotations 2 o a 107 recognized GS annotations 2 2 e 107 recognized GC annotations 2 a 108 recognized GR annotations ooa a 108 A2M multiple alignment format 2 o a a a a a e a a S 108 An example AZM E aia a a aea aa a Sh RAR Ra A A 108 LogalcharacterS s adc ean aaa ea la A 109 Determining consensus columns aaa ee 109 hmmpgmd sequence database format aooaa a ee 109 Fields in header ME 00 cr e a a pue ae ener e E E A E a ms E EA 110 FASTA like sequence format ee 110 Creati
49. sequences If the domain number estimation section of the protein table exp reg clu ov env dom rep inc makes no sense to you it may help to read the previous section of the manual which describes the HMMER processing pipeline including the steps that probabilistically define domain locations in a sequence The domain hits table protein search only In protein search programs the domtblout option produces the domain hits table There is one line for each domain There may be more than one domain per sequence The domain table has 22 whitespace delimited fields followed by a free text target sequence description as follows 1 target name The name of the target sequence or profile 2 target accession Accession of the target sequence or profile or if none is available 3 tlen Length of the target sequence or profile in residues This together with the query length is useful for interpreting where the domain coordinates in subsequent columns lie in the sequence 4 query name Name of the query sequence or profile 5 accession Accession of the target sequence or profile or if none is available 6 qlen Length of the query sequence or profile in residues 7 E value E value of the overall sequence profile comparison including all domains 8 score Bit score of the overall sequence profile comparison including all domains inclusive of a null2 bias composition correction to the s
50. the lt hmmfile gt contains more than one profile query then lt seqdb gt cannot come from lt stdin gt because we can t rewind the streaming target database to search it with another profile The output format is designed to be human readable but is often so voluminous that reading it is impractical and parsing it is a pain The tblout and domtblout options save output in simple tabular formats that are concise and easier to parse The o option allows redirecting the main output including throwing it away in dev null Options h Help print a brief reminder of command line usage and all available options Options for Controlling Output O lt f gt Direct the main human readable output to a file lt f gt instead of the default stdout A lt f gt Save a multiple alignment of all significant hits those satisfying inclusion thresh olds to the file lt f gt tblout lt f gt Save a simple tabular space delimited file summarizing the per target output with one data line per homologous target sequence found domtblout lt f gt Save a simple tabular space delimited file summarizing the per domain output with one data line per homologous domain detected in a query sequence for each homologous model acc Use accessions instead of names in the main output where available for profiles and or sequences noali Omit the alignment section from the main output This can greatly reduce the output volume no
51. the substitution matrix in file lt mxfile gt The default score matrix is BLOSUME62 this matrix is internal to HMMER and does not have to be available as a file The format of a substitution matrix lt mxfile gt is the standard format accepted by BLAST FASTA and other sequence analysis software Only one of the mx and mxfile options may be used Options Controlling Reporting Thresholds Reporting thresholds control which hits are reported in output files the main output tblout and domtblout Sequence hits and domain hits are ranked by statistical significance E value and output is generated in two sections called per target and per domain output In per target output by default all sequence hits with an E value lt 10 are reported In the per domain output for each target that has passed per target report ing thresholds all domains satisfying per domain reporting thresholds are reported By default these are domains with conditional E values of lt 10 The following options allow you to change the default E value reporting thresholds or to use bit score thresholds instead E lt x gt Inthe per target output report target sequences with an E value of lt lt x gt The default is 10 0 meaning that on average about 10 false positives will be reported per query so you can see the top of the noise and decide for yourself if it s really noise T lt x gt Instead of thresholding per profile output on E value inst
52. to the outer edges To trim these unaligned nonhomologous residues from the result see the trim option Options h Help print a brief reminder of command line usage and all available options o lt f gt Direct the output alignment to file lt f gt rather than to stdout mapali lt f gt Merge the existing alignment in file lt f gt into the result where lt f gt is exactly the same alignment that was used to build the model in lt hmmfile gt This is done using a map of alignment columns to consensus profile positions that is stored in the lt hmmfile gt The multiple alignment in lt f gt will be exactly reproduced in its consensus columns as defined by the profile but the displayed alignment in insert columns may be altered because insertions relative to a profile are considered by convention to be unaligned data trim Trim nonhomologous residues assigned to N and C states in the optimal align ments from the resulting multiple alignment output amino Specify that all sequences in lt segfile gt are proteins By default alphabet type is autodetected from looking at the residue composition dna Specify that all sequences in lt seqgfile gt are DNAs rna Specify that all sequences in lt segfile gt are RNAs informat lt s gt Declare that the input lt segfile gt is in format lt s gt Accepted sequence file formats include FASTA EMBL GenBank DDBJ UniProt Stockholm and SELEX Default is to autodet
53. value thresholds will pass a smaller proportion decreasing sensitivity and increasing speed Setting a filter s P value threshold to 1 0 means it will passing all sequences and effectively disables the filter Changing filter thresholds only removes or includes targets from consideration changing filter thresholds does not alter bit scores E values or alignments all of which are determined solely in postprocessing max Maximum sensitivity Turn off all filters including the bias filter and run full For ward Backward postprocessing on every target This increases sensitivity slightly at a large cost in speed F1 lt x gt First filter threshold set the P value threshold for the MSV filter step The default is 0 02 meaning that roughly 2 of the highest scoring nonhomologous targets are expected to pass the filter F2 lt x gt Second filter threshold set the P value threshold for the Viterbi filter step The default is 0 001 F3 lt x gt Third filter threshold set the P value threshold for the Forward filter step The default is 1e 5 nobias Turn off the bias filter This increases sensitivity somewhat but can come at a high cost in speed especially if the query has biased residue composition such as a repetitive sequence region or if it is a membrane protein with large regions of hydrophobicity Without the bias filter too many sequences may pass the filter with biased queries leading to slower than expected perfor
54. with some caution at the conditional E value to decide the statistical significance of additional weak scoring domains In the UniProt output for example we d be pretty sure of four of the domains 1 4 5 and maybe 6 each of which has a strong enough independent E value to declare 7LESS_DRomE to be an fnlll domain containing protein Domains 2 and 7 wouldn t be significant if they were all we saw in the sequence but once we decide that 7LESS_DRoME contains fn3 domains on the basis of the other hits their conditional E values indicate that they are probably also fn3 domains too Domain 3 is too weak to be sure of from this search alone but would be something to pay attention to The next four columns give the endpoints of the reported local alignment with respect to both the query model hmm from and hmm to and the target sequence ali from and ali to Is not immediately easy to tell from the to coordinate whether the alignment ended internally in the query or target versus ran all the way as in a full length global alignment to the end s To make this more readily apparent with each pair of query and target endpoint coordinates there s also a little symbology meaning both ends of the alignment ended internally and means both ends of the alignment were full length flush to the ends of the query or target and and mean only the left or right end was flush full length The next two columns
55. x gt Sets the minimum relative entropy contributed by an entire model alignment over its whole length This has the effect of making short models have higher relative entropy per position than ere alone would give The default is 45 0 bits eid lt x gt Sets the fractional pairwise identity cutoff used by single linkage clustering with the eclust option The default is 0 62 Options Controlling Priors By default weighted counts are converted to mean posterior probability parameter estimates using mixture Dirichlet priors Default mixture Dirichlet prior parameters for protein models and for nucleic acid RNA and DNA models are built in The following options allow you to override the default priors pnone Don t use any priors Probability parameters will simply be the observed frequen cies after relative sequence weighting plaplace Use a Laplace 1 prior in place of the default mixture Dirichlet prior Options Controlling E value Calibration The location parameters for the expected score distributions for MSV filter scores Viterbi filter scores and Forward scores require three short random sequence simulations EmL lt n gt Sets the sequence length in simulation that estimates the location parameter mu for MSV filter E values Default is 200 57 EmN lt n gt EvL lt n gt EvN lt n gt EfL lt n gt EfN lt n gt Eft lt x gt Other Options Cpu lt n gt informat lt s gt
56. 0 5 0 6 3 7e 98 330 3 0 6 1 0 1 sp P68873 HBB_PANTR 9 5e 98 329 0 0 7 1 1e 97 328 8 0 7 1 0 1 sp P02024 HBB_GORGO 2 9e 96 324 2 0 5 3 2e 96 324 0 0 5 1 0 1 sp P02025 HBB_HYLLA 2 9e 95 320 9 0 6 3 2e 95 320 8 0 6 1 0 1 sp P02032 HBB_SEMEN Description subunit subunit subunit subunit subunit subunit Hemoglobin Hemoglobin Hemoglobin Hemoglobin Hemoglobin Hemoglobin beta beta beta beta beta beta OS Homo sapien OS Pan paniscu OS Pan troglod OS Gorilla gor OS Hylobates 1 OS Semnopithec That continues until the inclusion threshold is reached at which point you see a tagline inclusion thresh old indicating where the threshold was set 0 00047 25 0 0 2 0 00055 24 8 0 2 1 0 1 sp QOKIY5 MYG_KOGBR 0 0006 24 6 0 0 0 00071 24 4 0 0 1 0 1 sp P14399 MYG_MUSAN Tiea inclusion threshold 0 001 239 0 3 0 011 20 5 0 3 2 0 1 sp P81044 HBAZ_MACEU 0 0013 23 55 0 0 0 0017 2352 0 0 1 1 1 sp 080405 LGB3_PEA The domain output and search statistics are then shown Myoglobin OS Kogia breviceps GN MB PE Myoglobin OS Mustelus antarcticus GN m Hemoglobin subunit zeta Fragments OS Leghemoglobin Lb120 1 OS Pisum sativum just as in phmmer At the end of this first iteration you ll see some output that starts with ee this is a simple tag that lets you search through the file to find the end of one iteration and the beginning of another New targets included 935 New alignment includes 936 subseqs Co
57. 02387 302466 330000 0 87 The bit score bias value Evalue and acc are as described for hmmsearch as is the choice of or symbols The next four columns give the endpoints of the reported local alignment with respect to both the query model hmm from and hmm to and the target sequence ali from and ali to These are as described in the section for hmmsearch results including the symbology used to recognize flush vs internal end points in hits The next two columns env from and env to also behave as described earlier for hmmsearch defining the envelope of the hit s location on the target sequence The sq len column indicates the full length of the target sequence enabling simple calculation of the proximity of a hit to the end of the target Under each one line hit table is displayed the alignment inferred between the model and the hit envelope For example the top hit from above is shown as Alignment score 39 0 bits XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX e XXXXXXXXXXXXXXXXXXXXXXXX RE MADE1 4 ggttggtgcaaaagtaattgcggtttttgccattacttttaatggC aaaaaccgcaattacttttgcacc 73 ggt ggtgcaaaa aattg ggtttttgccatt cttttaat gc a aaa ga t ctttt cacc humanchr1 239220001 239550000 302390 GGTCGGIGCAAAATCAATTIGTGGTITTIGCCATIGCTTTTAATTGCttttA AAA GTA ATGCTTTTIACACC 302459 B9Qkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkxkx xkxx xx x955533 443 334 4689kxxxxxxxx x PP XXXXXXX RF MADE1 74 aacct
58. 2009 2011 To learn more about HMMs from the perspective of the speech recognition community an excellent tutorial introduction has been written by Rabiner Rabiner 1989 gt How do I cite HMMER There is still no real paper on HMMER If you re writing for an enlightened url friendly journal the best reference is http hmmer org If you must use a paper reference the best one to use is Sean s 1998 profile HMM review Eddy 1998 11 2 Installation Quick installation instructions Download hmmer 3 0 tar gz from http hmmer org or directly from ftp selab janelia org pub software hmmer3 hmmer 3 0 tar gz unpack it configure and make gt wget ftp selab janelia org pub software hmmer3 hmmer 3 0 tar gz gt tar xf hmmer 3 0 tar gz gt cd hmmer 3 0 gt configure gt make To compile and run a test suite to make sure all is well you can optionally do gt make check All these tests should pass You don t have to install HMMER programs to run them The newly compiled binaries are now in the src directory You can run them from there To install the programs and man pages somewhere on your system do gt make install By default programs are installed in usr local bin and man pages in usr local share man man1 You can change the usr 1local prefix to any directory you want using the configure prefix option asin configure prefix the directory you want Optionally you can install the Easel li
59. 7 4 52134 3 29953 4 34285 4 18764 4 30886 3 35801 3 93889 TS AA 2 68629 4 42236 2 77530 2 73088 3 46365 2 40512 3 72505 3 29365 3 61514 0 09796 2 38361 6 81068 0 10064 2 34607 0 48576 0 95510 2 2 70230 5 97353 2 24744 2 62947 5 31433 2 60356 4 43584 4 79731 4 25623 38S 2 68618 4 42225 2 77519 2 73123 3 46354 2 40513 3 72494 3 29354 3 61503 0 00338 6 08833 6 81068 0 61958 0 77255 0 48576 0 95510 o 85 2 48488 5 72055 3 87501 1 97538 3 04853 3 48010 4 51877 3 51898 3 43366 120e B 2 68618 4 42225 2 77519 2 73123 3 46354 2 40513 3 72494 3 29354 3 61503 0 00338 6 08833 6 81068 0 61958 0 77255 0 48576 0 95510 86 3 03720 5 94099 3 75455 2 96917 5 26587 2 91682 3 66571 4 11840 4 99111 12d se 2 2 E 2 68618 4 42225 2 77519 2 73123 3 46354 2 40513 3 72494 3 29354 3 61503 0 00227 6 08723 0 61958 0 77255 0 00000 11 An HMM file consists of one or more HMMs Each HMM starts with a format version identifier here HMMER3 f and ends with on a line by itself The format version identifier allows backward compatibility as the HMMER software evolves it tells the parser this file is from HMMER3 s save file format version f The closing allows multiple HMMs to be concatenated The format is divided into two regions The first region contains textual information and miscalleneous parameters in a roughly tag value scheme This section ends with a line beginning with the keyword Hmm The second region is a tabula
60. 8 Options for Reporting Thresholds 1 2 2 0 0 o o 69 Options for Inclusion Thresholds ooo e 69 Options for Model specific Score Thresholding ooa ee eee eee 70 Control of the Acceleration Pipeline oaa a ee 70 Other Opuions 4 ical dina a duit ed a Bae dahl a lal oh wae RE A 71 hmmsearch search profile s against a sequence database o o o 72 SYNOPSIS is ta e ek E A a ds Ae 72 Descrip ii a a a dd A A 72 OPUONS sea a ds cala ba a O et da lia etiam nace ey ay at fs 72 Options for Controlling Output o o 72 Options Controlling Reporting Thresholds 0 00 eee ee ee eee 73 Options for Inclusion Thresholds o o o o 73 Options for Model specific Score Thresholding 0 00000 eee eee eee 74 Options Controlling the Acceleration Pipeline 0 00000 eee eee 74 Other Options a hee ee ek wee hn ee Ce eh ek a hehe UO e a es Boe 75 hmms im collect score distributions on random sequences o o o o 04 es 76 SINOPSIS zara wees legs te yaar ti eos Gee aha Mgt ia 76 DESCHUPION mi da ahah alee AA dla 76 Miscellaneous Options o 77 Options Controlling Output o 77 Options Controlling Model Configuration mode o o coo o o 78 Options Controlling Scoring Algorithm o ooo 78 Options Controlling Fitted Tail Masses for Forward 0 00000 ee eee 79 Options Controlling H3 Parame
61. ER profile sequence comparison pipeline Null Model ala RODAR hb ae Ming uh cose fe ai niece ee ee eS MSM TIGR a id ai ddr tas to ll daras as aed Biased composition filter o oo ee ViterbDintilier id Ad aa a a A Be eo a eS ES Forward filter parser ee Domain definitione s eae corra Re Rk hae ae A A wee AA A i Modifications to the pipeline as used for DNA search o o e SSVMOTMSV aae t a a Seb A A ee a a ee OG There are no domains but there are envelopes 2 2 000002 e Biased COMPOSITION coco idad Jone eee E ig A GO a ke we Ee 5 Tabular output formats The target hits table A oa a ek Be ee A ee a ee eee The domain hits table protein search only o e mu o 6 Some other topics How dolcite HMMER 2 ee How do lireport a bug oo ease ee ek aad A A dhe te ee a aaa A a a a ee a INPUETMOS civic da ceca Te at ae Rae Boe a Se ee a Ea de be As Pe a a ee Bs Reading from a stdin pipe using dash as a filename argument 7 Manual pages alimask Add mask line to a multiple sequence alignment o o o SINOPSIS a a a as tte anna PESCHON ans rural dd aca RES OPINAS vaa rd ua aa o as alada da da de le te e Oa cee Ge ead Options for Specifying Mask Range o e o Options for Specifying the Alphabet o o Options Controlling Profile Construction o
62. HMMER User s Guide Biological sequence analysis using profile hidden Markov models http hmmer org Version 3 161 May 2013 Sean R Eddy and Travis J Wheeler for the HMMER Development Team Janelia Farm Research Campus 19700 Helix Drive Ashburn VA 20147 USA http eddylab org Copyright C 2013 Howard Hughes Medical Institute Permission is granted to make and distribute verbatim copies of this manual provided the copyright notice and this permission notice are retained on all copies HMMER is licensed and freely distributed under the GNU General Public License version 3 GPLv3 For a copy of the License see http www gnu org licenses HMMER is a trademark of the Howard Hughes Medical Institute Contents 1 Introduction How to avoid reading this manual 2 2 ee How to avoid using this software links to similar software 0 o What profile HMMs are o e a Applications of profile HMMs o 0 o e Design goals of HMMER3 ee Whats new in HMMERB 1 000 0 2 ee What s still missing in HMMER3 1 o e How to learn more about profile HMMS o o e Installation Quick installation instructions ee System requirements ee Multithreaded parallelization for multicores is the default 220 MPI parallelization for clusters is optional aoaaa aa
63. J state and local entry exit tran sition probabilities are disabled s comes from HMMER2 s historical terminology for unihit glocal alignment Options Controlling Scoring Algorithm vit fwd hyb MSV Collect Viterbi maximum likelihood alignment scores This is the default Collect Forward log odds likelihood scores summed over alignment ensemble Collect Hybrid scores as described in papers by Yu and Hwa for instance Bioin formatics 18 864 2002 These involve calculating a Forward matrix and taking the maximum cell value The number itself is statistically somewhat unmotivated but the distribution is expected be a well behaved extreme value distribution Gumbel Collect MSV multiple ungapped segment Viterbi scores using H3 s main accel eration heuristic 78 fast For any of the above options use H3 s optimized production implementation us ing SIMD vectorization The default is to use the implementations sacrifice a small amount of numerical precision This can introduce confounding noise into statis tical simulations and fits so when one gets super concerned about exact details it s better to be able to factor that source of noise out Options Controlling Fitted Tail Masses for Forward In some experiments it was useful to fit Forward scores to a range of different tail masses rather than just one These options provide a mechanism for fitting an evenly spaced range of different tail masses
64. KKK KKK KK KKK KK KKK KKK KK IIIS RK KK KR KR KKK KKK KK KKK KIIQIT PP You d think that except for the E values which depend on database search space sizes you should get exactly the same scores domain number domain coordinates and alignment every time you do a search of the same HMM against the same sequence And this is actually the case but in fact it s actually not so obvious this should be so and HMMER is going out of its way to make it so HMMER uses stochastic sampling algorithms to infer some parameters and also to infer the exact domain number and domain boundaries in certain difficult cases If HMMER ran its stochastic samples properly it would see different samples every time you ran a program and all of you would complain to me that HMMER was weird and buggy because it gave different answers on the same problem To suppress run to run variation HMMER seeds its random number generator s identically every time you do a sequence comparison If you re an expert and you really want to see the proper stochastic variation that results from any sampling algorithms that got run you can pass a command line argument of seed 0 to programs that have this property hmmbuild and the four search programs 34 Creating multiple alignments with hmmalign The file tutorial globins45 fa is a FASTA file containing 45 unaligned globin sequences To align all of these to the globins4 model and make a multiple sequence alignment gt
65. Na the alphabet size K is set to 4 and the symbol alphabet to ACGU Mandatory RF lt s gt Reference annotation flag lt s gt is either no or yes case insensitive If yes the reference an notation character field for each match state in the main model see below is valid if no these characters are ignored Reference column annotation is picked up from a Stockholm alignment file s GC_ RF line It is propagated to alignment outputs and also may optionally be used to de fine consensus match columns in profile HMM construction Optional assumed to be no if not present MM lt s gt Model masked flag lt s gt is either no or yes case insensitive If yes the model mask annotation character field for each match state in the main model see below is valid if no these characters are ignored Indicates that the profile model was created such that emission probabilities at masked positions are set to match the background frequency rather than being set based on observed frequencies in the alignment Position specific insertion and deletion rates are not altered even in masked regions Optional assumed to be no if not present CONS lt s gt Consensus residue annotation flag lt s gt is either no or yes case insensitive If yes the consen sus residue field for each match state in the main model see below is valid If no these characters are ignored Consensus residue annotation is determined when models are built For models
66. _DROME 439 SAPVIEHLMGLDDSHLAVHWHPGRFTNGPIEGYRLRLSSSEGNA TSEOLVPAGRGSYIFSOLOAGTNYTLALSMINKOGEGP 520 TEIIIIGI9III A RAK KKK KK KK KKK KK KKK KKK KKKKKKIOIBR RK KKK KK KKK RK KKK KKK KKK KKK KKKKKKKIOIT PP The initial header line starts with a as a little handle for a parsing script to grab hold of We may put more information on that line eventually If the model had any consensus structure or reference line annotation that it inherited from your multiple alignment Gc SS_cons GC RF annotation in Stockholm files that information is simply regurgitated as CS or RF annotation lines here The n3 model had a consensus structure annotation line The line starting with n3 is the consensus of the query model Capital letters represent the most con served high information content positions Dots in this line indicate insertions in the target sequence with respect to the model The midline indicates matches between the query model and target sequence A indicates positive score which can be interpreted as conservative substitution with respect to what the model expects at that position The line starting with 7LESS_DRoME is the target sequence Dashes in this line indicate deletions in the target sequence with respect to the model The bottom line represents the posterior probability essentially the expected accuracy of each aligned residue A 0 means 0 5 1 means 5 15 and so on 9 means 85 95 and a means 95 100 post
67. a ee Using build directories a ar eee ae ete EE a a ae eed Makefile targets 2 ee Why is the output of make so clean ee What gets installed by make install and where 0 ee ee ees Staged installations in a buildroot fora packaging system o o a Workarounds for some unusual configure compilation problems Tutorial The programs in HMMER 2 o e Supported formals ii A EGER Be ir ae A aR Files used in the tutorial ee Searching a protein sequence database with a single protein profile HMM Step 1 build a profile HMM with hmmbuild 0 0 0 00000 ee eee ee eee Step 2 search the sequence database with hmmsearch Single sequence protein queries USING phmmer a aoaaa a Iterative protein searches using jackhmmer aaa a Searching a DNA sequence database a Step 1 Optionally build a profile HMM with hmmbuild Step 2 search the DNA sequence database with nhmmer Searching a profile HMM database with a query Sequence o Step 1 create an HMM database flatfile 0 o ee ee eee Step 2 compress and index the flatfile with hmmpress Step 3 search the HMM database withhmmscan o Creating multiple alignments with hmmalign 2 0 00 0 The HMM
68. aa 80 aa ctaa humanchr1 239220001 239550000 302460 AATCTAA 302466 99986 PP Details of the alignment format are the same as for hmmsearch Finally at the bottom of the file you ll see some summary statistics For example at the bottom of the MADE1 search output you ll find something like Internal pipeline statistics summary Query model s 1 80 nodes Target sequences 1 660000 residues searched Residues passing SSV filter 61658 0 0934 expected 0 02 Residues passing bias filter 45802 0 0694 expected 0 02 Residues passing Vit filter 2443 0 0037 expected 0 001 Residues passing Fwd filter 221 0 00336 expected le 05 Total number of hits 5 0 000403 CPU time 0 05u 0 00s 00 00 00 05 Elapsed 00 00 00 03 Mc sec 1760 00 This gives you some idea of what s going on in nhmmer s acceleration pipeline You ve got one query HMM and 660 000 residues were searched there are 330 000 bases in the single sequence found in the file the search includes the reverse complement doubling the search space The sequences in the database go through a gauntlet of three scoring algorithms called SSV Viterbi and Forward in order of increasing sensitivity and increasing computational requirement SSV the Single ungapped Segment Viterbi algorithm as used in nhmmer is closely related to the MSV algorithm used in hmmsearch in that it depends on ungapped alignment segments The difference lies in how those ali
69. able in genome analysis papers rely heavily on HMMER annotation Say you have a new sequence that according to a BLAST analysis shows a slew of hits to receptor 4There has been agitation in some quarters to call all such models position specific scoring matrices PSSMs but certain small nocturnal North American marsupials have a prior claim on the name This is not strictly true There is a subtle difference between an HMM s state path a first order Markov chain and the sequence described by an HMM generated from the state path by independent emissions of symbols at each state tyrosine kinases Before you decide to call your sequence an RTK homologue you suspiciously recall that RTK s are like many proteins composed of multiple functional domains and these domains are often found promiscuously in proteins with a wide variety of functions Is your sequence really an RTK Or is it a novel sequence that just happens to have a protein kinase catalytic domain or fibronectin type III domain Another application is the automated construction and maintenance of large multiple alignment databases It is useful to organize sequences into evolutionarily related families But there are thousands of sequence families some of which comprise tens of thousands of sequences and the primary sequence databases continue to double every year or two This is a hopeless task for manual curation but on the other hand manual curation is still nece
70. aceback clustering is in the column labeled env It ought to be almost the same as the expectation and the number of regions Maximum expected accuracy alignment Each envelope is now aligned to the profile using the full Forward Backward algorithm The profile is configured to unihit mode so that the profile expects only one local alignment domain in the envelope as opposed to multiple domains Posterior decoding is used to calculate the posterior probability of every detailed alignment of profile state to sequence residue The posterior decodings are used to extract a maximum expected accuracy alignment Each aligned residue is annotated with its posterior probability in the Forward Backward alignment ensemble 41 Currently the Forward Backward and posterior decoding calculations at this step are not memory efficient They calculate matrices requiring roughly 36ML bytes where M is the profile length and L is the length of the envelope subsequence Usually in hmmsearch and hmmscan profiles and envelopes are small enough that this is not a problem For example a typical Pfam domain model is about 200 residues long matching to individual target envelopes of about 200 residues each this requires about 1 4 MB of memory in MEA alignment However in phmmer and jackhmmer programs it s often going to be the case that you re aligning an entire query sequence to an entire target sequence in a single unresolved domain alignment
71. alone would give The default is 45 0 bits eid lt x gt Sets the fractional pairwise identity cutoff used by single linkage clustering with the eclust option The default is 0 62 Options Controlling Priors In profile construction by default weighted counts are converted to mean posterior probability parameter estimates using mixture Dirichlet priors Default mixture Dirichlet prior parameters for protein models and for nucleic acid RNA and DNA models are built in The following options allow you to override the default priors pnone Don t use any priors Probability parameters will simply be the observed frequencies after relative sequence weighting plaplace Use a Laplace 1 prior in place of the default mixture Dirichlet prior Options Controlling E value Calibration Estimating the location parameters for the expected score distributions for MSV filter scores Viterbi filter scores and Forward scores requires three short random sequence simulations EmL lt n gt Sets the sequence length in simulation that estimates the location parameter mu for MSV filter E values Default is 200 EmN lt n gt Sets the number of sequences in simulation that estimates the location parameter mu for MSV filter E values Default is 200 87 EvL lt n gt EvN lt n gt EfL lt n gt EfN lt n gt Eft lt x gt Other Options nonull2 Z lt x gt domZ lt x gt Seed lt n gt qformat lt s gt
