Sierra Monitor Corporation HRG010-W User's Manual
Contents
1. GM THERMO 2e R POWER LED ore A Hi gt OFF JE ALARM2 LED RUN LED ALARM3 LED EN SV H H MODE UP m Ne ALARM1 LED Fig 5 6 POWER Lamp OFF e POWER lamp OFF Power supply error power failure 2 Turn on the main power breaker of your unit and ensure the POWER lamp comes on 5 4 Recovery from Power Failure POWER Lamp ON HRG010 W HRG015 W 1st edition Aug 2006 5 6 Rev A May 2007 HRX OM J049 A Chapter 5 Error Message and Troubleshooting B HRG010 W B HRG015 W B earth leakage breaker mounted option 1 Undo the screws 6 pcs to remove the front panel Only operate the unit with the cover panel attached The unit contains the power supply carrying high voltage inside that is isolated with the cover panel Only trained personnel are allowed to work including unit inspection around the power supply There is the presence of the surface in the unit that is at high temperatures during operation Potential burns may occur if touched Residual heat may cause burns despite the power being turned OFF Be sure of the surface reaching room temperature before work The unit contains a section which rotates when it is in action Potential personal injury may occur if touched A rotator is structured to come to a temporary stop and resume rotation Avoid performing work during system operation Screw WA i Electrical unit2. Do not operate the switches etc with wet hands and do not touch any electrical components such as a power supply plug It may cause an electric shock if disregarded Keep this unit from water Do not wash the unit with water It may cause an electric shock and fire if disregarded Cut off the power supply of the unit before performing cleaning maintenance and inspection It