72. alue of lt lt x gt as the per domain inclusion threshold in targets that have already satisfied the overall per target inclusion threshold The default is 0 01 incdomT lt x gt Instead of using E values use a bit score of gt lt x gt as the per domain inclusion threshold 73 Options for Model specific Score Thresholding Curated profile databases may define specific bit score thresholds for each profile superseding any thresh olding based on statistical significance alone To use these options the profile must contain the appropriate GA TC and or NC optional score threshold annotation this is picked up by hmmbuild from Stockholm format alignment files Each thresholding option has two scores the per sequence threshold lt x1 gt and the per domain threshold lt x2 gt These act as if T lt x1 gt incT lt x1 gt domT lt x2 gt incdomT lt x2 gt has been applied specifically using each model s curated thresholds cut ga Use the GA gathering bit scores in the model to set per sequence GA1 and per domain GA2 reporting and inclusion thresholds GA thresholds are generally considered to be the reliable curated thresholds defining family membership for example in Pfam these thresholds define what gets included in Pfam Full align ments based on searches with Pfam Seed models cut_nc Use the NC noise cutoff bit score thresholds in the model to set per sequence NC1 and per domain NC2 reporting and inclusi
73. ame Full Protein sevenless EC 2 7 10 1 score bias c Evalue i Evalue hmmfrom hmm to alifrom ali to envfrom env to acc Le aksa 0 0 0 17 0 17 61 74 396 409 395 411 0 85 21 40 7 0 0 1 3e 14 1 3e 14 2 84 439 520 437 521 05 95 33 1 14 4 0 0 2e 06 2e 06 13 85 836 913 826 914 CTI 4 5AT 0 0 0 0016 0 0016 10 36 1209 1235 1203 1259 0 82 ls 24 3 0 0 1 7e 09 1 7e 09 14 80 1313 1380 1304 1386 0 82 6 0 0 0 0 0 063 0 063 58 TA ea 1754 1768 ass 1739 1769 xs 089 de 47 2 0 9 1 2e 16 1 2e 16 1 85 1799 1890 1799 18 91 e 0 91 8 17 8 0 0 1 8e 07 1 8e 07 6 TA 1904 1966 1901 1976 0 90 9 el 12 8 0 0 6 6e 06 6 6e 06 1 86 1993 LOA e 1993 2107 san 2089 Domains are reported in the order they appear in the sequence not in order of their significance The or 2 symbol indicates whether this domain does or does not satisfy both per sequence and per domain inclusion thresholds Inclusion thresholds are used to determine what matches should be considered to be true as opposed to reporting thresholds that determine what matches will be reported often including the top of the noise so you can see what interesting sequences might be getting tickled by your search By default inclusion thresholds usually require a per sequence E value of 0 01 or less and a per domain conditional E value of 0 01 or less except jackhmmer which requires a more stringent 0 001 for both and reporting E value thresholds are set to 10 0 The bit score and bias va
74. arching the globins4 hmm against UniProt 15 7 A FASTA file containing 45 unaligned globin sequences An example alignment of 106 fibronectin type III domains This is the Pfam 22 0 n3 seed alignment It provides an example of a Stockholm format with more complex annotation We ll also use it for an example of hmmsearch analyzing sequences containing multiple domains A profile HMM created from fn3 sto by hmmbuild A FASTA file containing the sequence of the Drosophila Sevenless protein a recep tor tyrosine kinase whose extracellular region is thought to contain seven fibronectin type III domains Output of hmmsearch fn3 hmm 7LESS_DROME The Pfam 22 0 Pkinase seed alignment of protein kinase domains A profile HMM created from Pkinase sto by hmmbuild An example HMM flatfile database containing three models globins4 fn3 and Pkinase Binary compressed files corresponding to minifam produced by hmmpress A FASTA file containing the sequence of human 3 hemoglobin used as an exam ple query for phmmer and jackhmmer An example alignment of 1997 instances of the MADE1 transposable element fam ily This is the Dfam 1 1 MADE1 seed alignment We ll use it for an example of using nhmmer to search a DNA database 18 MADE1 hmm A profile HMM created from MADE1 sto by hmmbui 1d with default parameters note this model differs from the MADE1 model found in DFAM which is built with more dna target fa A FASTA file
75. are retrieved in the order they occur in the hmmfile This is a side effect of an implementation that allows multiple keys to be retrieved even if the lt hmmfile gt is a nonrewindable stream like a standard input pipe In normal use without index or f options lt hmmfile gt may be dash which means reading input from stdin rather than a file With the index option lt hmmfile gt may not be it does not make sense to index a standard input stream With the f option either lt hmmfile gt or lt keyfile gt but not both may be It is often particularly useful to read lt keyfile gt from standard input because this allows use to use arbitrary command line invocations to create a list of HMM names or accessions then fetch them all to a new file just with one command By default fetched HMMs are printed to standard output in HMMER3 format Options h Help print a brief reminder of command line usage and all available options f The second commandline argument is a lt keyfile gt instead of a single lt key gt The first field on each line of the lt keyfile gt is used as a retrieval lt key gt an HMM name or accession Blank lines and comment lines that start with a character are ignored 0 lt f gt Output HMM s to file lt f gt instead of to standard output O Output HMM s to individual file s named lt key gt instead of standard output With the f option this can result in many
76. as enabled at compile time Options Controlling Output 0 lt f gt afile lt f gt efile lt f gt Save the main output table to a file lt f gt rather than sending it to stdout When collecting Viterbi alignment statistics the a option for each sampled se quence output two fields per line to a file lt f gt the length of the optimal alignment and the Viterbi bit score Requires that the a option is also used Output a rank vs E value plot in XMGRACE xy format to file lt f gt The x axis is the rank of this sequence from highest score to lowest the y axis is the E value cal culated for this sequence E values are calculated using H3 s default procedures i e the pmu plambda parameters in the output table You expect a rough match between rank and E value if E values are accurately estimated 77 ffile lt f gt pfile lt f gt xfile lt f gt Output a filter power file to lt f gt for each model a line with three fields model name number of sequences passing the P value threshold and fraction of se quences passing the P value threshold See pihresh for setting the P value threshold which defaults to 0 02 the default MSV filter threshold in H3 The P values are as determined by H3 s default procedures the pmu plambda param eters in the output table If all is well you expect to see filter power equal to the predicted P value setting of the threshold Output cumulative surv
77. as passed per target reporting thresholds all domains satisfying per domain reporting thresholds are reported By default these are domains with conditional E values of lt 10 The following options allow you to change the default E value reporting thresholds or to use bit score thresholds instead 83 E lt x gt Report sequences with E values lt lt x gt in per sequence output The default is 10 0 T lt x gt Use a bit score threshold for per sequence output instead of an E value threshold any setting of E is ignored Report sequences with a bit score of gt lt x gt By default this option is unset Z lt x gt Declare the total size of the database to be lt x gt sequences for purposes of E value calculation Normally E values are calculated relative to the size of the database you actually searched e g the number of sequences in target_segab In some cases for instance if you ve split your target sequence database into mul tiple files for parallelization of your search you may know better what the actual size of your search space is domE lt x gt Report domains with conditional E values lt lt x gt in per domain output in addi tion to the top scoring domain per significant sequence hit The default is 10 0 domT lt x gt Use a bit score threshold for per domain output instead of an E value threshold any setting of domT is ignored Report domains with a bit score of gt lt x gt in per domain
78. as the unrelated globins4 model So what happens when we scan the 7LESS_DROME sequence gt hmmscan minifam tutorial 7LESS_DROME 33 The header and the first section of the output will look like hmmscan search sequence s against a profile database HMMER 3 1 February 2013 http hmmer org Copyright C 2011 Howard Hughes Medical Institute Freely distributed under the GNU General Public License GPLv3 Bm os EAS A AAA ee ee eS eee query sequence file 7LESS_DROME target HMM database minifam per seq hits tabular output 7LESS tbl per dom hits tabular output 7LESS domtbl ETs AS A AN A A a a A A A a a A O Gee ee ee Query 7LESS_DROME L 2554 Accession P13368 Description RecName Full Protein sevenless EC 2 7 10 1 Scores for complete sequence score includes all domains full sequence best 1 domain dom E value score bias E value score bias exp N Model Description 5 6e 57 178 0 3 5e 16 47 2 1 1e 43 137 2 1 7e 43 136 5 9 fn3 Fibronectin type III domain 1 Pkinase Protein kinase domain The output fields are in the same order and have the same meaning as in hmmsearch s output The size of the search space for hmmscan is the number of models in the HMM database here 3 for a Pfam search on the order of 10000 In hmmsearch the size of the search space is the number of sequences in the sequence database This means that E values may differ even for the same individual
79. at of the phmmer type search except that the first line changes to 2 hmmab 1 In the hmmpgmd formatted sequence database file each sequence can be associated with one or more sub databases The segdb flag indicates which of these sub databases will be queried The HMM database format does not support sub databases The result of each query is an undocumented data structure in binary format In the future the data will be returned in a proper serialized structure but for now it requires meticulous unpacking within the client The example clients show how this is done 65 Options Expert Options master worker lt s gt daemon cport lt n gt wport lt n gt ccncts lt n gt wencts lt n gt pid lt f gt seqdb lt f gt hmmdb lt f gt cpu lt n gt Help print a brief reminder of command line usage and all available options Run as the master server Run as a worker connecting to the master server that is running on IP address lt S gt Run as a daemon using config file etc nmmpgmd conf Port to use for communication between clients and the master server The default is 51371 Port to use for communication between workers and the master server The default is 51372 Maximum number of client connections to accept The default is 16 Maximum number of worker connections to accept The default is 32 Name of file into which the process id will be written Name of the file
80. atabase much as PSI BLAST would do The first round is identical to a phmmer search All the matches that pass the inclusion thresholds are put in a multiple alignment In the second and subsequent rounds a profile is made from these results and the database is searched again with the profile Iterations continue either until no new sequences are detected or the maximum number of iterations is reached By default the maximum number of iterations is 5 you can change this with the n option Your original query sequence is always included in the multiple alignments whether or not it appears in the database The consensus columns assigned to each multiple alignment always correspond exactly to the residues of your query so the coordinate system of every profile is always the same as the numbering of residues in your query sequence 1 L for a sequence of length L Assuming you have UniProt or something like it handy here s an example command line for a jackhmmer search gt jackhmmer tutorial HBB_HUMAN uniprot _sprot fasta One difference from phmmer output you ll notice is that jackhmmer marks new sequences with a and lost sequences with a New sequences are sequences that pass the inclusion threshold s in this round but didn t in the round before Lost sequences are the opposite sequences that passed the inclusion threshold s in the previous round but have now fallen beneath yet are still in the reported hits
81. ates alirange lt s gt Supply the given range s in alignment coordinates apendmask Add to the existing mask found with the alignment The default is to overwrite any existing mask 51 model2ali lt s gt Rather than actually produce the masked alignment simply print model range s corresponding to input alignment range s ali2model lt s gt Rather than actually produce the masked alignment simply print alignment range s corresponding to input model range s Options for Specifying the Alphabet The alphabet type amino DNA or RNA is autodetected by default by looking at the composition of the msafile Autodetection is normally quite reliable but occasionally alphabet type may be ambiguous and autodetection can fail for instance on tiny toy alignments of just a few residues To avoid this or to increase robustness in automated analysis pipelines you may specify the alphabet type of msafile with these options amino Specify that all sequences in msafile are proteins dna Specify that all sequences in msafile are DNAs rna Specify that all sequences in msafile are RNAs Options Controlling Profile Construction These options control how consensus columns are defined in an alignment fast Define consensus columns as those that have a fraction gt symfrac of residues as opposed to gaps See below for the symfrac option This is the default hand Define consensus columns in next profile using refer
82. ation changing filter thresholds does not alter bit scores E values or alignments all of which are determined solely in postprocessing max Maximum sensitivity Turn off all filters including the bias filter and run full For ward Backward postprocessing on every target This increases sensitivity slightly at a large cost in speed F1 lt x gt First filter threshold set the P value threshold for the MSV filter step The default is 0 02 meaning that roughly 2 of the highest scoring nonhomologous targets are expected to pass the filter F2 lt x gt Second filter threshold set the P value threshold for the Viterbi filter step The default is 0 001 F3 lt x gt Third filter threshold set the P value threshold for the Forward filter step The default is 1e 5 nobias Turn off the bias filter This increases sensitivity somewhat but can come at a high cost in speed especially if the query has biased residue composition such as a repetitive sequence region or if it is a membrane protein with large regions of hydrophobicity Without the bias filter too many sequences may pass the filter 99 with biased queries leading to slower than expected performance as the compu tationally intensive Forward Backward algorithms shoulder an abnormally heavy load Options Controlling E value Calibration Estimating the location parameters for the expected score distributions for MSV filter scores Viterbi filter scores and Forwar
83. blem known as homologous overextension Gonzalez and Pearson 2010 The 3We know how to fix this with memory efficient algorithms and are working on it 42 null2 method used in protein search delays score modification until after the alignment is complete but we know that this kind of overextension can be mostly avoided if the model s log odds scores account for the composition bias of the target region while constructing the alignment The DNA search pipeline therefore does just this it modifies the scoring scheme for each target envelope as a function of that envelope s sequence composition then builds the alignment according to that scheme 43 5 Tabular output formats The target hits table The tblout output option produces the target hits table The target hits table consists of one line for each different query target comparison that met the reporting thresholds ranked by decreasing statistical significance increasing E value tblout fields for protein search programs In the protein search programs each line consists of 18 space delimited fields followed by a free text target sequence description as follows 1 2 3 4 5 6 7 8 9 target name The name of the target sequence or profile accession The accession of the target sequence or profile or if none query name The name of the query sequence or profile accession The accession of the query sequence or profile o
84. brary package as well including its various miniapplications in addition to its library and header files We don t do this by default in case you already have a copy of Easel separately installed gt cd easel make install That s it You can keep reading if you want to know more about customizing a HMMER installation or you can skip ahead to the next chapter the tutorial System requirements Operating system HMMER is designed to run on POSIX compatible platforms including UNIX Linux and MacOS X The POSIX standard essentially includes all operating systems except Microsoft Windows We have tested most extensively on Linux and on MacOS X because these are the machines we develop on Processor HMMER depends on vector parallelization methods that are supported on most modern pro cessors H3 requires either an x86 compatible IA32 1A64 or Intel64 processor that supports the SSE2 vector instruction set or a PowerPC processor that supports the Altivec VMX instruction set SSE2 is sup ported on Intel processors from Pentium 4 on and AMD processors from K8 Athlon 64 on we believe this includes almost all Intel processors since 2000 and AMD processors since 2003 Altivec VMX is supported on Motorola G4 IBM G5 and IBM PowerPC processors starting with the Power6 which we believe includes almost all PowerPC based desktop systems since 1999 and servers since 2007 If your platform does not support one of these vector instructi
85. bunit alpha 4 8e 29 106 2 0 1 5 3e 29 106 1 0 1 0 sp P14398 MYG_GALJA Myoglobin OS Galeorhinus japonicus GN 1 9e 28 104 3 0 0 2 3e 28 104 0 0 0 0 sp P09106 HBAT_PAPAN Hemoglobin subunit theta 1 OS Papio an 3 7e 28 103 4 0 53 4 8e 28 103 0 0 3 0 sp P80017 GLBD_CAUAR Globin D coelomic OS Caudina arenicol 4 1e 28 103 2 0 0 5 1e 28 102 9 0 0 0 sp P0C227 GLB_NERAL Globin OS Nerita albicilla PE 1 SV 1 3 1e 25 93 08 0 2 3 4e 25 93 7 0 2 0 sp P18979 HBA1_UROHA Hemoglobin subunit alpha 1 Fragment 4 2e 24 90 2 0 0 5e 24 89 9 0 0 0 sp 090W04 NGB_TETNG Neuroglobin OS Tetraodon nigroviridis 8 4e 24 89 2 0 0 le 23 89 0 0 0 sp P59742 NGB1_ONCMY Neuroglobin 1 OS Oncorhynchus mykiss G le 23 88 9 0 0 1 3e 23 88 7 0 0 0 sp P59743 NGB2_ONCMY Neuroglobin 2 OS Oncorhynchus mykiss G It s unusual to see sequences get lost and marked with but it can happen it doesn t happen in this globin example After round 2 many more globin sequences have been found New targets included 172 New alignment includes 1110 subseqs was 936 including original query Continuing to next round ee Round 3 Included in MSA 1110 subsequences query 1109 subseqs from 1107 targets Model size 146 positions ee Because new sequences were included it keeps going to round three and then again to round four then again to round five After round five the search ends quietly because there s a default maximum of five i
86. ch as easel easel_utest yourself and let it dump core and use a debugger to examine the stack trace in the core If it s failed in _errno_location it s linked a non thread capable system C library 16 3 Tutorial Here s a tutorial walk through of some small projects with HMMER This should suffice to get you started on work of your own and you can at least temporarily skip the rest of the Guide such as all the nitty gritty details of available command line options The programs in HMMER Build models and align sequences DNA or protein hmmbuild Build a profile HMM from an input multiple alignment hmmalign Make a multiple alignment of many sequences to a common profile HMM Search protein queries against protein database phmmer Search a single protein sequence against a protein sequence database BLASTP like jackhmmer Iteratively search a protein sequence against a protein sequence database PSIBLAST like hmmsearch Search a protein profile HMM against a protein sequence database hmmscan Search a protein sequence against a protein profile HMM database hmmpgmd Search daemon used for hmmer org website Search DNA queries against DNA database nhmmer Search a DNA sequence alignment or profile HMM against a DNA sequence database BLASTN like nhmmscan Search a DNA sequence against a DNA profile HMM database Other utilities alimask Modify alignment file to mask column ranges hmmconvert Convert profile
87. compile time 58 stall For debugging MPI parallelization arrest program execution immediately after start and wait for a debugger to attach to the running process and release the arrest maxinsertlen lt n gt Restrict insert length parameterization such that the expected insert length at each position of the model is no more than lt n gt 59 hmmconvert convert profile file to a HMMER format Synopsis hmmconvert options lt hmmfile gt Description The hmmconvert utility converts an input profile file to different HMMER formats By default the input profile can be in any HMMER format including old obsolete formats from HMMER2 ASCII or binary the output profile is a current HMMER3 ASCII format lt hmmfile gt may be dash which means reading this input from stdin rather than a file Options a b 2 outfmt lt s gt Help print a brief reminder of command line usage and all available options Output profiles in ASCII text format This is the default Output profiles in binary format Output in legacy HMMER2 ASCII text format in Is glocal mode This allows HMMER3 models to be converted back to a close approximation of HMMER2 for comparative studies Output in a HAMER3 ASCII text format other then the most current one Valid choices for lt s gt are 3 a through 3 f The current format is 3 f and this is the default The format 3 b was used in the official HMMER3 release and the other
88. containing 330000 bases extracted from human chromosome 1 in which four MADE1 instances are found This is used as the example database for nhmmer and nhmmscan Searching a protein sequence database with a single protein profile HMM Step 1 build a profile HMM with hmmbuild HMMER starts with a multiple sequence alignment file that you provide The format can usually be au todetected with accepted formats described above The file tutorial globins4 sto is an example of a simple Stockholm file It looks like this STOCKHOLM 1 0 HBB_HUMAN VHLTPEEKSAVTALWGKV NVDEVGGEALGRLLVVYPWTORFFESFGDLSTPDAVMGNPKVKAHGKKVL HBA HUMAN VLSPADKTNVKAAWGKVGA HAGEYGAEALERMFLSFPTTKTYFPHF DLS HGSAQVKGHGKKVA MYG lt PHYCA 9 vested ees VLSEGEWOLVLHVWAKVEA DVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVL GLB5_PETMA PIVDTGSVAPLSAAEKTKIRSAWAPVYS TYETSGVDILVKFFTSTPAAQEFFPKFKGLTTADOLKKSADVRWHAERII HBB_HUMAN GAFSDGLAHL D NLKGTFATLSELHCDKL HVDPENFRLLGNVLVCVLAHHF GKEF TPPVQAAYOKVVAGVANAL HBA_HUMAN DALTNAVAHV D DMPNALSALSDLHAHKL RVDPVNFKLLSHCLLVTLAAHLPAEF TPAVHASLDKFLASVSTVL MYG_PHYCA TALGAILKK K GHHEAELKPLAOSHATKH KIPIKYLEFISEAI IHVLHSRHPGDFGADAQGAMNKALELFRKDI GLB5_PETMA NAVNDAVASM DDTEKMSMKLRDLSGKHAKSF QVDPOYFKVLAAVIADTVAAG DAGFEKLMSMICILL HBB_HUMAN AHKYH HBA_HUMAN TSKYR MYG_PHYCA AAKYKELGYOG GLB5_PETMA RSAY Most popular alignment formats are similar block based formats
89. core 9 bias The biased composition score correction that was applied to the bit score 10 This domain s number 1 ndom 11 of The total number of domains reported in the sequence ndom 46 12 13 14 15 16 17 18 19 20 21 22 23 c Evalue The conditional E value a permissive measure of how reliable this particular domain may be The conditional E value is calculated on a smaller search space than the independent E value The conditional E value uses the number of targets that pass the reporting thresholds The null hypothesis test posed by the conditional E value is as follows Suppose that we believe that there is already sufficient evidence from other domains to identify the set of reported sequences as homologs of our query now how many additional domains would we expect to find with at least this particular domain s bit score if the rest of those reported sequences were random nonhomologous sequence i e outside the other domain s that were sufficient to identified them as homologs in the first place i Evalue The independent E value the E value that the sequence profile comparison would have received if this were the only domain envelope found in it excluding any others This is a stringent measure of how reliable this particular domain may be The independent E value uses the total number of targets in the target database score The bit score f
90. core or if the biased filter is off just the null model score If the P value of this score passes the Viterbi filter threshold the sequence passes on to the next step of the pipeline The F2 lt x gt option controls the P value threshold for passing the Viterbi filter score The default is 0 001 The max option bypasses all filters in the pipeline At the end of a search output you will see a line like 39 Passed Vit filter 2207 0 00443803 expected 497 3 0 001 which tells you how many and what fraction of comparisons passed the Viterbi filter versus how many were expected Forward filter parser The sequence is now aligned to the profile using the full Forward algorithm which calculates the likelihood of the target sequence given the profile summed over the ensemble of all possible alignments This is a specialized time and memory efficient Forward implementation called the Forward parser It is implemented in 4 way parallel SIMD vector instructions in full precision 32 bit floating point It stores just enough information that in combination with the results of the Backward parser below posterior probabilities of start and stop points of alignments domains can be calculated in the domain definition step below although the detailed alignments themselves cannot be The Forward filter bit score is calculated by correcting this score using the appropriate null model log likelihood by default the biased comp
91. d Shed Weed yy al 4 ees E E OO LES 89 D SCriptiony 40404 wt ean ae DRS A ee oe ee Ye ee eG BS 89 OPINAS ti Bit ote Sates Y bee Seta A ee et oh eat anata A A 89 Options for Controlling Output a ea ea a ee 89 Options Controlling Reporting Thresholds 2 0002 eee eee 90 Options for Inclusion Thresholds 1 2 e e 90 Options for Model specific Score Thresholding o o ee ee eee 90 Options Controlling the Acceleration Pipeline 0 000002 e eee eee 91 Other Opuonss acct bsg te ange dew ied A Bobet eee 91 nhmmscan search nucleotide sequence s against a nucleotide profile 93 SVMOPSIS Az chs nE te ce area teen Cte ta a AP tee Eien chee ade teh atten ae Ge wha te eaten Ok cee on A 93 DESCUIDO 5 2602 Sapa aa a A ee ee a hgh gin dE d 93 OPTIONS Pee se al he As o lin eee ip hy o dad eg Aber Bok Bak e Inigo Ss 93 Options for Controlling Output a aa ea ee 93 Options for Reporting Thresholds 2 2 a e mm 94 Options for Inclusion Thresholds o e 94 Options for Model specific Score Thresholding o o 94 Control of the Acceleration Pipeline 2 2 0 00 oo 95 Other Options 020 a a ad ee ea a 95 phmmer search protein sequence s against a protein sequence database 97 SINOPSIS a o hs Hekate A Stine bates BAS Ba 97 Descrip iii a A Tag eee te eS A es 97 OPTIONS toa la Sa bs BBs ds ata o a Sy che ce ew
92. d precision scores scaled to 8 bit integers enabling acceleration via 16 way parallel SIMD vector instructions The MSV score is a true log odds likelihood ratio so it obeys conjectures about the expected score distribution Eddy 2008 that allow immediate and accurate calculation of the statistical significance P value of the MSV bit score By default comparisons with a P value of lt 0 02 pass this filter meaning that about 2 of nonhomol ogous sequences are expected to pass You can use the r1 lt x gt option to change this threshold For example F1 lt 0 05 gt would pass 5 of the comparisons making a search more sensitive but slower Setting the threshold to gt 1 0 r1 99 for example assures that all comparisons will pass Shutting off the MSV filter may be worthwhile if you want to make sure you don t miss comparisons that have a lot of scattered insertions and deletions Alternatively the max option causes the MSV filter step and all other filter steps to be bypassed The MSV bit score is calculated as a log odds score using the null model for comparison No correction for a biased composition or repetitive sequence is done at this stage For comparisons involving biased sequences and or profiles more than 2 of comparisons will pass the MSV filter At the end of search output there is a line like Passed MSV filter 107917 0 020272 expected 106468 8 0 02 which tells you how many and what fraction of comparison
93. d scores requires three short random sequence simulations EmL lt n gt EmN lt n gt EvL lt n gt EvN lt n gt EfL lt n gt EfN lt n gt Eft lt x gt Other Options nonull2 Z lt x gt domZ lt x gt Seed lt n gt qformat lt s gt tformat lt s gt Sets the sequence length in simulation that estimates the location parameter mu for MSV filter E values Default is 200 Sets the number of sequences in simulation that estimates the location parameter mu for MSV filter E values Default is 200 Sets the sequence length in simulation that estimates the location parameter mu for Viterbi filter E values Default is 200 Sets the number of sequences in simulation that estimates the location parameter mu for Viterbi filter E values Default is 200 Sets the sequence length in simulation that estimates the location parameter tau for Forward E values Default is 100 Sets the number of sequences in simulation that estimates the location parameter tau for Forward E values Default is 200 Sets the tail mass fraction to fit in the simulation that estimates the location param eter tau for Forward evalues Default is 0 04 Turn off the null2 score corrections for biased composition Assert that the total number of targets in your searches is lt x gt for the purposes of per sequence E value calculations rather than the actual number of targets seen Assert that the total numbe
94. d we re more likely to stay in our usual good mood If we re in our usual good mood we ll reply quickly We ll probably tell you we fixed the bug in our development code and that the fix will appear in the next HMMER release This of course doesn t help you much since nobody knows when the next HMMER release is going to be So if possible we ll usually try to describe a workaround for the bug If the code fix is small we might also tell you how to patch and recompile the code yourself You may or may not want to do this There are currently not enough open bugs to justify having a formal on line bug tracking system We have a bugtracking system but it s internal 48 Input files Reading from a stdin pipe using dash as a filename argument Generally HMMER programs read their sequence and or profile input from files Unix power users often find it convenient to string an incantation of commands together with pipes indeed such wizardly incantations are a point of pride For example you might extract a subset of query sequences from a larger file using a one liner combination of scripting commands perl awk whatever To facilitate the use of HMMER programs in such incantations you can almost always use an argument of dash in place of a filename and the program will take its input from a standard input pipe instead of opening a file For example the following three commands are entirely equivalent and give essentially i
95. de nonhomologous as well as homologous sequences and may contain more than one homologous sequence segment By default the profile is in multihit local mode and the target sequence length is configured for L 400 Options Controlling Emission from Profiles These options require that you have set the p option L lt n gt local unilocal glocal uniglocal Configure the profile s target sequence length model to generate a mean length of approximately lt n gt rather than the default of 400 Configure the profile for multihit local alignment Configure the profile for unihit local alignment Smith Waterman Configure the profile for multihit glocal alignment Configure the profile for unihit glocal alignment Options Controlling Fancy Consensus Emission These options require that you have set the C option minl lt x gt minu lt x gt Other Options seed lt n gt Sets the minl threshold for showing weakly conserved residues as lower case 0 lt X lt 1 Sets the minu threshold for showing strongly conserved residues as upper case 0 lt x lt 1 Seed the random number generator with lt n gt an integer gt 0 If lt n gt is nonzero any stochastic simulations will be reproducible the same command will give the same results If lt n gt is 0 the random number generator is seeded arbitrarily and stochastic simulations will vary from run to run of the same command The de fault is
96. dentical output gt hmmsearch globins4 hmm uniprot_sprot fasta gt cat globins4 hmm hmmsearch uniprot_sprot fasta gt cat uniprot_sprot fasta hmmsearch globins4 hmm Most Easel miniapp programs share the same ability of pipe reading Because the programs for profile HMM fetching nmmfetch and sequence fetching esl sfetch can fetch any number of profiles or sequences by names accessions given in a list and these programs can also read these lists from a stdin pipe you can craft incantations that generate subsets of queries or targets on the fly For example gt esl sfetch index uniprot_sprot fasta gt cat mytargs list esl sfetch f uniprot_sprot fasta hmmsearch globins4 hmm This takes a list of sequence names accessions in mytargets list fetches them one by one from UniProt note that we index the UniProt file first for fast retrieval and note that esl sfetch Is reading its lt namefile gt list of names accessions through a pipe using the argument and pipes them to an hmmsearch It should be obvious from this that we can replace the cat mytargets list with any incanta tion that generates a list of sequence names accessions including SQL database queries Ditto for piping subsets of profiles Supposing you have a copy of Pfam in Pfam A hmm gt hmmfetch index Pfam A hmm gt cat myqueries list hmmfetch f Pfam hmm hmmsearch uniprot_sprot fasta This takes a list of query profile names access
97. devote a second execution thread to database input resulting in possible speedup over serial execution If you specify cpu 0 the program will run in serial only mode with no threads This might be useful if you suspect something is awry with the threaded parallel implementation MPI parallelization for clusters is optional MPI Message Passing Interface parallelization on clusters is now supported in hmmbuild and all search programs except nhmmer and nhmmscan To use MPI you first need to have an MPI library installed such as OpenMPI www open mpi org We use Intel MPI at Janelia MPI support is not enabled by default and it is not compiled into the precompiled binaries that we supply with HMMER To enable MPI support at compile time give the enable mpi option to the configure command To use MPI parallelization each program that has an MPl parallel mode has an mpi command line option This option activates a master worker parallelization mode Without the mpi option if you run a program under mpirun on N nodes you ll be running N independent duplicate commands not a single MPl enabled command Don t do that The MPI implementation for hmmbuild scales well up to hundreds of processors and hmmsearch scales all right The other search programs hmmscan phmmer and jackhmmer scale poorly and probably shouldn t be used on more than tens of processors at most Improving MPI scaling is one of our goals 2 If you i
98. domains get marked as significant or questionable in domain output incE lt x gt incT lt x gt incdomE lt x gt incdomT lt x gt Use an E value of lt lt x gt as the per target inclusion threshold The default is 0 01 meaning that on average about 1 false positive would be expected in every 100 searches with different query sequences Instead of using E values for setting the inclusion threshold instead use a bit score of gt lt x gt as the per target inclusion threshold It would be unusual to use bit score thresholds with hmmscan because you don t expect a single score threshold to work for different profiles different profiles have slightly different expected score distributions Use a conditional E value of lt lt x gt as the per domain inclusion threshold in targets that have already satisfied the overall per target inclusion threshold The default is 0 01 Instead of using E values instead use a bit score of gt lt x gt as the per domain inclusion threshold As with incT above it would be unusual to use a single bit score threshold in hmmscan 69 Options for Model specific Score Thresholding Curated profile databases may define specific bit score thresholds for each profile superseding any thresh olding based on statistical significance alone To use these options the profile must contain the appropriate GA TC and or NC optional score threshold annotation this is picked
99. e In many places I ve reimplemented algorithms described in the literature These are too numerous to credit and thank here The original references are given in the comments of the code However I ve borrowed more than once from the following folks that l d like to be sure to thank Steve Altschul Pierre Baldi Phillip Bucher Warren Gish Steve and Jorja Henikoff Anders Krogh and Bill Pearson HMMER is primarily developed on GNU Linux and Apple Macintosh machines but is tested on a variety of hardware Over the years Compaq IBM Intel Sun Microsystems Silicon Graphics Hewlett Packard Paracel and nVidia have provided generous hardware support that makes this possible owe a large debt to the free software community for the development tools use an incomplete list includes GNU gcc gdb emacs and autoconf the amazing valgrind the indispensable Subversion the ineffable perl LaTeX and TeX PolyglotMan and the UNIX and Linux operating systems Finally will cryptically thank Dave Mr Frog Pare and Tom Chainsaw Ruschak for a totally unrelated free software product that was historically instrumental in HMMER s development for reasons that are best not discussed while sober 113 References Altschul S F Gish W Miller W Myers E W and Lipman D J 1990 Basic local alignment search tool J Mol Biol 215 403 410 Altschul S F Madden T L Schaffer A A Zhang J Zhang Z Miller
100. e Nucl Acids Res 38 D211 D222 Gonzalez M W and Pearson W R 2010 Homologous over extension a challenge for iterative similarity searches Nucleic acids research 38 7 2177 2189 Gribskov M Luthy R and Eisenberg D 1990 Profile analysis Meth Enzymol 183 146 159 Gribskov M McLachlan A D and Eisenberg D 1987 Profile analysis Detection of distantly related proteins Proc Natl Acad Sci USA 84 4355 4358 Holmes 1998 Studies in Probabilistic Sequence Alignment and Evolution PhD thesis University of Cambridge Karlin S and Altschul S F 1990 Methods for assessing the statistical significance of molecular sequence features by using general scoring schemes Proc Natl Acad Sci USA 87 2264 2268 Karlin S and Altschul S F 1993 Applications and statistics for multiple high scoring segments in molec ular sequences Proc Natl Acad Sci USA 90 5873 5877 Krogh A 1998 An introduction to hidden Markov models for biological sequences In Salzberg S Searls D and Kasif S editors Computational Methods in Molecular Biology pages 45 63 Elsevier Krogh A Brown M Mian I S Sj lander K and Haussler D 1994 Hidden Markov models in compu tational biology Applications to protein modeling J Mol Biol 235 1501 1531 114 Letunic l Copley R R Pils B Pinkert S Schultz J and Bork P 2006 SMART 5 Domains in the context of genomes and
101. e overridden with the hmmout flag An example of searching a sequence database with our MADE1 hmm model would look like gt nhmmer MADE1 hmm dna_target fa gt MADE1 out The output file MADE1 out should look like the example provided in tutorial MADE1 out This output is largely similar to that of hmmsearch The key differences are that 1 each hit is not to a full sequence in the target database but a local alignment of the HMM to a subsequence of a full target database sequence and 2 there are no domains The first section is the header that tells you what program you ran on what and with what options as above The second section is the top hits list It is a list of ranked top hits sorted by E value most significant hit first formatted much like the hmmsearch output top hits list E value score bias Sequence start end Description 8 4e 11 39 0 7 4 humanchr1 239220001 239550000 302390 302466 7 8e 08 20 5 6 0 humanchr1 239220001 239550000 302466 302390 8 4e 08 29 4 8 3 humanchr1 239220001 239550000 174456 174498 5 6e 06 23 6 7 0 humanchr1 239220001 239550000 174493 174456 SR inclusion threshold 1 7 6 0 6 7 humanchr1 239220001 239550000 304074 304104 The table presents the hit E value sequence bit score bias Sequence and Description See the section above for hmmsearch for a description of these fields The start and end columns give for each hit the range in the target sequence at which the
102. e tutorial subdirectory of the distribution 17 Supported formats HMMER can usually automatically detect the format of a multiple sequence alignment for example given to hmmbuild or as the query to nhmmer To override autodetection specify informat afa on the command line of any program that reads an input alignment HMMER can also usually detect the format of an unaligned sequence file for example given as the target database to one of the search programs or as input to hmmalign Autodetection can be overridden with program specifc flags for example specifying t format afa on the command line of search programs See man pages for program specific lists of accepted formats Files used in the tutorial The subdirectory tutorial in the HMMER distribution contains the files used in the tutorial as well as a number of examples of various file formats that HMMER reads The important files for the tutorial are globins4 sto An example alignment of four globin sequences in Stockholm format This align ment is a subset of a famous old published structural alignment from Don Bashford Bashford et al 1987 globins4 hmm An example profile HMM file built from globins4 sto in HMMER3 ASCII text globins4 out globins45 fa minifam fn3 sto n3 hmm 7LESS_DROME f n3 out Pkinase sto Pkinase hmm minifam h3 m i f p HBB_HUMAN MADE1 sto format An example hmmsearch output file that results from se
103. e Forward parser algorithm is calculated in an analogous time and memory efficient implementation The Forward algorithm gives the likelihood of all prefixes of the target sequence summed over their alignment ensemble and the Backward algorithm gives the likelihood of all suffixes For any given point of a possible model state residue alignment the product of the Forward and Backward likelihoods gives the likelihood of the entire alignment ensemble conditional on using that particular alignment point Thus we can calculate things like the posterior probability that an alignment starts or ends at a given position in the target sequence 2Code gurus and masochists can follow along in src p7_domaindef c 40 Domain decoding The posterior decoding algorithm is applied to calculate the posterior probability of alignment starts and ends profile B and E state alignments with respect to target sequence position The sum of the posterior probabilities of alignment starts B states over the entire target sequence is the expected number of domains in the sequence In a tabular output tb1out file this number is in the column labeled exp Region identification A heuristic is now applied to identify a non overlapping set of regions that contain significant probability mass suggesting the presence of a match alignment to the profile For each region the expected number of domains is calculated again by posterior decoding on the Forward
104. e best alignment HMMER3 s log odds scores are sequence scores not just optimal alignment scores they are integrated over the posterior alignment ensemble Speed A major limitation of previous profile HMM implementations including HMMER2 was their slow performance HMMER3 implements a heuristic acceleration algorithm For most protein queries it s about as fast as BLAST while for DNA queries it s typically less than 10x slower than sensitive settings for BLAST Individually none of these points is new As far as alignment ensembles and sequence scores go pretty much the whole reason why hidden Markov models are so theoretically attractive for sequence analysis is that they are good probabilistic models for explicitly dealing with alignment uncertainty The SAM profile HMM software from UC Santa Cruz has always used full probabilistic inference the HMM Forward and Backward algorithms as opposed to optimal alignment scores the HMM Viterbi algorithm HMMER2 had the full HMM inference algorithms available as command line options but used Viterbi alignment by default in part for speed reasons Calculating alignment ensembles is even more computationally intensive than calculating single optimal alignments One reason why it s been hard to deploy sequence scores for practical large scale use is that we haven t known how to accurately calculate the statistical significance of a log odds score that s been integrated over alignment uncertain
105. e for two more years 2001 2003 The final release of the HMMER2 series 2 3 was assembled in spring 2003 The last bugfix release 2 3 2 came out in October 2003 If the world worked as hoped and expected the combination of the 1998 Durbin Eddy Krogh Mitchison book Biological Sequence Analysis and the existence of HMMER2 as a widely used proof of principle should have motivated the widespread adoption of probabilistic modeling methods for sequence analysis particularly database search We would declare Victory and move on Richard Durbin moved on to human genomics Anders Krogh moved on to pioneer a number of other probabilistic approaches for other biological sequence analysis problems Graeme Mitchison moved on to quantum computing moved on to noncoding RNAs Yet BLAST continued to be the most widely used search program HMMs seemed to be widely con sidered to be a mysterious and orthogonal black box rather than a natural theoretical basis for important programs like BLAST The NCBI in particular seemed to be slow to adopt or even understand HMM meth ods This nagged at me the revolution was unfinished When we moved the lab to Janelia Farm in 2006 had to make a decision about what we should spend our time on It had to be something Janelian something that would work on with my own hands something that would be difficult to accomplish under the usual reward structures of academic science and something that would make the larg
106. e is in format lt s gt Currently the accepted multiple alignment sequence file formats include Stockholm Aligned FASTA Clustal NCBI PSI BLAST PHYLIP Selex and UCSC SAM A2M Default is to autodetect the format of the file Seed the random number generator with lt n gt an integer gt 0 If lt n gt is nonzero any stochastic simulations will be reproducible the same command will give the same results If lt n gt is 0 the random number generator is seeded arbitrarily and stochastic simulations will vary from run to run of the same command The default seed is 42 Window length tail mass The upper bound W on the length at which nhmmer ex pects to find an instance of the model is set such that the fraction of all sequences generated by the model with length gt W is less than lt x gt The default is 1e 7 Override the model instance length upper bound W which is otherwise controlled by w_beta It should be larger than the model length The value of W is used deep in the acceleration pipeline and modest changes are not expected to impact results though larger values of W do lead to longer run time Run as a parallel MPI program Each alignment is assigned to a MPI worker node for construction Therefore the maximum parallelization cannot exceed the num ber of alignments in the input msafile This is useful when building large profile libraries This option is only available if optional MPI capability was enabled at
107. e is the target s description line as free text As with the target hits table above this table is columnated neatly for human readability but you should not write parsers that rely on this columnation parse based on space delimited fields instead 47 6 Some other topics How do cite HMMER The appropriate citation is to the web site hmmer org You should also cite what version of the software you used We archive all old versions so anyone should be able to obtain the version you used when exact reproducibility of an analysis is an issue The version number is in the header of most output files To see it quickly do something like hmmscan h to get a help page and the header will say hmmscan search sequence s against a profile database HMMER 3 1 February 2013 http hmmer org Copyright C 2011 Howard Hughes Medical Institute Freely distributed under the GNU General Public License GPLv3 So from the second line there this is from HMMER 3 1 There is not yet any appropriate citable published paper that describes the HMMER3 software suite How do report a bug Email us at hmmer janelia hhmi org Before we can see what needs fixing we almost always need to reproduce a bug on one of our ma chines This means we want to have a small reproducible test case that shows us the failure you re seeing So if you re reporting a bug please send us e A brief description of what went wrong e The com
108. ead report target se quences with a bit score of gt lt x gt domE lt x gt Inthe per domain output for target sequences that have already satisfied the per profile reporting threshold report individual domains with a conditional E value of lt lt x gt The default is 10 0 A conditional E value means the expected number of additional false positive domains in the smaller search space of those comparisons that already satisfied the per target reporting threshold and thus must have at least one homologous domain already domT lt x gt Instead of thresholding per domain output on E value instead report domains with a bit score of gt lt x gt 98 Options Controlling Inclusion Thresholds Inclusion thresholds are stricter than reporting thresholds They control which hits are included in any output multiple alignment the A option and which domains are marked as significant as opposed to questionable in domain output incE lt x gt Use an E value of lt lt x gt as the per target inclusion threshold The default is 0 01 meaning that on average about 1 false positive would be expected in every 100 searches with different query sequences incT lt x gt Instead of using E values for setting the inclusion threshold instead use a bit score of gt lt x gt as the per target inclusion threshold By default this option is unset incdomE lt x gt Use a conditional E value of lt lt x gt
109. ect the format of the file outformat lt s gt Specify that the output multiple alignment is in format lt s gt Currently the accepted multiple alignment sequence file formats only include Stockholm and SELEX 54 hmmbuild construct profile HMM s from multiple sequence alignment s Synopsis hmmbuild options lt hmmfile_out gt lt msafile gt Description For each multiple sequence alignment in lt msafile gt build a profile HMM and save it to a new file lt hmmfile_out gt lt msafile gt may be dash which means reading this input from stdin rather than a file To use you must also specify the alignment file format with informat lt s gt as in informat stockholm because of a current limitation in our implementation MSA file formats cannot be autodetected in a nonrewindable input stream lt hmmfile_out gt may not be stdout because sending the HMM file to stdout would conflict with the other text output of the program Options h Help print a brief reminder of command line usage and all available options n lt s gt Name the new profile lt s gt The default is to use the name of the alignment if one is present in the msafile or failing that the name of the hmmfile If msafile contains more than one alignment n doesn t work and every alignment must have a name annotated in the msafile as in Stockholm GF ID annotation 0 lt f gt Direct the summary output to file lt
110. ed by uneven phylogenetic representation For example two identical sequences would typically each receive half the weight that one sequence would and this is why jackhmmer isn t concerned about always including your original query sequence in each iteration s alignment even if it finds it again in the database you re searching These options control which algorithm gets used wpb wgsc wblosum wnone wid lt x gt Use the Henikoff position based sequence weighting scheme Henikoff and Henikoff J Mol Biol 243 574 1994 This is the default Use the Gerstein Sonnhammer Chothia weighting algorithm Gerstein et al J Mol Biol 235 1067 1994 Use the same clustering scheme that was used to weight data in calculating BLO SUM subsitution matrices Henikoff and Henikoff Proc Natl Acad Sci 89 10915 1992 Sequences are single linkage clustered at an identity threshold default 0 62 see wid and within each cluster of c sequences each sequence gets rela tive weight 1 c No relative weights All sequences are assigned uniform weight Sets the identity threshold used by single linkage clustering when using wblosum Invalid with any other weighting scheme Default is 0 62 86 Options Controlling Effective Sequence Number After relative weights are determined they are normalized to sum to a total effective sequence number eff_nseg This number may be the actual number of sequences in the alignment
111. ed the bias filter If you don t like it it can occasionally be overaggressive you can shut it off with the nobias option Here 17061 sequences pass through the bias filter The Viterbi filter then calculates a gapped optimal alignment score This is a bit more sensitive than the MSV score but the Viterbi filter is about four fold slower than MSV By default HMMER3 lets sequences with a P value of lt 0 001 through this stage Here because there s a little over a thousand true globin homologs in this database much more than that gets through 2321 sequences Then the full Forward score is calculated which sums over all possible alignments of the profile to the target sequence The default allows sequences with a P value of lt 107 through 1109 sequences passed All sequences that make it through the three filters are then subjected to a full probabilistic analysis using the HMM Forward Backward algorithms first to identify domains and assign domain envelopes then within each individual domain envelope Forward Backward calculations are done to determine posterior probabilities for each aligned residue followed by optimal accuracy alignment The results of this step are what you finally see on the output Recall the difference between conditional and independent E values with their two different search space sizes These search space sizes are reported in the statistics summary Finally it reports the speed of the search in uni
112. eleration pipeline and modest changes are not expected to impact results though larger values of W do lead to longer run time This flag may be used to override the value of W established for the model by hmmbuild or when the query is sequence based Only search the top strand By default both the query sequence and its reverse complement are searched Only search the bottom reverse complement strand By default both the query sequence and its reverse complement are searched Set the number of parallel worker threads to lt n gt By default HMMER sets this to the number of CPU cores it detects in your machine that is it tries to maximize the use of your available processor cores Setting lt n gt higher than the number of avail able cores is of little if any value but you may want to set it to something less You can also control this number by setting an environment variable HMMER_NCPU This option is only available if HMMER was compiled with POSIX threads support This is the default but it may have been turned off at compile time for your site or machine for some reason For debugging the MPI master worker version pause after start to enable the developer to attach debuggers to the running master and worker s processes Send SIGCONT signal to release the pause Under gdb gdb signal SIGCONT Only available if optional MPI support was enabled at compile time Run in MPI master worker mode using mpirun Only available
113. ence annotation to the multiple alignment This allows you to define any consensus columns you like symfrac lt x gt Define the residue fraction threshold necessary to define a consensus column when using the fast option The default is 0 5 The symbol fraction in each column is calculated after taking relative sequence weighting into account and ig noring gap characters corresponding to ends of sequence fragments as opposed to internal insertions deletions Setting this to 0 0 means that every alignment col umn will be assigned as consensus which may be useful in some cases Setting it to 1 0 means that only columns that include 0 gaps internal insertions deletions will be assigned as consensus fragthresh lt x gt We only want to count terminal gaps as deletions if the aligned sequence is known to be full length not if it is a fragment for instance because only part of it was sequenced HMMER uses a simple rule to infer fragments if the sequence length L is less than or equal to a fraction lt x gt times the alignment length in columns then the sequence is handled as a fragment The default is 0 5 Setting fragthreshO will define no nonempty sequence as a fragment you might want to do this if you know you ve got a carefully curated alignment of full length sequences Setting fragthresh7 will define all sequences as fragments you might want to do this if you know your alignment is entirely composed of fragments such as t
114. enough on their own are summing up to lift the sequence up to a high score Whether this is Good or Bad is not clear the sequence may contain several weak homologous domains or it might contain a repetitive sequence that is hitting by chance i e once one repeat hits all the repeats hit score best 1 domain The bit score if only the single best scoring domain envelope were found in the sequence and none of the others Inclusive of the null2 bias correction 10 bias best 1 domain The null2 bias correction that was applied to the bit score of the single best scoring domain 11 exp Expected number of domains as calculated by posterior decoding on the mean number of begin states used in the alignment ensemble The tblout format is deliberately space delimited rather than tab delimited and justified into aligned columns so these files are suitable both for automated parsing and for human examination Tab delimited data files are difficult for humans to examine and spot check For this reason we think tab delimited files are a minor evil in the world Although we occasionally receive shrieks of outrage about this we stubbornly feel that space delimited files are just as trivial to parse as tab delimited files 44 12 13 14 15 16 17 18 19 reg Number of discrete regions defined as calculated by heuristics applied to posterior decoding of begin end state positions in the alignment e
115. env from and env to define the envelope of the domain s location on the target sequence The envelope is almost always a little wider than what HMMER chooses to show as a reasonably confident alignment As mentioned earlier the envelope represents a subsequence that encompasses most of the posterior probability for a given homologous domain even if precise endpoints are only fuzzily inferrable You ll notice that for higher scoring domains the coordinates of the envelope and the inferred alignment will tend to be in tighter agreement corresponding to sharper posterior probability defining the location of the homologous region Operationally we would use the envelope coordinates to annotate domain locations on target se quences not the alignment coordinates However be aware that when two weaker scoring domains are close to each other envelope coordinates can and will overlap corresponding to the overlapping uncer tainty of where one domain ends and another begins In contrast alignment coordinates generally do not overlap though there are cases where even they will overlap The last column is the average posterior probability of the aligned target sequence residues effectively the expected accuracy per residue of the alignment 2Not to mention one mercifully rare bug artifact that we re betting is so unusual that testers don t even see an example of it but we ll see 24 For comparison current UniProt con
116. epetitive DNA based on profile hidden Markov models Nucl Acids Res in press 115
117. eport target se quences with a bit score of gt lt x gt domE lt x gt Inthe per domain output for target sequences that have already satisfied the per profile reporting threshold report individual domains with a conditional E value of lt lt x gt The default is 10 0 A conditional E value means the expected number of additional false positive domains in the smaller search space of those comparisons that already satisfied the per target reporting threshold and thus must have at least one homologous domain already domT lt x gt Instead of thresholding per domain output on E value instead report domains with a bit score of gt lt x gt Options for Inclusion Thresholds Inclusion thresholds are stricter than reporting thresholds Inclusion thresholds control which hits are con sidered to be reliable enough to be included in an output alignment or a subsequent search round or marked as significant as opposed to questionable in domain output incE lt x gt Use an E value of lt lt x gt as the per target inclusion threshold The default is 0 01 meaning that on average about 1 false positive would be expected in every 100 searches with different query sequences incT lt x gt Instead of using E values for setting the inclusion threshold instead use a bit score of gt lt x gt as the per target inclusion threshold By default this option is unset incdomE lt x gt Use a conditional E v
118. er W which is only present when the input sequence alignment is made up of DNA or RNA This represents an upper bound on the length at which nhmmer 29 expects to find an instance of the family It is always larger than mlen though the ratio of mlen to W depends on the observed insert rate in the seed alignment This length is used deep in the acceleration pipeline and modest changes are not expected to impact results but larger values of W do lead to longer run time The value can be overridden with the w_length or w_beta flags at the risk of possibly missing instances of the family that happen to be longer than W due to plentiful insertions Step 2 search the DNA sequence database with nhmmer We ll use tutorial dna_target fa as the target sequence database It is a FASTA format file containing one 330Kb long DNA sequence extracted from human chromosome 1 The program nhmmer accepts a target DNA sequence database in the same formats as hmmsearch we typically use FASTA For the query it accepts either an HMM file as produced above by hmmbuild or a file containing either one DNA sequence or an alignment of multiple DNA sequences If a sequence or alignment is used as query input nhmmer internally produces the HMM for that align ment then searches with that model The HMM produced in this way is automatically saved to disk the default file name is chosen by appending hmm to the name of the sequence file name This can b
119. erbi algorithm looks for one or more high scoring ungapped alignments If the MSV score passes a set threshold the entire sequence passes on to the next pipeline step else it is rejected Bias filter A hack that reduces false positive MSV hits due to biased composition sequences A two state HMM is constructed from the mean residue composition of the profile and the standard residue composition of the null model and used to score the sequence The MSV bit score is corrected using this as a second null hypothesis If the MSV score still passes the MSV threshold the sequence passes on to the next step else it is rejected The bias filter score correction will also be applied to the Viterbi filter and Forward filter scores that follow Viterbi filter A more stringent accelerated filter An optimal maximum likelinood gapped alignment score is calculated If this score passes a set threshold the sequence passes to the next step else it is rejected Forward filter parser The full likelinood of the profile sequence comparison is evaluated summed over the entire alignment ensemble using the HMM Forward algorithm This score is corrected to a bit score using the null model and bias filter scores If the bit score passes a set threshold the sequence passes on to the next step else it is rejected Domain identification Using the Forward parser results now combined with a Backward parser poste rior probabilities of domain locations are ca
120. erior probability You can use these posterior probabilities to decide which parts of the alignment are well determined or not You ll often observe for example that expected alignment accuracy degrades around locations of insertion and deletion which you d intuitively expect You ll also see expected alignment accuracy degrade at the ends of an alignment this is because alignment accuracy posterior probabilities currently not only includes whether the residue is aligned to one model position versus others but also confounded with whether a residue should be considered to be homologous aligned to the model somewhere versus not homologous at all These domain table and per domain alignment reports for each sequence then continue for each se quence that was in the per sequence top hits list Finally at the bottom of the file you ll see some summary statistics For example at the bottom of the Sit may make more sense to condition the posterior probabilities on the assumption that the residue is indeed homologous given that how likely is it that we ve got it correctly aligned 25 globins search output you ll find something like Internal pipeline statistics summary Query model s Target sequences Passed MSV filter Passed bias filter Passed Vit filter Passed Fwd filter Initial search space Z 4 539165 20801 17061 2321 1109 539165 149 nodes 191456931 residues searched 0 03858
121. ert state might correspond to more than one column the probability on an insert residue is not the probability that it belongs in that particular column again where there s a choice of column for inserted residues that choice is arbitrary The program hmmalign currently has a feature that we re aware of Recall that HMMER only does local alignments Here we know that we ve provided full length globin sequences and globins4 is a full length globin model We d probably like hmmalign to produce a global alignment It can t currently do that If it doesn t quite manage to extend its local alignment to the full length of a target globin sequence you ll get a weird looking effect as the nonmatching termini are pulled out to the left or right For example look at the N terminal g in MYG_HORSE above HMMER is about 80 confident that this residue is nonhomologous though any sensible person would align it into the first globin consensus column Look at the end of that first block of Stockholm alignment where you ll see HBBL_RANCA v HWTAEEKAVINSVWOKV DVEQDGHEALTRLFIVYPWTOQRYFSTFGD GR HBBL_RANCA PP 6 6799 4 RR RR RI RR IR IRR IO IR Kk HBB2_TRICR VHLTAEDRKE IAAI LGKV NVDSLGGOCLARLIVVNPWSRRYFHDFGD GR HBB2_TRICR PP 696 RR RR RRR I IIR RR IO I I Ok GC PP_cons GTOkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk xk GC RF XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX The Gc PP_cons line is Stockholm format consensus
122. es that make it through these filters are then subjected to a full probabilistic analysis using the HMM Forward Backward algorithms to identify hit envelopes then determine posterior probabilities for each aligned residue followed by optimal accuracy alignment The results of this step are what you finally see on the output The final number of hits and fractional coverage of the database is shown next This is typically smaller than the fraction of the database passing the Forward filter as hit identification typically trims windows down to a smaller envelope Finally nhmmer reports the speed of the search in units of Mc sec million dynamic programming cells per second the CPU time and the elapsed time This search took about 0 03 seconds of elapsed wall clock time There is not currently a DNA analog to jackhmmer Searching a profile HMM database with a query sequence In some cases rather than wishing to search a single model against a collection of sequences you may wish to annotate all the instances of a collection of HMMs found in a single sequence In the case of proteins hmmscan is for annotating all the different known detectable domains in a given protein sequence It takes a single query sequence and an HMM database as input The HMM database might be Pfam SMART or TIGRFams for example or another collection of your choice In the case of DNA the same purpose is met with nhmmscan In this case the HMM database might be Dfa
123. est possible impact on science decided that we should aim to replace BLAST with an entirely new generation of software The result is the HMMER3 project Thanks HMMER is increasingly not just my own work but the work of great people in my lab including Steve Johnson Alex Coventry Dawn Brooks Sergi Castellano Michael Farrar Travis Wheeler and Elena Rivas The current HMMER development team at Janelia Farm includes Sergi Michael and Travis as well as myself would call the Janelia computing environment world class except that it s even better than that That s entirely due to Goran Ceric HMMER3 testing now spins up thousands of processors at a time an unearthly amount of computing power Over the years the MRC LMB computational molecular biology discussion group contributed many ideas to HMMER In particular thank Richard Durbin Graeme Mitchison Erik Sonnhammer Alex Bate 112 man Ewan Birney Gos Micklem Tim Hubbard Roger Sewall David MacKay and Cyrus Chothia The UC Santa Cruz HMM group led by David Haussler and including Richard Hughey Kevin Karplus Anders Krogh now back in Copenhagen and Kimmen Sj lander has been a source of knowledge friendly competition and occasional collaboration All scientific competitors should be so gracious The Santa Cruz folks have never complained at least in my earshot that HMMER started as simply a re implementation of their original ideas just to teach myself what HMMs wer
124. ey ll come 10 Profile profile comparison A number of pioneering papers and software packages have demonstrated the power of profile profile comparison for even more sensitive remote homology detection We will aim to develop profile HMM methods in HMMER with improved detection power and at HMMER3 speed We also have some technical and usability issues we will be addressing Real Soon Now More alignment modes HMMER3 only does local alignment HMMER2 also could do glocal alignment align a complete model to a subsequence of the target and global alignment align a complete model to a complete target sequence The E value statistics of glocal and global alignment remain poorly understood HMMERS relies on accurate significance statistics far more so than HMMER2 did because HMMER3 s acceleration pipeline works by filtering out sequences with poor P values More speed Even on x86 platforms HMMER3 s acceleration algorithms are still on a nicely sloping bit of their asymptotic optimization curve We still think we can accelerate the code by another two fold or so perhaps more for DNA search Additionally for a small number of HMMs lt 1 of Pfam models the acceleration core is performing relatively poorly for reasons we pretty much understand having to do with biased composition most of these pesky models are hydrophobic membrane proteins but which are non trivial to work around This ll produce an annoying behavior that you may no
125. file in lt hmmfile gt lt hmmfile gt may be a dash character in which case profiles are read from a lt stdin gt pipe instead of from a file The columns are Options idx name accession nseq eff_nseq relent info p relE compKL h The index of this profile numbering each on in the file starting from 1 The name of the profile 3 The optional accession of the profile or if there is none The number of sequences that the profile was estimated from The effective number of sequences that the profile was estimated from after HM MER applied an effective sequence number calculation such as the default entropy weighting The length of the model in consensus residues match states Mean relative entropy per match state in bits This is the expected mean score per consensus position This is what the default entropy weighting method for effective sequence number estimation focuses on so for default HMMER3 models you expect this value to reflect the default target for entropy weighting Mean information content per match state in bits Probably not useful Information content is a slightly different calculation than relative entropy Mean positional relative entropy in bits This is a fancier version of the per match state relative entropy taking into account the transition insertion deletion proba bilities it may be a more accurate estimation of the average score cont
126. g less You can also control this number by setting an environment variable HM MER_NCPU This option is only available if HMMER was compiled with POSIX threads support This is the default but it may have been turned off for your site or machine for some reason For debugging the MPI master worker version pause after start to enable the developer to attach debuggers to the running master and worker s processes Send SIGCONT signal to release the pause Under gdb gdb signal SIGCONT Only available if optional MPI support was enabled at compile time Run in MPI master worker mode using mpirun Only available if optional MPI support was enabled at compile time 71 hmmsearch search profile s against a sequence database Synopsis hmmsearch options lt hmmfile gt lt seqdb gt Description hmmsearch is used to search one or more profiles against a sequence database For each profile in lt hmmfile gt use that query profile to search the target database of sequences in lt seqdb gt and output ranked lists of the sequences with the most significant matches to the profile To build profiles from multiple alignments see hmmbuild Either the query lt hmmfile gt or the target lt seqdb gt may be a dash character in which case the query profile or target database input will be read from a lt stdin gt pipe instead of from a file Only one input source can come through lt stdin gt not both An exception is that if
127. g that you may also want to set nobias to turn off another biased composition step called the bias filter which affects which sequences get scored at all The next three numbers are again an E value score and bias but only for the single best scoring do main in the sequence rather than the sum of all its identified domains The rationale for this isn t apparent in the globin example because all the globins in this example consist of only a single globin domain So let s set up a second example using a model of a single domain that s commonly found in multiple domains in a single sequence Build a fibronectin type III domain model using the tutorial fn3 sto alignment this happens to be a Pfam seed alignment it s a good example of an alignment with complex Stockholm anno tation Then use that model to analyze the sequence tutorial 7LESS_DROME the Drosophila Sevenless receptor tyrosine kinase gt hmmbuild fn3 hmm tutorial fn3 sto gt hmmsearch fn3 hmm tutorial 7LESS_DROME gt fn3 out An example of what that output file will look like is provided in tutorial fn3 out The sequence top hits list says full sequence best 1 domain dom E value score bias E value score bias exp N Sequence Description 1 9e 57 178 0 0 4 1 2e 16 47 2 0 9 9 4 9 7LESS_DROME RecName Full Protein sevenless OK now let s pick up the explanation where we left off The total sequence score of 178 0 sums up all the fibronectin IIl
128. ge cost in speed Set the P value threshold for the MSV filter step The default is 0 02 meaning that roughly 2 of the highest scoring nonhomologous targets are expected to pass the filter Set the P value threshold for the Viterbi filter step The default is 0 001 Set the P value threshold for the Forward filter step The default is 1e 5 Turn off the bias filter This increases sensitivity somewhat but can come at a high cost in speed especially if the query has biased residue composition Such as a repetitive sequence region or if it is a membrane protein with large regions of hydrophobicity Without the bias filter too many sequences may pass the filter with biased queries leading to slower than expected performance as the compu tationally intensive Forward Backward algorithms shoulder an abnormally heavy load Turn off the null2 score corrections for biased composition Assert that the total number of targets in your searches is lt x gt for the purposes of per sequence E value calculations rather than the actual number of targets seen 95 seed lt n gt qformat lt s gt w_beta lt x gt w_length lt n gt toponly bottomonly cpu lt n gt stall mpi Set the random number seed to lt n gt Some steps in postprocessing require Monte Carlo simulation The default is to use a fixed seed 42 so that results are exactly reproducible Any other positive integer will give different but
129. gic in searching many queries against many targets is For each query search the target database then rewind the target database to the beginning For hmmsearch the profiles are queries and sequences are targets For hmmscan the reverse In general HMMER and Easel programs document in their man page whether and which command line arguments can be replaced by You can always check by trial and error too The worst that can happen is a Failed to open file error message if the program can t read from pipes 50 7 Manual pages alimask Add mask line to a multiple sequence alignment Synopsis alimask options lt msafile gt lt postmsafile gt Description alimask is used to apply a mask line to a multiple sequence alignment based on provided alignment or model coordinates When hmmbuild receives a masked alignment as input it produces a profile model in which the emission probabilities at masked positions are set to match the background frequency rather than being set based on observed frequencies in the alignment Position specific insertion and deletion rates are not altered even in masked regions alimask autodetects input format and produces masked alignments in Stockholm format lt msafile gt may contain only one sequence alignment A common motivation for masking a region in an alignment is that the region contains a simple tandem repeat that is observed to cause an unacceptably high rate of false posit
130. gnments are used Using MSV a sequence is either rejected or accepted in its entirety In the scanning SSV filter of nnmmer each sequence in the database is scanned for high scoring ungapped alignment segments and a window around each such segment is extracted merging overlapping windows 31 and passed on to the next stage By default nhmmer is configured to allow sequence segments with a P value of lt 0 02 through the SSV score filter thus if the database contained no homologs and P values were accurately calculated the highest scoring 2 of the sequence will pass the filter Here 61658 bases or about 9 of the database got through the SSV filter The quick bias filter is then applied as in hmmsearch Here 45802 bases roughly 7 of the database pass through the bias filter The Viterbi filter then calculates a gapped optimal alignment score for each window that survived the earlier stages This score is a closer approximation than the SSV score of the final score that the window will achieve if it survives to final processing but the Viterbi filter is about four fold slower than SSV By default nhmmer lets windows with a P value of lt 0 001 through this stage Here 2443 bases about 0 4 of the database gets through Then the full Forward score is calculated which sums over all possible alignments of the profile to the window The default allows windows with a P value of lt 107 through 2217 bases passed All sequenc
131. h in simulation that estimates the location parameter tau for Forward E values Default is 100 EfN lt n gt Sets the number of sequences in simulation that estimates the location parameter tau for Forward E values Default is 200 Eft lt x gt Sets the tail mass fraction to fit in the simulation that estimates the location param eter tau for Forward evalues Default is 0 04 79 Debugging Options stall Seed lt n gt Experimental Options For debugging the MPI master worker version pause after start to enable the developer to attach debuggers to the running master and worker s processes Send SIGCONT signal to release the pause Under gdb gdb signal SIGCONT Only available if optional MPI support was enabled at compile time Set the random number seed to lt n gt The default is 0 which makes the random number generator use an arbitrary seed so that different runs of hmmsim will almost certainly generate a different statistical sample For debugging it is useful to force reproducible results by fixing a random number seed These options were used in a small variety of different exploratory experiments bgflat bgcomp x no lengthmodel NU lt x gt pthresh lt x gt Set the background residue distribution to a uniform distribution both for purposes of the null model used in calculating scores and for generating the random se quences The default is to use a standard amino acid backgro
132. he nobias option turns off bypasses the biased composition filter The simple null model is used as a null hypothesis for MSV and in subsequent filter steps The biased composition filter step compromises a small amount of sensitivity Though it is good to have it on by default you may want to shut it off if you know you will have no problem with biased composition hits At the end of a search output you will see a line like Passed bias filter 105665 0 019849 expected 106468 8 0 02 which tells you how many and what fraction of comparisons passed the biased composition filter versus how many were expected If the filter was turned off all comparisons pass Viterbi filter The sequence is now aligned to the profile using a fast Viterbi algorithm for optimal gapped alignment This Viterbi implementation is specialized for speed It is implemented in 8 way parallel SIMD vector instructions using reduced precision scores that have been scaled to 16 bit integers Only one row of the dynamic programming matrix is stored so the routine only recovers the score not the optimal alignment itself The reduced representation has limited range local alignment scores will not underflow but high scoring comparisons can overflow and return infinity in which case they automatically pass the filter The final Viterbi filter bit score is then computed using the appropriate null model log likelihood by default the biased composition filter model s
133. hit is found Note that end can be smaller than start indicating a hit found on the reverse complement of the target database sequence Note that one of the five reported hits falls below the inclusion threshold The observant reader will notice that the first two hits cover the same range of positions one on the for ward strand 302390 302466 the other on the reverse 302466 302390 The next two hits likewise cover a shared range This happens because the MADE1 model is palindromic the consensus is almost perfectly so and highlights the important facts that a nhmmer searches on both strands of an input sequence and b this can sometimes lead to overlapping opposite strand hits which are not filtered Then comes the third output section which starts with Annotation for each hit and alignments 5W is based on position specific insert rates only 1e 7 of all sequences generated from the profile HMM will have length greater than W SUsing default hmmbuild parameters if you want more control explicitly built the model with hmmbuild 30 For each hit in the top hits list there will be a one line table providing detailed information about the hit followed by the alignment inferred for the hit The first entry from the mapE1 example above looks like gt gt humanchr1 239220001 239550000 score bias Evalue hmmfrom hmm to alifrom ali to envfrom env to sq len acc i 39 0 7 4 8 4e 11 4 80 302390 302466 3
134. hmmalign globins4 hmm tutorial globins45 fa The output of this is a Stockholm format multiple alignment file The first few lines of it look like STOCKHOLM 1 0 MYG_ESCGI VLSDAEWOLVLNIWAKVEADVAGHGODILIRLFKGHPETLEKFDKFKH GR MYG_ESCGI PP 1 69k eR RRR KR RRR RR RR RRR OO AA k k MYG_HORSE g LSDGEWOOVLNVWGKVEADIAGHGOEVLIRLFTGHPETLEKFDKFKH H GR MYG_HORSE PP 8 89xxx xx x RI IR RR IR IO RAR RR RRA Ok MYG_PROGU g LSDGEWOLVLNVWGKVEGDLSGHGOEVLIRLFKGHPETLEKFDKFKH GR MYG_PROGU PP 8 89xxx xx x RI IR IR KARA RARA RR RRA MYG_SAISC g LSDGEWOLVLNIWGKVEADIPSHGOEVLISLFKGHPETLEKFDKFKH GR MYG_SATSC PP 8 B9x RR RR RARA RRA RAR RRA RR RRA e k k k k k MYG_LYCPI g LSDGEWQIVLNIWGKVETDLAGHGOEVLIRLFKNHPETLDKFDKFKH H GR MYG_LYCPI PP 8 89m RR I IR IRI IO IR RR I I Ok MYG_MOUSE g LSDGEWOLVLNVWGKVEADLAGHGOEVLIGLFKTHPETLDKFDKFKN GR MYG_MOUSE PP 8 89 RRR I IR I RI IOI RR I I Ok MYG_MUSAN v DWEKVNSVWSAVESDLTAIGONILLRLFEQYPESONHFPKFKN and so on First thing to notice here is that hmmalign uses both lower case and upper case residues and it uses two different characters for gaps This is because there are two different kinds of columns match columns in which residues are assigned to match states and gaps are treated as deletions relative to consensus and insert columns where residues are assigned to insert states and gaps in other sequences are just padding for the alignment to accomodate those insertions In a match column resid
135. holds are less stringent than GA in the context of Pfam they are generally used to store the score of the highest scoring known false positive Use the NC trusted cutoff bit score threshold in the model to set per hit reporting and inclusion thresholds TC thresholds are more stringent than GA and are gen erally considered to be the score of the lowest scoring known true positive that is above all known false positives for example in Dfam these thresholds are applied when annotating a genome with a model of a family not known to be found in that organism Options Controlling the Acceleration Pipeline HMMERS searches are accelerated in a three step filter pipeline the scanning SSV filter the Viterbi filter and the Forward filter The first filter is the fastest and most approximate the last is the full Forward scoring algorithm There is also a bias filter step between SSV and Viterbi Targets that pass all the steps in the acceleration pipeline are then subjected to postprocessing domain identification and scoring using the Forward Backward algorithm Changing filter thresholds only removes or includes targets from consideration changing filter thresholds does not alter bit scores E values or alignments all of which are determined solely in postprocessing max F1 lt x gt F2 lt x gt F3 lt x gt nobias Other Options tformat lt s gt qformat lt s gt Turn off nearly all filters incl
136. ich hits are reported in output files the main output tblout and dfamtblout Hits are ranked by statistical significance E value E lt x gt Report target profiles with an E value of lt lt x gt The default is 10 0 meaning that on average about 10 false positives will be reported per query so you can see the top of the noise and decide for yourself if it s really noise T lt x gt Instead of thresholding output on E value instead report target profiles with a bit score of gt lt x gt Options for Inclusion Thresholds Inclusion thresholds are stricter than reporting thresholds Inclusion thresholds control which hits are con sidered to be reliable enough to be included in an output alignment or a subsequent search round In nhmmscan which does not have any alignment output like nhmmer inclusion thresholds have little ef fect They only affect what hits get marked as significant or questionable in hit output incE lt x gt Use an E value of lt lt x gt as the inclusion threshold The default is 0 01 meaning that on average about 1 false positive would be expected in every 100 searches with different query sequences incT lt x gt Instead of using E values for setting the inclusion threshold use a bit score of gt lt x gt as the inclusion threshold It would be unusual to use bit score thresholds with hmmscan because you don t expect a single score threshold to work for different profiles
137. ier to parse The o option allows redirecting the main output including throwing it away in dev null Options h Help print a brief reminder of command line usage and all available options Options for Controlling Output o lt f gt Direct the main human readable output to a file lt f gt instead of the default stdout tblout lt f Save a simple tabular space delimited file summarizing the per hit output with one data line per homologous target model hit found dfamiblout lt f gt Save a tabular space delimited file summarizing the per hit output similar to tblout but more succinct aliscoresout lt f gt Save to file a list of per position scores for each hit This is useful for example in identifying regions of high score density for use in resolving overlapping hits from different models acc Use accessions instead of names in the main output where available for profiles and or sequences noali Omit the alignment section from the main output This can greatly reduce the output volume 93 notextw Unlimit the length of each line in the main output The default is a limit of 120 characters per line which helps in displaying the output cleanly on terminals and in editors but can truncate target profile description lines textw lt n gt Set the main output s line length limit to lt n gt characters per line The default is 120 Options for Reporting Thresholds Reporting thresholds control wh
138. ies to be installed by you other than standard ANSI C99 libraries that should already be present on a system that can compile C code Bundling Easel instead of making it a separate installation requirement is a deliberate design decision to simplify the installation process Configuration and compilation use several UNIX utilities Although these utilities are available on all UNIX Linux MacOS systems old versions may not support all the features the configure script and Makefiles are hoping to find We aim to build on anything even old Ebay ed junk but if you have an old system you may want to hedge your bets and install up to date versions of GNU tools such as GNU make and GNU grep Multithreaded parallelization for multicores is the default The six search programs and hmmbuild support multicore parallelization using POSIX threads By default the configure script will identify whether your platform supports POSIX threads almost all platforms do and will automatically compile in multithreading support If you want to disable multithreading at compile time recompile from source after giving the disable threads flag to configure By default our multithreaded programs will use all available cores on your machine You can control the number of cores each HMMER process will use for computation with the cpu lt x gt command line option or the HMMER_NCPU environment variable Even with a single processing thread cpu 1 HMMER will
139. if optional MPI support was enabled at compile time 92 nhmmscan search nucleotide sequence s against a nucleotide profile Synopsis hmmescan options lt hmmdb gt lt seqfile gt Description nhmmscan is used to search nucleotide sequences against collections of nucleotide profiles For each sequence in lt seqfile gt use that query sequence to search the target database of profiles in lt hmmab gt and output ranked lists of the profiles with the most significant matches to the sequence The lt segfile gt may contain more than one query sequence It can be in FASTA format or several other common sequence file formats genbank embl and uniprot among others or in alignment file formats stockholm aligned fasta and others See the gformat option for a complete list The lt hmmdb gt needs to be press ed using hmmpress before it can be searched with hmmscan This creates four binary files suffixed h3 fimp The query lt seqfile gt may be a dash character in which case the query sequences are read from a lt stdin gt pipe instead of from a file The lt hmmdb gt cannot be read from a lt stdin gt stream because it needs to have those four auxiliary binary files generated by hmmpress The output format is designed to be human readable but is often so voluminous that reading it is impractical and parsing it is a pain The tblout option saves output in a simple tabular format that is concise and eas
140. ight annotated or none of them can Ac lt s gt Accession lt s gt is a database accession number for this sequence Compare the cF Ac markup which gives an accession for the whole alignment One word 107 DE lt s gt Description lt s gt is one line giving a description for this sequence Compare the cr DE markup which gives a description for the whole alignment recognized GC annotations RF Reference line Any character is accepted as a markup for a column The intent is to allow labeling the columns with some sort of mark mm Model mask line An m indicates that the column lies within a masked range so that hmmbuild should produce emissions matching the background for a match state corresponding to that align ment column Otherwise a is used SS_cons Secondary structure consensus For protein alignments DSSP codes or gaps are accepted as markup HGIEBTSCX _ where H is alpha helix G is 3 10 helix is p helix E is extended strand B is a residue in an isolated b bridge T is a turn S is a bend C is a random coil or loop and X is unknown for instance a residue that was not resolved in a crystal structure SA_cons Surface accessibility consensus 0 9 gap symbols or X are accepted as markup 0 means lt 10 accessible residue surface area 1 means lt 20 9 means lt 100 etc X means unknown structure recognized GR annotations ss Secondary structure consensus See Gc SS_cons above sa
141. iled with POSIX threads support This is the default but it may have been turned off at compile time for your site or machine for some reason For debugging the MPI master worker version pause after start to enable the developer to attach debuggers to the running master and worker s processes Send SIGCONT signal to release the pause Under gdb gdb signal SIGCONT Only available if optional MPI support was enabled at compile time Run in MPI master worker mode using mpirun Only available if optional MPI support was enabled at compile time 101 8 File formats HMMER profile HMM files The file tutorial f n3 hmm gives an example of a HMMER3 ASCII save file An abridged version is shown here where mark deletions made for clarity and space HMMER3 3 1 February 2013 NAME n3 ACC PF0O0041 13 DESC Fibronectin type III domain LENG 86 ALPH amino RF no MM no CONS yes cs yes MAP yes DATE Fri Feb 15 06 04 13 2013 NSEQ 106 EFFN 11 415833 CKSUM 3564431818 GA 8 00 7 20 TC 8 00 7 20 NC 7 90 7 90 STATS LOCAL MSV 9 4043 0 71847 STATS LOCAL VITERBI 9 7737 0 71847 STATS LOCAL FORWARD 3 8341 0 71847 HMM A Cc D E F G H I C m gt m m gt i m gt d i gt m Teri d gt m d gt d COMPO 2 70330 4 91262 3 03272 2 64079 3 60307 2 84344 3 74204 3 07942 3 21526 2 68618 4 42225 2 77519 2 73123 3 46354 2 40513 3 72494 3 29354 3 61503 0 00338 6 08833 6 81068 0 61958 0 77255 0 00000 1 3 16986 5 2144
142. in hmmpgmd format containing protein sequences The contents of this file will be cached for searches Name of the file containing protein HMMs The contents of this file will be cached for searches Number of parallel threads to use for worker 66 hmmpress prepare an HMM database for hmmscan Synopsis hmmpress options lt hmmfile gt Description Starting from a profile database lt hmmfile gt in standard HMMER3 format construct binary compressed datafiles for hmmscan The hmmpress step is required for hmmscan to work Four files are created lt hmmfile gt h3m lt hmmfile gt h3i lt hmmfile gt h3f and lt hmmfile gt h3p The lt hmmfile gt h3m file contains the profile HMMs and their annotation in a binary format The lt hmmfile gt h3i file is an SSI index for the lt hmmfile gt h3m file The lt hmmfile gt h3f file contains precomputed data structures for the fast heuristic filter the MSV filter The lt hmmfile gt h3p file contains precomputed data structures for the rest of each profile lt hmmfile gt may not be dash running hmmpress on a standard input stream rather than a file is not allowed Options h Help print a brief reminder of command line usage and all available options f Force overwrites any previous hmmpress ed datafiles The default is to bitch about any existing files and ask you to delete them first 67 hmmscan search protein sequence s against a protein profile
143. in the header then this is an integer representing the alignment column index for this match state 1 alen otherwise this field is The next field is the cons consensus residue for this node If cons was yes in the header then this is a single character representing the consensus residue annotation for this match state otherwise this field is The next field is the rr annotation for this node If kr was yes in the header then this is a single character representing the reference annotation for this match state otherwise this field is The next field is the mm mask value for this node If mm was yes in the header then this is a single m character indicating that the position was identified as a masked position during model construction otherwise this field is The next field is the cs annotation for this node If cs was yes then this is a single character representing the consensus structure at this match state otherwise this field is Insert emission line The K fields on this line are the insert emission scores one per symbol in alphabetic order State transition line The seven fields on this line are the transitions for node k in the order shown by the transition header line Mg Mk 1 Ik Dk 1 Ik gt Mk 1 Ik Dk gt Mk 1 Dri For transitions from the final node M match state M 1 is interpreted as the END state E and there is no delete state M 1 therefore the final M
144. ion independent scoring parame ters This property of profiles captures important information about the degree of conservation at various positions in the multiple alignment and the varying degree to which gaps and insertions are permitted The advantage of using HMMs is that HMMs have a formal probabilistic basis We use probability theory to guide how all the scoring parameters should be set Though this might sound like a purely academic issue this probabilistic basis lets us do things that more heuristic methods cannot do easily One of the most important is that HMMs have a consistent theory for setting position specific gap and insertion scores The methods are consistent and therefore highly automatable allowing us to make libraries of hundreds of profile HMMs and apply them on a very large scale to whole genome analysis One such database of protein domain models is Pfam Sonnhammer et al 1997 Finn et al 2010 which is a significant part of the Interpro protein domain annotation system Mulder et al 2003 The construction and use of Pfam is tightly tied to the HMMER software package Profile HMMs do have important limitations One is that HMMs do not capture any higher order corre lations An HMM assumes that the identity of a particular position is independent of the identity of all other positions Profile HMMs are often not good models of structural RNAs for instance because an HMM cannot describe base pairs Applications of p
145. ion parameter as determined by H3 s estimation procedures Slope parameter as determined by H3 s estimation procedures The E value calculated for the 10th ranked score using pmu plambda At the end of this table one more line is printed starting with and summarizing the overall CPU time used by the simulations Some of the optional output files are in xmgrace xy format xmgrace is powerful and freely available graph plotting software Miscellaneous Options h a V L lt n gt N lt n gt mpi Help print a brief reminder of command line usage and all available options Collect expected Viterbi alignment length statistics from each simulated sequence This only works with Viterbi scores the default see vit Two additional fields are printed in the output table for each model the mean length of Viterbi alignments and the standard deviation Verbose Print the scores too one score per line Set the length of the randomly sampled nonhomologous sequences to lt n gt The default is 100 Set the number of randomly sampled sequences to lt n gt The default is 1000 Run in MPI parallel mode under mpirun It is parallelized at the level of sending one profile at a time to an MPI worker process so parallelization only helps if you have more than one profile in the lt hmmfile gt and you want to have at least as many profiles as MPI worker processes Only available if optional MPI support w
146. ions in myqueries list fetches them one by one from Pfam and does an hmmsearch with each of them against UniProt As above the cat myqueries list part can be replaced by any suitable incantation that generates a list of profile names accessions There are three kinds of cases where using is restricted or doesn t work A fairly obvious restriction is that you can only use one per command you can t do a hmmsearch that tries to read both profile queries and sequence targets through the same stdin pipe Second another case is when an input file must be obligately associated with additional separately generated auxiliary files so reading data from a single stream using doesn t work because the auxiliary files aren t present in this case using will be prohibited by the program An example is hmmscan which needs its lt hmmfile gt argument to be associated with four auxiliary files named lt hmmfile gt h3 mifp that hmmpress creates SO hmmscan does not permit a for its lt hmmfile gt argument Finally when a command would require multiple passes over an input file the command will generally abort after the first pass if you are trying to read that file through a standard input pipe pipes are nonrewindable in general a few HMMER or Easel programs will buffer input streams to make multiple passes possible but this is not usually the case An example would be trying to search a file containing multiple profile
147. is hmmsim options lt hmmfile gt Description The hmmsim program generates random sequences scores them with the model s in lt hmmfile gt and outputs various sorts of histograms plots and fitted distributions for the resulting scores hmmsim is not a mainstream part of the HMMER package Most users would have no reason to use it It is used to develop and test the statistical methods used to determine P values and E values in HMMER3 For example it was used to generate most of the results in a 2008 paper on H3 s local alignment statistics PLoS Comp Bio 4 e1000069 2008 http www ploscompbiol org doi pcbi 1000069 Because it is a research testbed you should not expect it to be as robust as other programs in the package For example options may interact in weird ways we haven t tested nor tried to anticipate all different possible combinations The main task is to fit a maximum likelihood Gumbel distribution to Viterbi scores or an maximum likelihood exponential tail to high scoring Forward scores and to test that these fitted distributions obey the conjecture that lambda log_2 for both the Viterbi Gumbel and the Forward exponential tail The output is a table of numbers one row for each model Four different parametric fits to the score data are tested 1 maximum likelihood fits to both location mu tau and slope lambda parameters 2 assuming lambda log_2 maximum likelihood fit to the location parameter only 8 same
148. ival plots P S gt x to file lt f gt in XMGRACE xy format There are three plots 1 the observed score distribution 2 the maximum like lihood fitted distribution 3 a maximum likelihood fit to the location parameter mu tau while assuming lambda log_2 Output the bit scores as a binary array of double precision floats 8 bytes per score to file lt f gt Programs like Easel s esl histplot can read such binary files This is useful when generating extremely large sample sizes Options Controlling Model Configuration mode H3 only uses multihit local alignment fs mode and this is where we believe the statistical fits Unihit local alignment scores Smith Waterman sw mode also obey our statistical conjectures Glocal alignment statistics either multihit or unihit are still not adequately understood nor adequately fitted ts SW Is Collect multihit local alignment scores This is the default alignment as fragment search mode Collect unihit local alignment scores The H3 J state is disabled alignment as Smith Waterman search mode Collect multihit glocal alignment scores In glocal global local alignment the en tire model must align to a subsequence of the target The H3 local entry exit tran sition probabilities are disabled Ils comes from HMMER2 s historical terminology for multihit local alignment as local search mode Collect unihit glocal alignment scores Both the H3
149. ive hits In the simplest case a mask range is given in coordinates relative to the input alignment using alirange lt s gt However it is more often the case that the region to be masked has been identified in coordinates relative to the profile model e g based on recognizing a simple repeat pattern in false hit alignments or in the HMM logo Not all alignment columns are converted to match state positions in the profile see the sym rac flag for hmmbuild for discussion so model positions do not necessarily match up to alignment column positions To remove the burden of converting model positions to alignment positions alimask accepts the mask range input in model coordinates as well using modelrange lt s gt When using this flag alimask determines which alignment positions would be identified by hmmbuild as match states a process that requires that all hmmbuild flags impacting that decision be supplied to alimask It is for this reason that many of the hmmbuild flags are also used by alimask Options h Help print a brief reminder of command line usage and all available options o lt f gt Direct the summary output to file lt f gt rather than to stdout Options for Specifying Mask Range A single mask range is given as a dash separated pair like modelrange 10 20 and multiple ranges may be submitted as a comma separated list modelrange 10 20 30 42 modelrange lt s gt Supply the given range s in model coordin
150. l It s an average calculated as a weighted marginal sum over all possible alignments Because it s an average it isn t necessarily a round integer The second the column marked N is the number of domains that HMMER s domain postprocessing and annotation pipeline finally decided to identify annotate and align in the target sequence This is the number of alignments that will show up in the domain report later in the output file These two numbers should be about the same Rarely you might see that they re wildly different and this would usually be a sign that the target sequence is so highly repetitive that it s confused the HUMMER domain postprocessors Such sequences aren t likely to show up as significant homologs to any sensible query in the first place The sequence top hits output continues until it runs out of sequences to report By default the report includes all sequences with an E value of 10 0 or less Then comes the third output section which starts with Domain annotation for each sequence and alignments Now for each sequence in the top hits list there will be a section containing a table of where HMMER thinks all the domains are followed by the alignment inferred for each domain Let s use the n3 vs 7LESS_DROME example because it contains lots of domains and is more interesting in this respect than the 22 globin4 output The domain table for 7LESS_DRomE looks like gt gt TLESS_DROME RecN
151. lculated A discrete set of putative domains alignments is identified by applying heuristics to posterior probabilities This procedure identifies envelopes sub sequences on the target sequence which contain a lot of probability mass for a match to the profile Alignment For each identified domain a full Forward Backward algorithm is performed An ad hoc null2 hypothesis is constructed for each domain s composition and used to calculate a biased composition score correction A maximum expected accuracy MEA alignment is calculated This identifies one MEA alignment within each envelope Storage Now we have a sequence score and P value the sequence contains one or more domains each of which has a domain score and P value and each domain has an MEA alignment annotated with per residue posterior probabilities In more detail each step is described in subsections that follow Even more detail may be found in Eddy 2011 TCode gurus and masochists you can follow along in src p7_pipeline c 37 Null model The null model calculates the probability that the target sequence is not homologous to the query profile A HMMER bit score is the log of the ratio of the sequence s probability according to the profile the homology hypothesis over the null model probability the non homology hypothesis The null model is a one state HMM configured to generate random sequences of the same mean length L as the target
152. le named lt prefix gt lt n gt hmm where lt n gt is the iteration number from 1 N 82 chkali lt prefix gt At the end of each iteration checkpoint an alignment of all domains satisfying inclusion thresholds e g what will become the query HMM for the next iteration saving it to a file named lt checkpoint file prefix gt lt n gt sto in Stockholm format where lt n gt is the iteration number from 1 N acc Use accessions instead of names in the main output where available for profiles and or sequences noali Omit the alignment section from the main output This can greatly reduce the output volume notextw Unlimit the length of each line in the main output The default is a limit of 120 characters per line which helps in displaying the output cleanly on terminals and in editors but can truncate target profile description lines textw lt n gt Set the main output s line length limit to lt n gt characters per line The default is 120 Options Controlling Single Sequence Scoring first Iteration By default the first iteration uses a search model constructed from a single query sequence This model is constructed using a standard 20x20 substitution matrix for residue probabilities and two additional pa rameters for position independent gap open and gap extend probabilities These options allow the default single sequence scoring parameters to be changed popen lt x gt Set the gap open probability for
153. line from a Stockholm alignment file If this is not present the name is created from the name of the alignment file by removing any file type suffix For example an otherwise nameless HMM built from the alignment file rrm s1x would be named rrm Mandatory acc lt s gt Accession number lt s gt is a one word accession number This is picked up from the GF AC line in a Stockholm format alignment Optional DESC lt s gt Description line lt s gt is a one line free text description This is picked up from the GF DE line in a Stockholm alignment file Optional LENG lt d gt Model length lt d gt a positive nonzero integer is the number of match states in the model Mandatory MAXL lt d gt Max instance length lt d gt a positive nonzero integer is the upper bound on the length at which and instance of the model is expected to be found Used only by nhmmer and nhmmscan Op tional ALPH lt s gt Symbol alphabet type For biosequence analysis models lt s gt iS amino DNA Or RNA case in sensitive There are also other accepted alphabets for purposes beyond biosequence analysis including coins dice and custom This determines the symbol alphabet and the size of the sym bol emission probability distributions If amino the alphabet size K is set to 20 and the symbol alphabet to ACDEFGHIKLMNPQRSTVWY alphabetic order if bna the alphabet size K is set to 4 and the symbol alphabet to ACGT if R
154. ll sequence The biased composition correction as above 16 description of target The remainder of the line is the target s description line as free text These tables are columnated neatly for human readability but do not write parsers that rely on this columnation rely on space delimited fields The pretty columnation assumes fixed maximum widths for each field If a field exceeds its allotted width it will still be fully represented and space delimited but the columnation will be disrupted on the rest of the row Note the use of target and query columns A program like hmmsearch searches a query profile against a target sequence database In an hmmsearch tblout file the sequence target name is first and the profile query name is second A program like hmmscan on the other hand searches a query sequence against a target profile database In a hmmscan tblout file the profile name is first and the sequence name is second You might say hey wouldn t it be more consistent to put the profile name first and the sequence name second or vice versa SO hmmsearch and hmmscan tblout files were identical Well first of all they still wouldn t be identical because the target database size used for E value calculations is different number of target sequences for hmmsearch number of target profiles for hmmscan and it s good not to forget this Second what about programs like phmmer where the query is a Sequence and the targets are also
155. lues are as described above for sequence scores but are the score of just one domain s envelope The first of the two E values is the conditional E value This is an odd number and it s not even clear were going to keep it Pay attention to what it means It is an attempt to measure the statistical significance of each domain given that we ve already decided that the target sequence is a true homolog It is the expected number of additional domains we d find with a domain score this big in the set of sequences reported in the top hits list if those sequences consisted only of random nonhomologous sequence outside the region that sufficed to define them as homologs The second number is the independent E value the significance of the sequence in the whole database search if this were the only domain we had identified It s exactly the same as the best 1 domain E value in the sequence top hits list The different between the two E values is not apparent in the 7LESS_DROME example because in both cases the size of the search space as 1 sequence There s a single sequence in the target sequence database that s the size of the search space that the independent best single domain E value depends on There s one sequence reported as a putative homolog in the sequence top hits list that s the size of the search space that the conditional E value depends on A better example is to see what happens when we search UniProt 2013_02 contai
156. m a database of HMMs for transposable element families or a collection of conserved regulatory elements Here we show an example of using hmmscan which you will see produces output very much like that of hmmsearch We omit details of running nhmmscan it is run in the same way as hmmscan and its output matches that of nhmmer Step 1 create an HMM database flatfile An HMM database flatfile is simply a concatenation of individual HMM files To create a database flat file you can either build individual HMM files and concatenate them or you can concatenate Stockholm alignments and use hmmbuild to build an HMM database of all of them in one command Let s create a tiny database called minifam containing models of globin fn3 and Pkinase protein kinase domains by concatenating model files gt hmmbuild globins4 hmm tutorial globins4 sto gt hmmbuild fn3 hmm tutorial fn3 sto gt hmmbuild Pkinase hmm tutorial Pkinase sto gt cat globins4 hmm n3 hmm Pkinase hmm gt minifam We ll use minifam for our examples in just a bit but first a few words on other ways to build HMM databases especially big ones The file tutorials minifam is the same thing if you want to just use that 32 Alternatively you can concatenate Stockholm alignment files together as Pfam does in its big P am A seed and Pfam A full flatfiles and use hmmbuild to build HMMs for all the alignments at once This won t work properly for our tutorial alignmen
157. mance as the compu tationally intensive Forward Backward algorithms shoulder an abnormally heavy load Options Controlling Profile Construction later Iterations These options control how consensus columns are defined in multiple alignments when building profiles By default jackhmmer always includes your original query sequence in the alignment result at every iteration and consensus positions are defined by that query sequence that is a default jackhmmer profile is always the same length as your original query at every iteration fast Define consensus columns as those that have a fraction gt symfrac of residues as opposed to gaps See below for the symfrac option Although this is the default profile construction option elsewhere in hmmbuild in particular it may have undesirable effects in jackhmmer because a profile could iteratively walk in sequence space away from your original query leaving few or no consensus columns corresponding to its residues 85 hand symfrac lt x gt fragthresh lt x gt Define consensus columns in next profile using reference annotation to the multiple alignment jackhmmer propagates reference annotation from the previous profile to the multiple alignment and thence to the next profile This is the default Define the residue fraction threshold necessary to define a consensus column when using the fast option The default is 0 5 The symbol fraction in each column is calcula
158. mand line s that reproduce the problem e Copies of any files we need to run those command lines e Information about what kind of hardware you re on what operating system and if you compiled the software yourself rather than running precompiled binaries what compiler and version you used with what configuration arguments Depending on how glaring the bug is we may not need all this information but any work you can put into giving us a clean reproducible test case doesn t hurt and often helps The information about hardware operating system and compiler is important Bugs are frequently specific to particular configurations of hardware OS compiler We have a wide variety of systems available for trying to reproduce bugs and we ll try to match your system as closely as we can If you first see a problem on some huge compute like running a zillion query sequence over a huge profile database it will really really help us if you spend a bit of time yourself trying to isolate whether the problem really only manifests itself on that huge compute or if you can isolate a smaller test case for us The ideal bug report for us gives us everything we need to reproduce your problem in one email with at most some small attachments Remember we re not a company with dedicated support staff we re a small lab of busy researchers like you Somebody here is going to drop what they re doing to try to help you out Try to save us some time an
159. n t used accidentally Why is the output of make so clean Because we re hiding what s really going on with the compilation with a pretty wrapper If you want to see what the command lines really look like in all their ugly glory pass a v 1 option V for verbose to make as in gt make V 1 What gets installed by make install and where HMMER s make install generally follows the GNU Coding Standards and the Filesystem Hierarchy Stan dard The top level Makefile has variables that specify five directories where make install will install things Variable What bindir All HMMER programs libdir libhmmer a includedir hmmer h manldir All HAMMER man pages pdfdir Userguide pdf These variables are constructed from some other variables in accordance with the GNU Coding Stan dards All of these variables are at the top of the top level Makefile Their defaults are as follows 14 Variable Default prefix usr local exec_prefix Sprefix bindir Sexec_prefix bin libdir Sexec_prefix lib includedir Sprefix include datarootdir Sprefix share mandir Sdatarootdir man manidir Smandir manl The best way to change these defaults is when you use configure and the most important variable to consider changing is prefix For example if you want to install HMMER in a directory hierarchy all of its own you might want to do something like gt configure prefix usr local hmmer That would keep HMMER
160. nclusion thresholds TC thresholds are more stringent than GA and are gen erally considered to be the score of the lowest scoring known true positive that is above all known false positives for example in Dfam these thresholds are applied when annotating a genome with a model of a family not known to be found in that organism Control of the Acceleration Pipeline HMMERS searches are accelerated in a three step filter pipeline the scanning SSV filter the Viterbi filter and the Forward filter The first filter is the fastest and most approximate the last is the full Forward scoring algorithm There is also a bias filter step between SSV and Viterbi Targets that pass all the steps in the acceleration pipeline are then subjected to postprocessing domain identification and scoring using the Forward Backward algorithm Changing filter thresholds only removes or includes targets from consideration changing filter thresholds does not alter bit scores E values or alignments all of which are determined solely in postprocessing max F1 lt x gt F2 lt x gt F3 lt x gt nobias Other Options nonull2 Z lt x gt Turn off nearly all filters including the bias filter and run full Forward Backward postprocessing on most of the target sequence In contrast to hmmscan the max flag in nhhmmscan sets the scanning SSV filter threshold to 0 4 not 1 0 Use of this flag increases sensitivity somewhat at a lar
161. nd The default seed is 42 Declare that the input query segfile is in format lt s gt Accepted sequence file formats include FASTA EMBL GenBank DDBJ UniProt Stockholm and SELEX Default is to autodetect the format of the file Declare that the input target segdb is in format lt s gt Accepted sequence file for mats include FASTA EMBL GenBank DDBJ UniProt Stockholm and SELEX Default is to autodetect the format of the file Set the number of parallel worker threads to lt n gt By default HMMER sets this to the number of CPU cores it detects in your machine that is it tries to maximize the use of your available processor cores Setting lt n gt higher than the number of avail able cores is of little if any value but you may want to set it to something less You can also control this number by setting an environment variable HMMER_NCPU This option is only available if HMMER was compiled with POSIX threads support This is the default but it may have been turned off at compile time for your site or machine for some reason For debugging the MPI master worker version pause after start to enable the developer to attach debuggers to the running master and worker s processes Send SIGCONT signal to release the pause Under gdb gdb signal SIGCONT Only available if optional MPI support was enabled at compile time Run in MPI master worker mode using mpirun Only available if optional MPI support was enabled at com
162. networks Nucl Acids Res 34 D257 D260 Mulder N J Apweiler R Attwood T K Bairoch A Barrell D Bateman A Binns D Biswas M Bradley P Bork P Bucher P Copley R R Courcelle E Das U Durbin R Falquet L Fleischmann W Griffiths Jones S Haft D Harte N Hulo N Kahn D Kanapin A Krestyaninova M Lopez R Letunic l Lonsdale D Silventoinen V Orchard S E Pagni M Peyruc D Ponting C P Selengut J D Servant F Sigrist C J Vaughan R and Zdobnov E M 2003 The InterPro database 2003 brings increased coverage and new features Nucl Acids Res 31 315 318 Pearson W R and Lipman D J 1988 Improved tools for biological sequence comparison Proc Natl Acad Sci USA 85 2444 2448 Rabiner L R 1989 A tutorial on hidden Markov models and selected applications in speech recognition Proc IEEE 77 257 286 Smith T F and Waterman M S 1981 Identification of common molecular subsequences J Mol Biol 147 195 197 Sonnhammer E L L Eddy S R and Durbin R 1997 Pfam A comprehensive database of protein families based on seed alignments Proteins 28 405 420 Taylor W R 1986 Identification of protein sequence homology by consensus template alignment J Mol Biol 188 233 258 Wheeler T J Clements J Eddy S R Hubley R Jones T A Jurka J Smit A F A and Finn R D 2013 Dfam a database of r
163. ng lt n gt higher than the number of available cores is of little if any value but you may want to set it to something less You can also control this number by setting an environment variable HM MER_NCPU This option is only available if HMMER was compiled with POSIX threads support This is the default but it may have been turned off for your site or machine for some reason For debugging the MPI master worker version pause after start to enable the developer to attach debuggers to the running master and worker s processes Send SIGCONT signal to release the pause Under gdb gdb signal SIGCONT Only available if optional MPI support was enabled at compile time Run in MPI master worker mode using mpirun Only available if optional MPI support was enabled at compile time 96 phmmer search protein sequence s against a protein sequence database Synopsis phmmer options lt seqfile gt lt seqdb gt Description phmmer is used to search one or more query protein sequences against a protein sequence database For each query sequence in lt segfile gt use that sequence to search the target database of sequences in lt seqdb gt and output ranked lists of the sequences with the most significant matches to the query Either the query lt segfile gt or the target lt seqdb gt may be a dash character in which case the query sequences or target database input will be read from a lt stdin gt pipe instead of from a
164. ng a file in hmmpgmd format o o o 111 Acknowledgements and history 112 THARE 0 A it AAA A a dredge 112 1 Introduction HMMER is used to search sequence databases for homologs of protein or DNA sequences and to make sequence alignments HMMER can be used to search sequence databases with single query sequences but it becomes particularly powerful when the query is an alignment of multiple instances of a sequence family HMMER makes a profile of the query that assigns a position specific scoring system for substitutions insertions and deletions HMMER profiles are probabilistic models called profile hidden Markov models profile HMMs Krogh et al 1994 Eddy 1998 Durbin et al 1998 Compared to BLAST FASTA and other sequence alignment and database search tools based on older scoring methodology HMMER aims to be significantly more accurate and more able to detect remote homologs because of the strength of its underlying probability models In the past this strength came at a significant computational cost with profile HMM implementations running about 100x slower than comparable BLAST searches for protein search and about 1000x slower than BLAST searches for DNA search With HMMER3 1 HMMER is now essentially as fast as BLAST for protein search and roughly 5 10x slower than BLAST in DNA search How to avoid reading this manual We hate reading documentation If you re like us you re sitting here thinking 113
165. nment sequence file formats include Stockholm Aligned FASTA Clustal NCBI PSI BLAST PHYLIP Selex and UCSC SAM A2M Default is to autodetect the format of the file Seed the random number generator with lt n gt an integer gt 0 If lt n gt is nonzero any stochastic simulations will be reproducible the same command will give the same results If lt n gt is 0 the random number generator is seeded arbitrarily and stochastic simulations will vary from run to run of the same command The default seed is 42 53 hmmalign align sequences to a profile HMM Synopsis hmmalign options lt hmmfile gt lt seqfile gt Description Perform a multiple sequence alignment of all the sequences in lt seqfile gt by aligning them individually to the profile HMM in lt hmmfile gt The new alignment is output to stdout in Stockholm format The lt hmmfile gt should contain only a single profile If it contains more only the first profile in the file will be used Either lt hmmfile gt or lt seqfile gt but not both may be dash which means reading this input from stdin rather than a file The sequences in lt seqfile gt are aligned in unihit local alignment mode Therefore they should already be known to contain only a single domain or a fragment of one The optimal alignment may assign some residues as nonhomologous N and C states in which case these residues are still included in the resulting alignment but shoved
166. ns 539165 sequences with the fn3 model gt hmmsearch fn3 hmm uniprot_sprot fasta If you don t have UniProt and can t run a command like this don t worry about it l II show the relevant bits here Now the domain report for 7LESS_DRoME looks like score bias c Evalue i Evalue hmmfrom hmm to alifrom ali to envfrom env to acc Li 40 7 0 0 9 6e 12 6 9e 09 2 84 439 520 437 521 0 95 2k 14 4 0 0 0 0015 ed 13 85 836 913 826 914 0 73 3 Sad 0 0 1 2 8 6e 02 10 36 1209 1235 1203 1259 0 82 4 24 3 0 0 1 3e 06 0 00091 14 80 1313 1380 1304 1386 0 82 5 47 2 0 9 8 8e 14 6 3e 11 1 85 7 99 1890 1799 18 91 60 91 6 17 8 0 0 0 00014 0 099 6 E i 1904 V9 66 ay 1901 1976 0 90 pe cil 12 8 0 0 0 005 35 1 86 1993 2107 1993 2107 245089 Notice that almost everything s the same it s the same target sequence after all except for what hap pens with E values The independent E value is calculated assuming a search space of all 539165 se quences For example look at the highest scoring domain domain 5 here domain 7 above When we only looked at a single sequence its score of 47 2 bits has an E value of 1 2e 16 When we search a database of 539165 sequences a hit scoring 47 2 bits would be expected to happen 539165 times as of ten 1 2e 16 x 539165 6 47e 11 it s showing 6 3e 11 because of roundoff issues the 1 2e 16 in fact isn t 23 exactly 1 2e 16 inside HMMER In this UniProt search 754 sequences were repo
167. nsemble The number of regions will generally be close to the expected number of domains The more different the two numbers are the less discrete the regions appear to be in terms of probability mass This usually means one of two things On the one hand weak homologous domains may be difficult for the heuristics to identify clearly On the other hand repetitive sequence may appear to have a high expected domain number from lots of crappy possible alignments in the ensemble no one of which is very convincing on its own so no one region is discretely well defined clu Number of regions that appeared to be multidomain and therefore were passed to stochastic traceback clustering for further resolution down to one or more envelopes This number is often zero ov For envelopes that were defined by stochastic traceback clustering how many of them overlap other envelopes env The total number of envelopes defined both by single envelope regions and by stochastic traceback clustering into one or more envelopes per region dom Number of domains defined In general this is the same as the number of envelopes for each envelope we find an MEA maximum expected accuracy alignment which defines the endpoints of the alignable domain rep Number of domains satisfying reporting thresholds If you ve also saved a domtblout file there will be one line in it for each reported domain inc Number of domains satisfying inclusion thresholds
168. nstall more than one package that uses the Easel library it may become an annoyance you ll have multiple instantiations of Easel lying around The Easel API is not yet stable enough to decouple it from the applications that use it like HMMER and Infernal 13 Using build directories The configuration and compilation process from source supports using separate build directories using the GNU standard VPATH mechanism This allows you to maintain separate builds for different processors or with different configuration compilation options All you have to do is run the configure script from the directory you want to be the root of your build directory For example gt mkdir my hmmer build gt cd my hmmer build gt path to hmmer configure gt make This assumes you have a make that supports VPATH If your system s make does not you can always install GNU make Makefile targets al1 Builds everything Same as just saying make check Runs automated test suites in both HMMER and the Easel library clean Removes all files generated by compilation by make Configuration files generated by configure is preserved distclean Removes all files generated by configuration by configure and by compilation by make Note that if you want to make a new configuration for example to try an MPI version by configure enable mpi make you should do a make distclean rather than a make clean to be sure old configuration files are
169. nstructed One state emits residues from the background frequency distribution same as the null1 model and the other state emits residues from the mean residue composi tion of the profile i e the expected composition of sequences generated by the core model including match and insert states p7_hmm c p7_hmm_SetComposition Thus if the profile is highly biased cysteine rich for example or highly hydrophobic with many transmembrane segments this composition bias will be cap tured by this second state This model s transitions are arbitrarily set such that state 1 emits an expected length of 400 at a time and state 2 emits an expected length of M 8 at a time for a profile of length M An overall target sequence length distribution is set to a mean of L identical to the null1 model The sequence is then rescored using this bias filter model in place of the null1 model using the HMM Forward algorithm This replaces the nulli model score at all subsequent filter steps in the pipeline until a final Forward score is calculated A new MSV bit score is obtained If the P value of this still satisfies the MSV thresholds the sequence passes the biased composition filter The F1 lt x gt option controls the P value threshold for passing the MSV filter score both before with the simple null1 model and after the bias composition filter is applied The max option bypasses all filters in the pipeline including the bias filter T
170. ntensive Forward Backward algorithms shoulder an abnormally heavy load 70 Other Options nonull2 Z lt x gt domZ lt x gt seed lt n gt qformat lt s gt cpu lt n gt stall mpi Turn off the null2 score corrections for biased composition Assert that the total number of targets in your searches is lt x gt for the purposes of per sequence E value calculations rather than the actual number of targets seen Assert that the total number of targets in your searches is lt x gt for the purposes of per domain conditional E value calculations rather than the number of targets that passed the reporting thresholds Set the random number seed to lt n gt Some steps in postprocessing require Monte Carlo simulation The default is to use a fixed seed 42 so that results are exactly reproducible Any other positive integer will give different but also reproducible results A choice of 0 uses an arbitrarily chosen seed Assert that the query sequence file is in format lt s gt Accepted formats include fasta embl genbank ddbj uniprot stockholm pfam a2m and afa Set the number of parallel worker threads to lt n gt By default HMMER sets this to the number of CPU cores it detects in your machine that is it tries to maximize the use of your available processor cores Setting lt n gt higher than the number of available cores is of little if any value but you may want to set it to somethin
171. ntinuing to next round was 1 including original query Round 2 Included in MSA 936 subsequences Model size 146 positions query 935 subsegs from 935 targets This obviously is telling you that the new alignment contains 936 sequences your query plus 935 significant matches For round two it s built a new model from this alignment Now for round two it fires off what s essentially an hmmsearch of the target database with this new model Scores for complete sequences score includes all domains full sequence best 1 domain dom E value score bias E value score bias exp N Sequence 7 5e 68 232 1 0 2 8 3e 68 232 0 0 2 1 0 1 sp P02055 HBB_MELME 1 1e 67 231 5 0 4 1 3e 67 231 4 0 4 1 0 1 sp P81042 HBE_MACEU 1 3e 67 231 3 0 3 1 5e 67 231 1 0 3 1 0 1 sp P15449 HBB_MELCA 1 9e 67 230 8 0 2 2 1e 67 230 6 0 2 1 0 1 sp P68046 HBB_ODORO Description subunit beta OS Meles meles subunit epsilon OS Macropus subunit beta OS Mellivora c subunit beta OS Odobenus ro Hemoglobin Hemoglobin Hemoglobin Hemoglobin If you skim down through this output you ll start seeing newly included sequences marked with s such 28 as 9 4e 30 108 5 0 0 le 29 108 4 0 0 0 sp O9DEPO MYG_CRYAN Myoglobin OS Cryodraco antarcticus GN 1 4e 29 107 9 0 2 1 6e 29 107 8 0 2 0 sp P14397 MYG_GALGA Myoglobin OS Galeorhinus galeus GN mb 2 4e 29 107 2 0 0 2 7e 29 107 0 0 0 0 sp P02022 HBAM_LITCT Hemoglobin heart muscle su
172. o fit on one line the alignment may be split into multiple blocks with blocks separated by blank lines The number of sequences their order and their names must be the same in every block Within a given block each sub sequence and any associated GR and GC markup see below is of equal length called the block length Block lengths may differ from block to block The block length must be at least one residue and there is no maximum Other blank lines are ignored You can add comments anywhere to the file even within a block on lines starting with a All other annotation is added using a tag value comment style The tag value format is inherently exten sible and readily made backwards compatible unrecognized tags will simply be ignored Extra annotation includes consensus and individual RNA or protein secondary structure sequence weights a reference co ordinate system for the columns and database source information including name accession number and coordinates for subsequences extracted from a longer source sequence See below for details syntax of Stockholm markup There are four types of Stockholm markup annotation for per file per sequence per column and per residue annotation GF lt tag gt lt s gt Per file annotation lt s gt is a free format text line of annotation type lt tag gt For example GF DATE April 1 2000 Can occur anywhere in the file but usually all the cr markups occur in a header
173. old any setting of incE is ignored Include sequences with a bit score of gt lt x gt By default this option is unset incdomE lt x gt Include domains with conditional E values lt lt x gt in subsequent iteration or fi nal alignment output by A in addition to the top scoring domain per significant sequence hit The default is 0 001 incdomT lt x gt Use a bit score threshold for per domain inclusion instead of an E value threshold any setting of incT is ignored Include domains with a bit score of gt lt x gt By default this option is unset 84 Options Controlling Acceleration Heuristics HMMERS searches are accelerated in a three step filter pipeline the MSV filter the Viterbi filter and the Forward filter The first filter is the fastest and most approximate the last is the full Forward scoring algo rithm slowest but most accurate There is also a bias filter step between MSV and Viterbi Targets that pass all the steps in the acceleration pipeline are then subjected to postprocessing domain identification and scoring using the Forward Backward algorithm Essentially the only free parameters that control HMMER s heuristic filters are the P value thresholds controlling the expected fraction of nonhomologous sequences that pass the filters Setting the default thresholds higher will pass a higher proportion of nonhomologous sequence increasing sensitivity at the expense of speed conversely setting lower P
174. on sets the configure script will revert to an unoptimized implementation called the dummy implementation The dummy implementation is two orders of magnitude slower It will enable you to see H3 s scientific features on a much wider range of processors but is not suited for real production work We do aim to be portable to all modern processors The acceleration algorithms are designed to be portable despite their use of specialized SIMD vector instructions We hope to add support for the Sun There are add on products available for making Windows more POSIX compliant and more compatible with GNU ish configures and builds One such product is Cygwin http www cygwin com which is freely available Although we do not test on Windows platforms we understand HMMER builds fine in a Cygwin environment on Windows 12 SPARC VIS instruction set for example We believe that the code will be able to take advantage of GP GPUs and FPGAs in the future Compiler The source code is C conforming to POSIX and ANSI C99 standards It should compile with any ANSI C99 compliant compiler including the GNU C compiler gcc We test the code using both the gcc and icc compilers We find that icc produces somewhat faster code at present Libraries and other installation requirements HMMER includes a software library called Easel which it will automatically compile during its installation process By default HMMER3 does not require any additional librar
175. on thresholds NC thresholds are generally considered to be the score of the highest scoring known false posi tive cut_tc Use the TC trusted cutoff bit score thresholds in the model to set per sequence TC1 and per domain TC2 reporting and inclusion thresholds TC thresholds are generally considered to be the score of the lowest scoring known true positive that is above all known false positives Options Controlling the Acceleration Pipeline HMMERS searches are accelerated in a three step filter pipeline the MSV filter the Viterbi filter and the Forward filter The first filter is the fastest and most approximate the last is the full Forward scoring al gorithm There is also a bias filter step between MSV and Viterbi Targets that pass all the steps in the acceleration pipeline are then subjected to postprocessing domain identification and scoring using the Forward Backward algorithm Changing filter thresholds only removes or includes targets from considera tion changing filter thresholds does not alter bit scores E values or alignments all of which are determined solely in postprocessing max Turn off all filters including the bias filter and run full Forward Backward postpro cessing on every target This increases sensitivity somewhat at a large cost in speed F1 lt x gt Set the P value threshold for the MSV filter step The default is 0 02 meaning that roughly 2 of the highest scoring nonhomologous targets are
176. or this domain bias The biased composition null2 score correction that was applied to the domain bit score from hmm coord The start of the MEA alignment of this domain with respect to the profile num bered 1 N for a profile of N consensus positions to hmm coord The end of the MEA alignment of this domain with respect to the profile numbered 1 N for a profile of N consensus positions from ali coord The start of the MEA alignment of this domain with respect to the sequence numbered 1 L for a sequence of L residues to ali coord The end of the MEA alignment of this domain with respect to the sequence num bered 1 L for a sequence of L residues from env coord The start of the domain envelope on the sequence numbered 1 L for a se quence of L residues The envelope defines a subsequence for which their is substantial probability mass supporting a homologous domain whether or not a single discrete alignment can be identified The envelope may extend beyond the endpoints of the MEA alignment and in fact often does for weakly scoring domains to env coord The end of the domain envelope on the sequence numbered 1 L for a sequence of L residues acc The mean posterior probability of aligned residues in the MEA alignment a measure of how reliable the overall alignment is from 0 to 1 with 1 00 indicating a completely reliable alignment according to the model description of target The remainder of the lin
177. osition filter model score or if the biased filter is off just the null model score If the P value of this bit score passes the Forward filter threshold the sequence passes on to the next step of the pipeline The bias filter score has no further effect in the pipeline It is only used in filter stages It has no effect on final reported bit scores or P values Biased composition compensation for final bit scores is done by a more complex domain specific algorithm described below The F3 lt x gt option controls the P value threshold for passing the Forward filter score The default is 1e 5 The max option bypasses all filters in the pipeline At the end of a search output you will see a line like Passed Fwd filter 1076 0 00216371 expected 5 0 le 05 which tells you how many and what fraction of comparisons passed the Forward filter versus how many were expected Domain definition A target sequence that reaches this point is very likely to contain one or more significant matches to the profile These matches are referred to as domains since the main use of HMMER has historically been to match profile HMMs from protein domain databases like Pfam and one of HMMER s strengths is to be able to cleanly parse a multidomain target sequence into its multiple nonoverlapping hits to the same domain model The domain definition step is essentially its own pipeline with steps as follows Backward parser The counterpart of th
178. ossibly redundant database provided those redundant counts are given in the hmmpgmd formatted file The hmmpgmd file begins with a single line containing various counts describing the contents of the file of the form res_cnt seq cnt db_cnt cnt_1 fullcnt_1 cnt_2 fullcnt_2 date_stamp Fields in header line res_cnt Number of residues in the sequence file seq_cnt Number of sequences in the sequence file db_cnt Number of databases in the sequence file ent_i Of the sequnces in the file the number that belong to database i Note that if the file contains only a single database this will match seq_cnt fullcnt_i For database i the number of sequences that should be used in computing E values If redun dant sequences were collapsed out of the original database this may be larger than cnt i FASTA like sequence format In the main body of the sequence file database sequences are stored sequentially with each entry con sisting of a one line FASTA like header followed by one or more lines containing the amino acid sequence like gt 1 100 ACDEFGHIKLMNPOTVWY gt 2 010 ACDKLMNPOTVWYEFGHI gt 33 LII EFMNRGHIKLMNPOT Note that the per entry header line is made up of two parts The first part is a numeric incrementing sequence identifier the ith entry has the identifier i The second part is a bit string indicating database membership In this example sequence 1 is found in database 1 sequence 2 is found in database 2 and se
179. pages of documentation you must be joking just want to know that the software compiles runs and gives apparently useful results before read some 113 exhausting pages of someone s documentation For cynics that have seen one too many software packages that don t work e Follow the quick installation instructions on page 12 An automated test suite is included so you will know immediately if something went wrong e Go to the tutorial section on page 17 which walks you through some examples of using HMMER on real data Everything else you can come back and read later How to avoid using this software links to similar software Several implementations of profile HMM methods and related position specific scoring matrix methods are available Software URL HMMER http hmmer org SAM http www cse ucsc edu research compbio sam html PSI BLAST http www ncbi nlm nih gov Education BLASTinfo psil htm PFTOOLS http www isrec isb sib ch profile profile html The UC Santa Cruz SAM software is the closest relative of HMMER What profile HMMs are Profile HMMs are statistical models of multiple sequence alignments or even of single sequences They capture position specific information about how conserved each column of the alignment is and which residues are likely Anders Krogh David Haussler and co workers at UC Santa Cruz introduced profile 1NCBI blastn with wordsize 7 default wordsize of 11 is 10x fas
180. parameters needed for E value calculations lt s1 gt is the model s alignment mode configuration currently only Local is recognized lt s2 gt is the name of the score distribution currently MSV VITERBI and FORWARD are recognized lt f1 gt and lt f2 gt are two real valued parameters controlling location and slope of each distribution respectively y and A for Gumbel distributions for MSV and Viterbi scores and 7 and A for exponential tails for Forward scores values must be positive All three lines or none of them must be present when all three are present the model is considered to be calibrated for E value statistics Optional HMM Flags the start of the main model section Solely for human readability of the tabular model data the symbol alphabet is shown on the uw line aligned to the fields of the match and insert symbol emission distributions in the main model below The next line is also for human readability providing column headers for the state transition probability fields in the main model section that follows Though unparsed after the nmm tag the presence of two header lines is mandatory the parser always skips the line after the Hmm tag line COMPO lt f gt K The first line in the main model section may be an optional line starting with compo these are the model s overall average match state emission probabilities which are used as a background residue composition in the filter null model The K fields on
181. pile time 88 nhmmer search DNA RNA queries against a DNA RNA sequence database Synopsis nhmmer options lt queryfile gt lt seqdb gt Description nhmmer is used to search one or more nucleotide queries against a nucleotide sequence database For each query in lt queryfile gt use that query to search the target database of sequences in lt seqdb gt and output a ranked list of the hits with the most significant matches to the query A query may be either a profile model built using hmmbuild a sequence alignment or a single sequence Sequence based queries can be in a number of formats see qformat and can typically be autodetected Note that only Stockholm format supports the use of multiple sequence based queries Either the query lt queryfile gt or the target lt seqdb gt may be a dash character in which case the query file or target database input will be read from a lt stdin gt pipe instead of from a file Only one input source can come through lt stdin gt not both If the query is sequence based and passed via lt stdin gt the qformat flag must be used If the lt queryfile gt contains more than one query then lt segdb gt cannot come from lt stdin gt because we can t rewind the streaming target database to search it with another profile If the query is sequence based and not from lt stdin gt a new file containing the HMM s built from the input s in lt queryfile gt may optionally be p
182. posterior probability annotation for the entire column It s calculated simply as the arithmetic mean of the per residue posterior probabilities in that col umn This should prove useful in phylogenetic inference applications for example where it s common to mask away nonconfidently aligned columns of a multiple alignment The PP cons line provides an objective measure of the confidence assigned to each column The cc RF line is Stockholm format reference coordinate annotation with an x marking each column that the profile considered to be consensus 36 4 The HMMER profile sequence comparison pipeline In this section we briefly outline the processing pipeline for a single profile sequence comparison This should help give you a sense of what HMMER is doing under the hood what sort of mistakes it may make rarely of course and what the various results in the output actually mean We ll first describe the pipeline in the context of protein search phmmer hmmsearch hmmscan jackhmmer then wrap back around to discuss the modified pipeline used in nammer and nhmmscan In briefest outline the comparison pipeline takes the following steps Null model Calculate a score term for the null hypothesis a probability model of non homology This score correction is used to turn all subsequent profile sequence bit scores into a final log odds bit score MSV filter The main acceleration heuristic The MSV Multiple Segment Vit
183. quence 3 found in databases 1 2 and 3 The number of bits in each bit string should match db_cnt Because hmmpgmd accepts only numeric sequence identifiers it is necessary to keep track of the map ping between each numeric sequence identifier and the corresponding meta data e g name accession description external to the hmmpgmd format file and post process hmmpgmd seach results to apply those fields to the target sequence information Depending on the size of the map list this might be easily acheived with a simple perl array or might require a more heavy duty mapping backend such as mongodb http www mongodb org 110 Creating a file in hmmpgmd format The HMMER Easel tool es1 reformat is able to convert a file in unaligned fasta format into an hmmpgmd format file such as gt esl reformat idmap mydb hmmpgmd map hmmpgmd mydb fasta gt mydb hmmpgmd The optional id map flag captures sequence name and description information into a simple tabular file to be used for mapping those values back to hmmpgmd query hits 111 9 Acknowledgements and history HMMER 1 was developed on slow weekends in the lab at the MRC Laboratory of Molecular Biology Cam bridge UK while was a postdoc with Richard Durbin and John Sulston thank the Human Frontier Science Program and the National Institutes of Health for their remarkably enlightened support at a time when was really supposed to be working on the genetics of neural development
184. queries against a streamed target database gt cat myqueries list hmmfetch f Pfam hmm gt many hmms gt cat mytargets list esl sfetch f uniprot_sprot fasta hmmsearch many hmms This will fail Unfortunately the above business about how it will generally abort after the first pass means it fails weirdly The first query profile search will succeed and its output will appear then an error message will be generated when hmmsearch sees the second profile query and oops it realizes it is unable to rewind the target sequence database stream This is inherent in how it reads the profile HMM query file sequentially as a stream which is what s allowing it to read input from stdin pipes in the first place one 49 model at a time it doesn t see there s more than one query model in the file until it gets to the second model This case isn t too restricting because the same end goal can be achieved by reordering the commands In cases where you want to do multiple queries against multiple targets you always want to be reading the queries from a stdin pipe not the targets gt cat mytargets list esl sfetch f uniprot_sprot fasta gt mytarget seqs gt cat myqueries list hmmfetch f Pfam hmm hmmsearch mytarget seqs So in this multiple queries multiple targets case of using stdin pipes you just have to know for any given program which file it considers to be queries and which it considers to be targets That is the lo
185. r if none E value full sequence The expectation value statistical significance of the target This is a per query E value i e calculated as the expected number of false positives achieving this comparison s score for a single query against the Z sequences in the target dataset If you search with multiple queries and if you want to control the overall false positive rate of that search rather than the false positive rate per query you will want to multiply this per query E value by how many queries you re doing score full sequence The score in bits for this target query comparison It includes the biased composition correction the null2 model Bias full sequence The biased composition correction the bit score difference contributed by the null2 model High bias scores may be a red flag for a false positive especially when the bias score is as large or larger than the overall bit score It is difficult to correct for all possible ways in which a nonrandom but nonhomologous biological sequences can appear to be similar such as short period tandem repeats so there are cases where the bias correction is not strong enough creating false positives E value best 1 domain The E value if only the single best scoring domain envelope were found in the sequence and none of the others If this E value isn t good but the full sequence E value is good this is a potential red flag Weak hits none of which are good
186. r whitespace limited format for the main model parameters All probability parameters are all stored as negative natural log probabilities with five digits of precision to the right of the decimal point rounded For example a probability of 0 25 is stored as log 0 25 1 38629 The special case of a zero probability is stored as Spacing is arranged for human readability but the parser only cares that fields are separated by at least one space character A more detailed description of the format follows header section The header section is parsed line by line in a tag value format Each line type is either mandatory or optional as indicated HMMER3 Unique identifier for the save file format version the means that this is HAMER3 HMM file for mat version f When HMMER3 changes its save file format the revision code advances This way HMMER 3 0 used 3 b format HMMER 3 1 uses 3 f format Some alpha test versions of 3 0 used 3 a format Internal development versions of 3 1 used 3 c 3 d and 3 e formats 102 parsers may easily remain backwards compatible The remainder of the line after the HymER3 f tag is free text that is ignored by the parser HMMER currently writes its version number and release date in brackets here e g 3 1b1 February 2013 in this example Mandatory NAME lt s gt Model name lt s gt is a single word containing no spaces or tabs The name is normally picked up from the GF ID
187. r of targets in your searches is lt x gt for the purposes of per domain conditional E value calculations rather than the number of targets that passed the reporting thresholds Seed the random number generator with lt n gt an integer gt 0 If lt n gt is gt 0 any stochastic simulations will be reproducible the same command will give the same results If lt n gt is 0 the random number generator is seeded arbitrarily and stochastic simulations will vary from run to run of the same command The default seed is 42 Declare that the input lt seqfile gt is in format lt s gt Accepted formats include fasta embl genbank ddbj uniprot stockholm pfam a2m and afa The default is to autodetect the format of the file Declare that the input lt seqdb gt is in format lt s gt Accepted formats include fasta embl genbank ddbj uniprot stockholm pfam a2m and afa The default is to autodetect the format of the file 100 cpu lt n gt stall mpi Set the number of parallel worker threads to lt n gt By default HMMER sets this to the number of CPU cores it detects in your machine that is it tries to maximize the use of your available processor cores Setting lt n gt higher than the number of avail able cores is of little if any value but you may want to set it to something less You can also control this number by setting an environment variable HMMER_NCPU This option is only available if HAMER was comp
188. ranslated short reads in metagenomic shotgun data 52 Options Controlling Relative Weights HMMER uses an ad hoc sequence weighting algorithm to downweight closely related sequences and up weight distantly related ones This has the effect of making models less biased by uneven phylogenetic representation For example two identical sequences would typically each receive half the weight that one sequence would These options control which algorithm gets used wpb wgsc wblosum wnone wid lt x gt Other Options informat lt s gt seed lt n gt Use the Henikoff position based sequence weighting scheme Henikoff and Henikoff J Mol Biol 243 574 1994 This is the default Use the Gerstein Sonnhammer Chothia weighting algorithm Gerstein et al J Mol Biol 235 1067 1994 Use the same clustering scheme that was used to weight data in calculating BLO SUM subsitution matrices Henikoff and Henikoff Proc Natl Acad Sci 89 10915 1992 Sequences are single linkage clustered at an identity threshold default 0 62 see wid and within each cluster of c sequences each sequence gets rela tive weight 1 c No relative weights All sequences are assigned uniform weight Sets the identity threshold used by single linkage clustering when using wblosum Invalid with any other weighting scheme Default is 0 62 Declare that the input msafile is in format lt s gt Currently the accepted multiple alig
189. re exactly reproducible Any other positive integer will give different but also reproducible results A choice of 0 uses a randomly chosen seed Assert that the target sequence database file is in format lt s gt Accepted formats include fasta embl genbank ddbj uniprot stockholm pfam a2m and afa The default is to autodetect the format of the file Set the number of parallel worker threads to lt n gt By default HMMER sets this to the number of CPU cores it detects in your machine that is it tries to maximize the use of your available processor cores Setting lt n gt higher than the number of avail able cores is of little if any value but you may want to set it to something less You can also control this number by setting an environment variable HMMER_NCPU This option is only available if HAMER was compiled with POSIX threads support This is the default but it may have been turned off at compile time for your site or machine for some reason For debugging the MPI master worker version pause after start to enable the developer to attach debuggers to the running master and worker s processes Send SIGCONT signal to release the pause Under gdb gdb signal SIGCONT Only available if optional MPI support was enabled at compile time Run in MPI master worker mode using mpirun Only available if optional MPI support was enabled at compile time 75 hmmsim collect score distributions on random sequences Synops
190. ributed per model consensus position Kullback Leibler distance between the model s overall average residue composition and the default background frequency distribution The higher this number the more biased the residue composition of the profile is Highly biased profiles can slow the HMMERS acceleration pipeline by causing too many nonhomologous sequences to pass the filters Help print a brief reminder of command line usage and all available options 81 jackhmmer iteratively search sequence s against a protein database Synopsis jackhmmer options lt seqfile gt lt seqdb gt Description jackhmmer iteratively searches each query sequence in lt segfile gt against the target sequence s in lt seqdb gt The first iteration is identical to a phmmer search For the next iteration a multiple align ment of the query together with all target sequences satisfying inclusion thresholds is assembled a profile is constructed from this alignment identical to using hmmbuild on the alignment and profile search of the lt seqdb gt is done identical to an hmmsearch with the profile The query lt seqfile gt may be a dash character in which case the query sequences are read from a lt stdin gt pipe instead of from a file The lt seqdb gt cannot be read from a lt stdin gt stream because jackhmmer needs to do multiple passes over the database The output format is designed to be human readable but is often so vol
191. ris machine It s a known issue in GNU autoconf You can either install GNU grep or you can insist to configure that the Solaris grep or whatever grep you have is ok by explicitly setting GREP gt configure GREP usr xpg4 bin grep Configuration warns that it s using the dummy implementation and H3 is going to be very slow This is what you get if your system has a processor that we don t yet support with a fast vector parallel im plementation We currently support Intel AMD compatible processors and PowerPC compatible processors H3 will revert to a portable but slow version on other processors 15 Many make check tests fail We have one report of a system that failed to link multithread capable system C libraries correctly and instead linked to one or more serial only libraries We ve been unable to reproduce the problem here and are not sure what could cause it we optimistically believe it s a messed up system instead of our fault If it does happen it screws all kinds of things up with the multithreaded implementation A workaround is to shut threading off gt configure disable threads This will compile code won t parallelize across multiple cores of course but it will still work fine on a single processor at a time and MPI if you build with MPI enabled 3The telltale phenotype of this failure is to configure with debugging flags on and recompile run one of the failed unit test drivers su
192. rmined they are normalized to sum to a total effective sequence number eff_nseg This number may be the actual number of sequences in the alignment but it is almost always smaller than that The default entropy weighting method eent reduces the effective sequence num ber to reduce the information content relative entropy or average expected score on true homologs per consensus position The target relative entropy is controlled by a two parameter function where the two parameters are settable with ere and esigma eent Adjust effective sequence number to achieve a specific relative entropy per position see ere This is the default eclust Set effective sequence number to the number of single linkage clusters at a spe cific identity threshold see eid This option is not recommended it s for experi ments evaluating how much better eent is enone Turn off effective sequence number determination and just use the actual number of sequences One reason you might want to do this is to try to maximize the relative entropy position of your model which may be useful for short models eset lt x gt Explicitly set the effective sequence number for all models to lt x gt ere lt x gt Set the minimum relative entropy position target to lt x gt Requires eent Default depends on the sequence alphabet For protein sequences it is 0 59 bits position for nucleotide sequences it is 0 45 bits position esigma lt
193. roduced with the filename set using the hmmout flag The output format is designed to be human readable but is often so voluminous that reading it is impractical and parsing it is a pain The tblout option saves output in a simple tabular format that is concise and easier to parse The o option allows redirecting the main output including throwing it away in dev null Options h Help print a brief reminder of command line usage and all available options Options for Controlling Output O lt f gt Direct the main human readable output to a file lt f gt instead of the default stdout A lt f gt Save a multiple alignment of all significant hits those satisfying inclusion thresh olds to the file lt f gt tblout lt f gt Save a simple tabular space delimited file summarizing the per target output with one data line per homologous target sequence found dfamtblout lt f gt Save a tabular space delimited file summarizing the per hit output similar to tblout but more succinct aliscoresout lt f gt Save to file a list of per position scores for each hit This is useful for example in identifying regions of high score density for use in resolving overlapping hits from different models hmmout lt f gt If lt queryfile gt is sequence based the internally computed HMM s are written to lt b 89 acc Use accessions instead of names in the main output where available for profiles and or sequences
194. rofile HMMs HMMER can be used to replace BLASTP and PSI BLAST for searching protein databases with single query sequences HMMER includes two programs for searching protein databases with single query sequences phmmer and jackhmmer where jackhmmer is an iterative search akin to PSI BLAST Another application of HMMER is when you are working on a sequence family and you have carefully constructed a multiple sequence alignment Your family like most protein or DNA families has a number of strongly but not absolutely conserved key amino acids or nucleotides separated by characteristic spacing You wonder if there are more members of your family in the sequence databases but the family is so evolutionarily diverse a BLAST search with any individual sequence doesn t even find the rest of the sequences you already know about You re sure there are some distantly related sequences in the noise You spend many pleasant evenings scanning weak BLAST alignments by eye to find ones with the right key residues are in the right places but you wish there was a computer program that did this a little better Another application is the automated annotation of the domain structure of proteins Large databases of curated alignments and HMMER models of known domains are available including Pfam Finn et al 2010 and SMART Letunic et al 2006 in the Interpro database consortium Mulder et al 2003 Many top ten protein domains lists a standard t
195. rted in the top hits list with E values lt 10 If we were to assume that all 754 are true homologs x out the domain s that made us think that and then went looking for additional domains in those 754 sequences we d be searching a smaller database of 754 sequences the expected number of times we d see a hit of 47 2 bits or better is now 1 2e 16 x 754 9 0e 14 That s where the conditional E value c Evalue is coming from subject to rounding error Notice that a couple of domains disappeared in the UniProt search because now in this larger search space size they re not significant Domain 1 the one with the score of 1 3 bits got a conditional E value of 0 17 x 754 128 and domain 6 with a bit score of 0 0 got a c Evalue of 0 063 x 754 47 5 These fail the default reporting threshold of 10 0 The domain with a score of 5 1 bits also shifted from being above to below the default inclusion thresholds so now it s marked with a instead of a Operationally e If the independent E value is significant lt lt 1 that means that even this single domain by itself is such a strong hit that it suffices to identify the sequence as a significant homolog with respect to the size of the entire original database search You can be confident that this is a homologous domain e Once there s one or more high scoring domains in the sequence already sufficient to decide that the sequence contains homologs of your query you can look
196. s noali Omit the alignment section from the main output This can greatly reduce the output volume notextw Unlimit the length of each line in the main output The default is a limit of 120 characters per line which helps in displaying the output cleanly on terminals and in editors but can truncate target profile description lines textw lt n gt Set the main output s line length limit to lt n gt characters per line The default is 120 97 Options Controlling Scoring System The probability model in phmmer is constructed by inferring residue probabilities from a standard 20x20 substitution score matrix plus two additional parameters for position independent gap open and gap extend probabilities popen lt x gt Set the gap open probability for a single sequence query model to lt x gt The default is 0 02 lt x gt must be gt 0 and lt 0 5 pextend lt x gt Set the gap extend probability for a single sequence query model to lt x gt The default is 0 4 lt x gt must be gt 0 and lt 1 0 mx lt s gt Obtain residue alignment probabilities from the built in substitution matrix named lt s gt Several standard matrices are built in and do not need to be read from files The matrix name lt s gt can be PAM30 PAM70 PAM120 PAM240 BLOSUM45 BLOSUM50 BLOSUM62 BLOSUM80 or BLOSUM90 Only one of the mx and mxfile options may be used mxfile lt mxfile gt Obtain residue alignment probabilities from
197. s h Help print a brief reminder of command line usage and all available options Options for Controlling Output O lt f gt Direct the main human readable output to a file lt f gt instead of the default stdout tblout lt f gt Save a simple tabular space delimited file summarizing the per target output with one data line per homologous target model found domtblout lt f gt Save a simple tabular space delimited file summarizing the per domain output with one data line per homologous domain detected in a query sequence for each homologous model pfamiblout lt f gt Save an especially succinct tabular space delimited file summarizing the per target output with one data line per homologous target model found acc Use accessions instead of names in the main output where available for profiles and or sequences noali Omit the alignment section from the main output This can greatly reduce the output volume 68 notextw Unlimit the length of each line in the main output The default is a limit of 120 textw lt n gt characters per line which helps in displaying the output cleanly on terminals and in editors but can truncate target profile description lines Set the main output s line length limit to lt n gt characters per line The default is 120 Options for Reporting Thresholds Reporting thresholds control which hits are reported in output files the main output tb out and domtblout
198. s were used in the various testing versions 60 hmmemit sample sequences from a profile HMM Synopsis hmmemit options hmmfile Description The hmmemit program samples emits sequences from the profile HMM s in hmmfile and writes them to output Sampling sequences may be useful for a variety of purposes including creating synthetic true positives for benchmarks or tests The default is to sample one unaligned sequence from the core probability model which means that each sequence consists of one full length domain Alternatively with the c option you can emit a simple majority rule consensus sequence or with the a option you can emit an alignment in which case you probably also want to set N to something other than its default of 1 sequence per model As another option with the p option you can sample a sequence from a fully configured HMMER search profile This means sampling a homologous sequence by HMMER s definition including nonhomologous flanking sequences local alignments and multiple domains per sequence depending on the length model and alignment mode chosen for the profile The hmmfile may contain a library of HMMs in which case each HMM will be used in turn lt hmmfile gt may be dash which means reading this input from stdin rather than a file Common Options h Help print a brief reminder of command line usage and all available options O lt f gt Direct the output sequences
199. s passed the MSV filter versus how many and what fraction were expected Biased composition filter It s possible for profiles and or sequences to have biased residue compositions that result in significant log odds bit scores not because the profile matches the sequence particularly well but because the null model matches the sequence particularly badly 38 HMMER uses fairly good methods to compensate its scores for biased composition but these methods are computationally expensive and applied late in the pipeline described below In a few cases profiles and or target sequences are sufficiently biased that too many comparisons pass the MSV filter causing HMMER speed performance to be severely degraded Although the final scores and E values at the end of the pipeline will be calculated taking into account a null2 model of biased composition and simple repetition the null2 model is dependent on a full alignment ensemble calculation via the Forward Backward algorithm making it computationally complex so it won t get calculated until the very end The treatment of biased composition comparisons is probably the most serious problem remaining in HMMER Solving it well will require more research As a stopgap solution to rescuing most of the speed degradation while not sacrificing too much sensitivity an ad hoc biased composition filtering step is applied to remove highly biased comparisons On the fly a two state HMM is co
200. s support reference annota tion In this case Easel internally generates a reasonable guess at consensus columns using essentially the same procedure that HMMER s hmmbuild program uses by default sequence fragments sequences lt 50 of the mean sequence length in the alignment overall are ignored and for the remaining sequences any column containing gt 50 residues is considered to be a consensus column hmmpgmd sequence database format The hmmpgmd sequence database format closely resembles the FASTA format with slight modification to support use within HMMER s hmmpgmd daemon 109 The hmmpgmd program enables search of one or more sequence databases e g NR SwissProt UniProt within a single instance having loaded a single sequence file into memory Because the set of sequences found within the various databases may overlap the hmmpgmd format allows each sequence to be stored once and includes a small piece of metadata that indicates for each sequence the list of source databases in which the sequence is found When a search is performed in hmmpgmd a single target database is specified and search is restricted to sequences belonging to that database Furthermore because a single sequence might be found multiple times within a single sequence database hmmpgmd is designed to compute E values not just on the total number of non redundant sequences within a database but on the total number of sequences in the original p
201. sensus annotation of Sevenless shows seven domains FT DOMAIN 311 431 Fibronectin type III 1 FT DOMAIN 436 528 Fibronectin type III 2 FT DOMAIN 822 921 Fibronectin type III 3 FT DOMAIN 1298 1392 Fibronectin type III 4 FT DOMAIN 1680 1794 Fibronectin type III 5 FT DOMAIN 1797 1897 Fibronectin type III 6 FT DOMAIN 1898 1988 Fibronectin type III 7 These domains are a pretty tough case to call actually HMMER fails to see anything significant over lapping two of these domains 311 431 and 1680 1794 in the UniProt search though it sees a smidgen of them when 7LESS_DROME alone is the target HMMER3 sees two new domains 1205 1235 and 1993 2098 that UniProt currently doesn t annotate but these are pretty plausible domains given that the extracellular domain of Sevenless is pretty much just a big array of 100aa fibronectin repeats Under the domain table an optimal posterior accuracy alignment Holmes 1998 is computed within each domain s envelope and displayed For example skipping domain 1 because it s weak and uncon vincing fibronectin Ill domain 2 in your 7LESS_DROME output is shown as domain 2 score 40 7 bits conditional E value 1 3e 14 CEEEEEEECTTEEEEEEE S SS SEEEEEEEETTTCCGCEEEEEETTTSEEEEES TT EEEEEEEEEETTEE E CS fn3 2 saPenlsvsevtstsltlsWsppkdgggpitgYeveyqekgegeewgevtvprtttsvtltgLepgteYefrVqavngagegp 84 saP 1 4 4W p tgpitgY e vpt s L gt Y n gegp 7LESS
202. sequence with each residue drawn from a background frequency distribution a standard i i d model residues are treated as independent and identically distributed Currently this background frequency distribution is hardcoded as the mean residue frequencies in Swiss Prot 50 8 October 2006 For technical reasons HMMER incorporates the residue emission probabilities of the null model directly into the profile by turning each emission probability in the profile into an odds ratio The null model score calculation therefore is only concerned with accounting for the remaining transition probabilities of the null model and toting them up into a bit score correction The null model calculation is fast because it only depends on the length of the target sequence not its sequence MSV filter The sequence is aligned to the profile using a specialized model that allows multiple high scoring local ungapped segments to match The optimal alignment score Viterbi score is calculated under this multi segment model hence the term MSV for multi segment Viterbi This is HMMER s main speed heuristic The MSV score is comparable to BLAST s sum score optimal sum of ungapped alignment segments Roughly speaking MSV is comparable to skipping the heuristic word hit and hit extension steps of the BLAST acceleration algorithm The MSV filter is very very fast In addition to avoiding indel calculations in the dynamic programming table it uses reduce
203. sis applications to use more powerful statistical inference engines without sacrificing computational performance Specifically HMMER3 has three main design features that in combination distinguish it from previous tools Explicit representation of alignment uncertainty Most sequence alignment analysis tools report only a single best scoring alignment However sequence alignments are uncertain and the more distantly related sequences are the more uncertain alignments become HMMER3 calculates complete pos terior alignment ensembles rather than single optimal alignments Posterior ensembles get used for a variety of useful inferences involving alignment uncertainty For example any HMMER sequence alignment is accompanied by posterior probability annotation representing the degree of confidence in each individual aligned residue Sequence scores not alignment scores Alignment uncertainty has an important impact on the power of sequence database searches It s precisely the most remote homologs the most difficult to identify and potentially most interesting sequences where alignment uncertainty is greatest and where the statistical approximation inherent in scoring just a single best alignment breaks down the most To maximize power to discriminate true homologs from nonhomologs in a database search statistical inference theory says you ought to be scoring sequences by integrating over alignment uncertainty not just scoring the singl
204. ssary for high quality biologically relevant multiple alignments Databases like Pfam Finn et al 2010 and Dfam Wheeler et al 2013 are constructed by distinguishing between a stable curated seed alignment of a small number of representative sequences and full alignments of all de tectable homologs HMMER is used to make a model of the seed search the database for homologs and can automatically produce the full alignment by aligning every sequence to the seed consensus You may find other applications as well Using hidden Markov models to make a linear consensus model of a bunch of related strings is a pretty generic problem and not just in biological sequence analysis HMMER3 has already been used to model mouse song Elena Rivas personal communication and in the past HMMER has reportedly been used to model music speech and even automobile engine telemetry If you use it for something particularly strange we d be curious to hear about it but Sean never ever wants to see these error messages showing up on the console of his Saab Design goals of HMMER3 In the past profile HMM methods were considered to be too computationally expensive and BLAST has remained the main workhorse of sequence similarity searching The main objective of the HMMER3 project begun in 2004 is to combine the power of probabilistic inference with high computational speed We aim to upgrade some of molecular biology s most important sequence analy
205. st is the full Forward scoring al gorithm There is also a bias filter step between MSV and Viterbi Targets that pass all the steps in the acceleration pipeline are then subjected to postprocessing domain identification and scoring using the Forward Backward algorithm Changing filter thresholds only removes or includes targets from considera tion changing filter thresholds does not alter bit scores E values or alignments all of which are determined solely in postprocessing max Turn off all filters including the bias filter and run full Forward Backward postpro cessing on every target This increases sensitivity somewhat at a large cost in speed F1 lt x gt Set the P value threshold for the MSV filter step The default is 0 02 meaning that roughly 2 of the highest scoring nonhomologous targets are expected to pass the filter F2 lt x gt Set the P value threshold for the Viterbi filter step The default is 0 001 F3 lt x gt Set the P value threshold for the Forward filter step The default is 1e 5 nobias Turn off the bias filter This increases sensitivity somewhat but can come at a high cost in speed especially if the query has biased residue composition such as a repetitive sequence region or if it is a membrane protein with large regions of hydrophobicity Without the bias filter too many sequences may pass the filter with biased queries leading to slower than expected performance as the compu tationally i
206. t is a one line command There may be more than one com line per save file each numbered starting from n 1 These lines record every HMMER command that modified the save file This helps us reproducibly and automatically log how Pfam models have been constructed for example Optional NSEQ lt d gt Sequence number lt d gt is a nonzero positive integer the number of sequences that the HMM was trained on This field is only used for logging purposes Optional EFFN lt f gt Effective sequence number lt f gt is a nonzero positive real the effective total number of se quences determined by hmmbuild during sequence weighting for combining observed counts with Dirichlet prior information in parameterizing the model This field is only used for logging purposes Optional CKSUM lt d gt Training alignment checksum lt d gt is a nonnegative unsigned 32 bit integer This number is calculated from the training sequence data and used in conjunction with the alignment map infor mation to verify that a given alignment is indeed the alignment that the map is for Optional GA lt f gt lt f gt Pfam gathering thresholds GA1 and GA2 See Pfam documentation of GA lines Optional TC lt f gt lt f gt Pfam trusted cutoffs TC1 and TC2 See Pfam documentation of TC lines Optional NC lt f gt lt f gt Pfam noise cutoffs NC1 and NC2 See Pfam documentation of NC lines Optional STATS lt sl gt lt s2 gt lt f1 gt lt f 2 gt Statistical
207. t A O Wok he Be ds Common Options iii EES e EY So ee ee i ee oe a a Options Controlling WhattoEmit 00000 ee ee Options Controlling Emission from Profiles o o o o oo oo Options Controlling Fancy Consensus Emission 00 0000 ee ee eee Other Options i 2 fe aie tee a ae dE Shee Sot vig end Gr ba a eee hmmfetch retrieve profile HMM s from a file 0 o SYMOPSIS p uta ghz lia iaa A a e AAA DeSCIptOM maa aaa eee ee da ade e A 42 Options F214 18 a setts tees e ao Girne eve des teks a cba ee yo Ete e de a o 63 hmmpgmd daemon for searching a protein query against aproteindatabase 65 A A ARE e onda weve ee OE by GO Geeta aa ivan cet te Gace te te Ge Gk 65 DeScriplOn 4 Boe Make ds tt A A oe ie ee AS 65 OPlUONS 2 32 ee EE a ak Pe ee i ee GE rd 66 Expt Options 0 cote ee ete ond i eee Aone Nee EE eve te fe ieee PE 66 hmmpress prepare an HMM database forhmmscan 0 o e eee 67 SYNOPSIS tal td O A il A da E ta e ic ess 67 DOSCrPIION 00 a Peete kk E eee OG 67 OPINAS jaz cared rt a yen nie yet dade eres Conan neta te co hw le 67 hmmscan search protein sequence s against a protein profile database 68 SINOPSIS at a a E AO ty a heute eee te x we eles te rate Oa dae Ge od 68 DESCMPUION sd Sok aa ae ec ae Be a a eet hho War eeoe AA A 68 OPUONS 254 2 Soke Se a ts oa a ae ee Ad 68 Options for Controlling Output 2 ee 6
208. t files but is not obligated to do anything with the markup lines It is up to the application whether it will attempt to interpret the meaning the semantics of the markup in a useful way At the two extremes are the Belvu alignment viewer and the HMMER profile hidden Markov model software package Belvu simply reads Stockholm markup and displays it without trying to interpret it at all The tag types GF etc are sufficient to tell Belvu how to display the markup whether it is attached to the whole file sequences columns or residues HMMER uses Stockholm markup to pick up a variety of information from the Pfam multiple alignment database The Pfam consortium therefore agrees on additional syntax for certain tag types so HMMER can parse some markups for useful information This additional syntax is imposed by Pfam HMMER and other software of mine not by Stockholm format per se You can think of Stockholm as akin to XML and what my software reads as akin to an XML DTD if you re into that sort of structured data format lingo The Stockholm markup tags that are parsed semantically by my software are as follows recognized GF annotations ID lt s gt Identifier lt s gt is a name for the alignment e g rrm One word Unique in file AC lt s gt Accession lt s gt is a unique accession number for the alignment e g PF00001 Used by the Pfam database for instance Often a alphabetical prefix indicating the database e
209. ted after taking relative sequence weighting into account and ig noring gap characters corresponding to ends of sequence fragments as opposed to internal insertions deletions Setting this to 1 0 means that every alignment col umn will be assigned as consensus which may be useful in some cases Setting it to 0 0 is a bad idea because no columns will be assigned as consensus and you ll get a model of zero length We only want to count terminal gaps as deletions if the aligned sequence is known to be full length not if it is a fragment for instance because only part of it was sequenced HMMER uses a simple rule to infer fragments if the sequence length L is less than or equal to a fraction lt x gt times the alignment length in columns then the sequence is handled as a fragment The default is 0 5 Setting fragthreshO will define no nonempty sequence as a fragment you might want to do this if you know you ve got a carefully curated alignment of full length sequences Setting fragthresh7 will define all sequences as fragments you might want to do this if you know your alignment is entirely composed of fragments such as translated short reads in metagenomic shotgun data Options Controlling Relative Weights Whenever a profile is built from a multiple alignment HMMER uses an ad hoc sequence weighting algorithm to downweight closely related sequences and upweight distantly related ones This has the effect of making models less bias
210. ter but much less sensitive 2Nothing should go wrong SIn some circles residue is used to refer specifically in reference to amino acids but here we allow the term to alternately refer to nucleotides HMMs to computational biology Krogh et al 1994 adopting HMM techniques which have been used for years in speech recognition HMMs had been used in biology before the Krogh Haussler work notably by Gary Churchill Churchill 1989 but the Krogh paper had a dramatic impact because HMM technology was so well suited to the popular profile methods for searching databases using multiple sequence alignments instead of single query sequences Profiles had been introduced by Gribskov and colleagues Gribskov et al 1987 1990 and several other groups introduced similar approaches at about the same time such as flexible patterns Barton 1990 and templates Bashford et al 1987 Taylor 1986 The term profile has stuck All profile meth ods including PSI BLAST Altschul et al 1997 are more or less statistical descriptions of the consen sus of a multiple sequence alignment They use position specific scores for amino acids or nucleotides residues and position specific penalties for opening and extending an insertion or deletion Traditional pairwise alignment for example BLAST Altschul et al 1990 FASTA Pearson and Lipman 1988 or the Smith Waterman algorithm Smith and Waterman 1981 uses posit
211. ter Estimation Methods 04 79 Debugging Options sa grusi enii aa E oe ee ee i oe is 80 Experimental Options o o ee 80 hmmstat display summary statistics for a profile file o 81 A A E NN 81 DESCRPUIOM nia ll tn es Se ab A A AS Gr A 81 OPINAS ara ia a cerca ce Oe E a ESE Gy at AA ea 8 81 jackhmmer iteratively search sequence s against a protein database 82 SINOPSIS 4 9 ea Sh ane maa Reh wb eh Mp ds gdp ee ee aston wee ee 82 Descriptor e ne a aie did nhs Peek kek e e e Shee Bag 82 OPtIONSA maini E REDS e MA ae ee ea a 82 Options Controlling Output oaoa ea ee 82 Options Controlling Single Sequence Scoring first Iteration 83 Options Controlling Reporting Thresholds 0 000 eee eee es 83 Options Controlling Inclusion Thresholds 2 a ee e 84 Options Controlling Acceleration Heuristics 0 0 00 cee ee ee eee 85 Options Controlling Profile Construction later Iterations 0 o 85 Options Controlling Relative Weights 0 0002 eee ee 86 Options Controlling Effective Sequence Number o 00000005 87 Options Controlling Priors oaoa aa ee 87 Options Controlling E value Calibration 2 oao ee 87 Other Options coo a ee ee ee Se a a et ea a A RS i 88 nhmmer search DNA RNA queries against a DNA RNA sequence database 89 SYMOPSISS vo Lic dr ane Se a Ap ager do
212. terations and you get New targets included 1 New alignment includes 1151 subseqs was 1149 including original query In this example round 5 results in an alignment with two new subsequences a new hit sp Q09240 GLOB9_CAEEL and a second matching domain in a previously found hit sp P81044 HBAZ_MACEU The final alignment includes sequences from 1150 hits with one hit HBAZ_MACEU contributing two matching domains That marks the end of the results for one query Searching a DNA sequence database Step 1 Optionally build a profile HMM with hmmbuild This step is nearly idential to Step 1 for protein profile HMM For the DNA example type gt hmmbuild MADE1 hmm tutorial MADE1 sto and you ll see some output that looks like hmmbuild profile HMM construction from multiple sequence alignments HMMER 3 1 February 2013 http hmmer org Copyright C 2011 Howard Hughes Medical Institute Freely distributed under the GNU General Public License GPLv3 E a A A ne A SE A ee A e A input alignment file tutorial MADE1 sto output HMM file MADE1 hmm E A a ee RA a A a E a Bee ek ee eh ee Ba da ed ie ee idx name nseg alen mlen W eff_nseq re pos description EEEE A recat AS a A AR A NA A eet a ee 1 MADE1 1997 ILIZ 80 426 3 91 0 708 MADE1 MAriner Derived Element 1 a TcMar Mariner DNA CPU time 0 15u 0 01s 00 00 00 16 Elapsed 00 00 00 20 Notice the new output column with the head
213. textw Unlimit the length of each line in the main output The default is a limit of 120 characters per line which helps in displaying the output cleanly on terminals and in editors but can truncate target profile description lines textw lt n gt Set the main output s line length limit to lt n gt characters per line The default is 120 72 Options Controlling Reporting Thresholds Reporting thresholds control which hits are reported in output files the main output tblout and domtblout Sequence hits and domain hits are ranked by statistical significance E value and output is generated in two sections called per target and per domain output In per target output by default all sequence hits with an E value lt 10 are reported In the per domain output for each target that has passed per target report ing thresholds all domains satisfying per domain reporting thresholds are reported By default these are domains with conditional E values of lt 10 The following options allow you to change the default E value reporting thresholds or to use bit score thresholds instead E lt x gt In the per target output report target sequences with an E value of lt lt x gt The default is 10 0 meaning that on average about 10 false positives will be reported per query so you can see the top of the noise and decide for yourself if it s really noise T lt x gt Instead of thresholding per profile output on E value instead r
214. the globin4 output all of which have only a single domain do the full sequence bit scores and best single domain bit scores not exactly agree For example the top ranked hit myc_pHyca sperm whale myoglobin if you re curious has a full sequence score of 222 7 and a single best domain score of 222 6 What s going on What s going on is that the position and alignment of that domain is uncertain in this case only very slightly so but nonetheless uncertain The full sequence score is summed over all possible alignments of the globin model to the myc Puyca sequence When HMMER identifies domains it identifies what it calls an envelope bounding where the domain s alignment most probably lies More on this later when we discuss the reported coordinates of domains and alignments in the next section of the output The single best dom score is calculated after the domain envelope has been defined and the summation is restricted only to the ensemble of possible alignments that lie within the envelope The fact that the two scores are slightly different is therefore telling you that there s a small amount of probability uncertainty that the domain lies somewhat outside the envelope bounds that HMMER has selected The two columns headed doms are two different estimates of the number of distinct domains that the target sequence contains The first the column marked exp is the expected number of domains according to HMMER s statistical mode
215. this line are log probabilities for each residue in the appropriate biosequence alphabet s order Optional THIMMER does not use dates for any purpose other than human readable annotation so it is no more prone than you are to Y2K Y2038 or any other date related eschatology 104 main model section All the remaining fields are mandatory The first two lines in the main model section are atypical They contain information for the core model s BEGIN node This is stored as model node 0 and match state 0 is treated as the BEGIN state The begin state is mute so there are no match emission probabilities The first line is the insert 0 emissions The second line contains the transitions from the begin state and insert state 0 These seven numbers are BoM B gt lo B gt Di Io gt Mi Io gt Ip then a 0 0 and a because by convention nonexistent transitions from the nonexistent delete state O are set to log 1 0 and log0 w The remainder of the model has three lines per node for M nodes where M is the number of match states as given by the LENG line These three lines are K is the alphabet size in residues Match emission line The first field is the node number 1 M The parser verifies this number as a consistency check it expects the nodes to come in order The next K numbers for match emissions one per symbol in alphabetic order The next field is the map annotation for this node If map was yes
216. tice if you look systematically sometimes you ll see a model that runs at something more like HMMER2 speed 100x or so slower than an average query This needless to say Will Be Fixed More processor support One of the attractive features of the HMMER3 MSV acceleration algorithm is that it is a very tight and efficient piece of code which ought to be able to take advantage of recent advances in using massively parallel GPUs graphics processing units and other specialized processors such as the Cell processor or FPGAs We have prototype work going on in a variety of processors but none of this is far along as yet But this work combined with the parallelization is partly why we expect to wring significantly more speed out of HMMER in the future How to learn more about profile HMMs Cryptogenomicon http cryptogenomicon org is a blog where Sean will be talking about issues as they arise in HMMER3 and where you can comment or follow the discussion Reviews of the profile HMM literature have been written by Sean Eddy 1996 1998 and by Anders Krogh Krogh 1998 For details on how profile HMMs and probabilistic models are used in computational biology see the pioneering 1994 paper from Krogh et al Krogh et al 1994 or our book Biological Sequence Analysis Probabilistic Models of Proteins and Nucleic Acids Durbin et al 1998 For details on many aspects of the inner workings of HMMER3 see recent papers by Sean Eddy
217. to file lt f gt rather than to stdout N lt n gt Sample lt n gt sequences per model rather than just one Options Controlling What to Emit The default is to sample N sequences from the core model Alternatively you may choose one and only one of the following alternatives a Emit an alignment for each HMM in the hmmfile rather than sampling unaligned sequences one at a time c Emit a plurality rule consensus sequence instead of sampling a sequence from the profile HMM s probability distribution The consensus sequence is formed by selecting the maximum probability residue at each match state C Emit a fancier plurality rule consensus sequence than the c option If the maxi mum probability residue has p lt minl show it as a lower case any residue n or x if p gt minl and lt minu show it as a lower case residue and if p gt minu show it as an upper case residue The default settings of minu and minl are both 0 0 which means C gives the same output as c unless you also set minu and minl to what you want 61 p Sample unaligned sequences from the implicit search profile not from the core model The core model consists only of the homologous states between the be gin and end states of a HMMER Plan7 model The profile includes the nonho mologous N C and J states local glocal and uni multihit algorithm configuration and the target length model Therefore sequences sampled from a profile may in clu
218. ts because the globins4 sto alignment doesn t have an GF ID anno tation line giving a name to the globins4 alignment so hmmbuild wouldn t know how to name it correctly To build a multi model database from a multi MSA flatfile the alignments have to be in Stockholm format no other MSA format that I m aware of supports having more than one alignment per file and each alignment must have a name on a GF 1D line But if you happen to have a Pfam seed alignment flatfile fam A seed around an example command would be gt hmmbuild Pfam A hmm Pfam A seed This would take about two or three hours to build all 10 000 models or so in Pfam To speed the database construction process up hmmbuild supports MPI parallelization As far as HMMER s concerned all you have to do is add mpi to the command line for hmmbuild assuming you ve compiled support for MPI into it see the installation instructions You ll also need to know how to invoke an MPI job in your particular environment with your job scheduler and MPI distribution We can t really help you with this different sites have different cluster environments With our scheduler SGE the Sun Grid Engine and our MPI distro Intel MPI an example incantation for building P am hmm from Pfam A seed is gt qsub N hmmbuild j y o errors out b y cwd V pe impi 128 mpirun np 128 hmmbuild mpi Pfam hmm Pfam A seed gt hmmbuild out This reduces the time to build all of Pfam to
219. ts of Mc sec million dynamic programming cells per second the CPU time and the elapsed time This search took about 2 59 seconds of elapsed wall clock time running with cpu 2 on two cores That s in the same ballpark as BLAST On the same machine also running dual core NCBI BLAST with one of these globin sequences took 2 3 seconds and WU BLAST took 4 8 seconds Single sequence protein queries using phmmer The phmmer program is for searching a single sequence query against a sequence database much as BLASTP Or FASTA would do phmmer works essentially just like hmmsearch does except you provide a query sequence instead of a query profile HMM 26 Internally HMMER builds a profile HMM from your single query sequence using a simple position independent scoring system BLOSUM62 scores converted to probabilities plus a gap open and gap extend probability The file tutorial HBB_HUMAN is a FASTA file containing the human 6 globin sequence as an example query If you have a sequence database such as uniprot_sprot fasta make that your target database otherwise use tutorial globins45 fa as a small example gt phmmer tutorial HBB_HUMAN uniprot_sprot fasta or gt phmmer tutorial HBB_HUMAN tutorial globins45 fa Everything about the output is essentially as previously described for hmmsearch Iterative protein searches using jackhmmer The jackhmmer program is for searching a single sequence query iteratively against a sequence d
220. ty Accurate statistical significance estimates are essential when one is trying to discriminate homologs from millions of unrelated sequences in a large sequence database search The statistical significance of optimal alignment scores can be calculated by Karlin Altschul statistics Karlin and Altschul 1990 1993 Karlin Altschul statistics are one of the most important and fundamental advances introduced by BLAST However this theory doesn t apply to integrated log odds sequence scores HMM Forward scores The statistical significance expectation values or E values of HMMER3 sequence scores is determined by using recent theoretical conjectures about the statistical properties of integrated log odds scores which have been supported by numerical simulation experiments Eddy 2008 And as far as speed goes there s really nothing new about HMMER3 s speed either Besides Kar lin Altschul statistics the main reason BLAST has been so useful is that it s so fast Our design goal in HMMERS was to achieve rough speed parity between BLAST and more formal and powerful HMM based methods The acceleration algorithm in HMMER3 is a new heuristic It seems likely to be more sensitive than BLAST s heuristics on theoretical grounds It certainly benchmarks that way in practice at least in our hands Additionally it s very well suited to modern hardware architectures We expect to be able to take good advantage of GPUs and other parallel processing en
221. uding the bias filter and run full Forward Backward postprocessing on most of the target sequence In contrast to hmmscan the max flag in nhmmscan sets the scanning SSV filter threshold to 0 4 not 1 0 Use of this flag increases sensitivity somewhat at a large cost in speed Set the P value threshold for the SSV filter step The default is 0 02 meaning that roughly 2 of the highest scoring nonhomologous targets are expected to pass the filter Set the P value threshold for the Viterbi filter step The default is 0 001 Set the P value threshold for the Forward filter step The default is 1e 5 Turn off the bias filter This increases sensitivity somewhat but can come ata high cost in speed especially if the query has biased residue composition such as a repetitive sequence region or if it is a membrane protein with large regions of hydrophobicity Without the bias filter too many sequences may pass the filter with biased queries leading to slower than expected performance as the compu tationally intensive Forward Backward algorithms shoulder an abnormally heavy load Assert that the target sequence database file is in format lt s gt Accepted formats include fasta embl genbank ddbj uniprot stockholm pfam a2m and afa The default is to autodetect the format of the file Declare that the input queryfile is in format lt s gt This is used when the query is sequence based rather than made up of profile model s Currentl
222. ues are upper case and a character means a deletion relative to the consensus In an insert column residues are lower case anda is padding A deletion has a cost transition probabilities were assessed penalizing the transition into and out of a deletion A pad has no cost per se instead the sequence s with insertions are paying transition probabilities into and out of their inserted residue This notation is only for your convenience in output files you can see the structure of the profile HMM reflected in the pattern of residues and gap characters In input files in most alignment formats HMMER is case insensitive and it does not distinguish between different gap characters dash period or even underscore are accepted as gap characters Important insertions in a profile HMM are unaligned Suppose one sequence has an insertion of length 10 and another has an insertion of length 2 in the same place in the profile The alignment will show ten insert columns to accomodate the longest insertion The residues of the shorter insertion are thrown down in an arbitrary order If you must know by arbitrary HMMER convention the insertion is divided in half half is left justified and the other half is right justified leaving characters in the middle Notice that in the previous paragraph we oh so carefully said residues are assigned to a state not aligned For match states assigned
223. ult is 0 01 meaning that on average about 1 false positive would be expected in every 100 searches with different query sequences incT lt x gt Instead of using E values for setting the inclusion threshold use a bit score of gt lt x gt as the inclusion threshold By default this option is unset Options for Model specific Score Thresholding Curated profile databases may define specific bit score thresholds for each profile superseding any thresh olding based on statistical significance alone To use these options the profile must contain the appropriate GA TC and or NC optional score threshold annotation this is picked up by hmmbuild from Stockholm format alignment files For a nucleotide model each thresholding option has a single per hit threshold lt x gt This acts as if T lt x gt incT lt x gt has been applied specifically using each model s curated thresholds cut ga Use the GA gathering bit score threshold in the model to set per hit reporting and inclusion thresholds GA thresholds are generally considered to be the reli able curated thresholds defining family membership for example in Dfam these thresholds are applied when annotating a genome with a model of a family known to be found in that organism They may allow for minimal expected false discovery rate 90 cut_nc cut_tc Use the NC noise cutoff bit score threshold in the model to set per hit reporting and inclusion thresholds NC thres
224. uminous that reading it is impractical and parsing it is a pain The tblout and domtblout options save output in simple tabular formats that are concise and easier to parse The o option allows redirecting the main output including throwing it away in dev null Options h Help print a brief reminder of command line usage and all available options N lt n gt Set the maximum number of iterations to lt n gt The default is 5 If N 1 the result is equivalent to a phmmer search Options Controlling Output By default output for each iteration appears on stdout in a somewhat human readable somewhat parseable format These options allow redirecting that output or saving additional kinds of output to files including checkpoint files for each iteration 0 lt f gt Direct the human readable output to a file lt f gt A lt f gt After the final iteration save an annotated multiple alignment of all hits satisfying inclusion thresholds also including the original query to lt f gt in Stockholm format tblout lt f gt After the final iteration save a tabular summary of top sequence hits to lt f gt in a readily parseable columnar whitespace delimited format domtblout lt f gt After the final iteration save a tabular summary of top domain hits to lt f gt in a readily parseable columnar whitespace delimited format chkhmm lt prefix gt At the start of each iteration checkpoint the query HMM saving it to a fi
225. und frequency dis tribution Set the background residue distribution to the mean composition of the profile This was used in exploring some of the effects of biased composition Turn the H3 target sequence length model off Set the self transitions for N C J and the null model to 350 351 instead this emulates HMMER2 Not a good idea in general This was used to demonstrate one of the main H2 vs H3 differences Set the nu parameter for the MSV algorithm the expected number of ungapped local alignments per target sequence The default is 2 0 corresponding to a E gt J transition probability of 0 5 This was used to test whether varying nu has significant effect on result it doesn t seem to within reason This option only works if msv is selected it only affects MSV and it will not work with fast because the optimized implementations are hardwired to assume nu 2 0 Set the filter P value threshold to use in generating filter power files with ffile The default is 0 02 which would be appropriate for testing MSV scores since this is the default MSV filter threshold in H3 s acceleration pipeline Other appropriate choices matching defaults in the acceleration pipeline would be 0 001 for Viterbi and 1e 5 for Forward 80 hmmstat display summary statistics for a profile file Synopsis hmmstat options lt hmmfile gt Description The hmmstat utility prints out a tabular file of summary statistics for each pro
226. up by hmmbuild from Stockholm format alignment files Each thresholding option has two scores the per sequence threshold lt x1 gt and the per domain threshold lt x2 gt These act as if T lt x1 gt incT lt x1 gt domT lt x2 gt incdomT lt x2 gt has been applied specifically using each model s curated thresholds cut ga Use the GA gathering bit scores in the model to set per sequence GA1 and per domain GA2 reporting and inclusion thresholds GA thresholds are generally considered to be the reliable curated thresholds defining family membership for example in Pfam these thresholds define what gets included in Pfam Full align ments based on searches with Pfam Seed models cut_nc Use the NC noise cutoff bit score thresholds in the model to set per sequence NC1 and per domain NC2 reporting and inclusion thresholds NC thresholds are generally considered to be the score of the highest scoring known false posi tive cut_tc Use the NC trusted cutoff bit score thresholds in the model to set per sequence TC1 and per domain TC2 reporting and inclusion thresholds TC thresholds are generally considered to be the score of the lowest scoring known true positive that is above all known false positives Control of the Acceleration Pipeline HMMERS searches are accelerated in a three step filter pipeline the MSV filter the Viterbi filter and the Forward filter The first filter is the fastest and most approximate the la
227. ver and workers are expected to remain running One or more clients then connect to the master and submit possibly many queries The master distributes the work of a query among the workers collects results and merges them before responding to the client Two example client programs are included in the HMMER3 1 src directory the C program hmmce2 and the perl script hmmpgmd_client_example pl These are intended as examples only and should be extended as necessary to meet your needs A query is submitted to the master from the client as a character string Queries may be the sort that would normally be handled by phmmer protein sequence vs protein database hmmsearch protein HMM query vs protein database or hmmscan protein query vs protein HMM database The general form of a client query is to start with a single line of the form options followed by multiple lines of text representing either the query HMM or fasta formatted sequence The final line of each query is the separator For example to perform a phmmer type search of a sequence against a sequence database file the first line is of the form segdb 1 then the fasta formatted query sequence starting with the header line gt sequence name followed by one or more lines of sequence and finally the closing To perform an hmmsearch type search the query sequence is replaced by the full text of a HMMER format query HMM To perform an hmmscan type search the text matches th
228. vironments in the near future What s new in HMMER3 1 DNA sequence comparison HMMER now includes tools that are specifically designed for DNA DNA comparison nhmmer and nhmmscan The most notable improvement over using HMMER3 s tools is the ability to search long e g chromosome length target sequences More sequence input formats HMMER now handles a wide variety of input sequence file formats both aligned Stockholm Aligned FASTA Clustal NCBI PSI BLAST PHYLIP Selex UCSC SAM A2M and unaligned FASTA EMBL Genbank usually with autodetection MSV stage of HMMER acceleration pipeline now even faster Bjarne Knudsen Chief Scientific Officer of CLC bio in Denmark contributed an important optimization of the MSV filter the first stage in the accel erated filter pipeline that increases overall HMMER3 speed by about two fold This speed improvement has no impact on sensitivity What s still missing in HMMER3 1 Even though this is a stable public release that we consider suitable for large scale production work genome annotation Pfam analysis whatever at the same time HMMER remains a work in progress We think the codebase is a suitable foundation for development of a number of significantly improved approaches to classically important problems in sequence analysis Some of the more important holes for us are Translated comparisons We d of course love to have the HMM equivalents of BLASTX TBLASTN and TBLASTX Th
229. y distributed under the GNU General Public License GPLv3 Sh et ae et RIA AS e a IS ee AA ge ed a ee te ee query HMM file globins4 hmm target sequence database uniprot _sprot fasta per seq hits tabular output globins4 tbl per dom hits tabular output globins4 domtbl number of worker threads 2 A e E ALAN A o A A e A A A A A o 7 a Query globins4 M 149 Scores for complete sequences score includes all domains 20 19812 90369 55099 90347 10178 90363 The second section is the sequence top hits list It is a list of ranked top hits sorted by E value most significant hit first formatted in a BLAST like style full sequence best 1 domain dom E value score bias E value score bias exp N Sequence 6 5e 65 222 7 3 42 7 2e 65 222 6 362 1 0 1 sp P02185 MYG_PHYMC 3 3e 63 217 2 0 1 3 7e 63 217 0 0 1 1 0 1 sp P02024 HBB_GORGO 4 9e 63 216 6 0 0 5 4e 63 216 5 0 0 1 0 1 sp P68871 HBB_HUMAN 4 9e 63 216 6 0 0 5 4e 63 216 5 0 0 1 0 1 sp P68872 HBB_PANPA 4 9e 63 216 6 0 0 5 4e 63 216 5 0 0 1 0 1 sp P68873 HBB_PANTR 7e 63 216 1 30 7 7e 63 216 0 3 0 1 0 1 sp P02177 MYG_ESCGI Description Myoglobin OS Physeter macrocephalus GN Hemoglobin subunit beta OS Gorilla gor Hemoglobin subunit beta OS Homo sapien Hemoglobin subunit beta OS Pan paniscu Hemoglobin subunit beta OS Pan troglod Myoglobin OS Eschrichtius gibbosus GN The last two columns obviously are the name of each target sequence
230. y the accepted multiple alignment sequence file formats include Stockholm Aligned FASTA Clustal 91 nonull2 Z lt x gt seed lt n gt w_beta lt x gt w_length lt n gt toponly bottomonly cpu lt n gt stall mpi NCBI PSI BLAST PHYLIP Selex and UCSC SAM A2M Default is to autodetect the format of the file Turn off the null2 score corrections for biased composition For the purposes of per hit E value calculations Assert that the total size of the target database is lt x gt million nucleotides rather than the actual number of targets seen Set the random number seed to lt n gt Some steps in postprocessing require Monte Carlo simulation The default is to use a fixed seed 42 so that results are exactly reproducible Any other positive integer will give different but also reproducible results A choice of 0 uses a randomly chosen seed Window length tail mass The upper bound W on the length at which nhmmer ex pects to find an instance of the model is set such that the fraction of all sequences generated by the model with length gt W is less than lt x gt The default is 1e 7 This flag may be used to override the value of W established for the model by hmmbuild or when the query is sequence based Override the model instance length upper bound W which is otherwise controlled by w_beta It should be larger than the model length The value of W is used deep in the acc

Download Pdf Manuals

image

Related Search

Related Contents

Samsung SMART CAMERA WB850F Инструкция по использованию  Manual Warrior Feed 304    Processus de sélection des communautés participantes au Québec  none RG195/5 Instructions / Assembly  Samsung 23 colių FHD monitorius su multimedia Vartotojo vadovas  Tiefkühlschrank Upright freezer  Hybrid-Post - セキスイエクステリア  S`exercer à l`égalité II  

Copyright © All rights reserved.
Failed to retrieve file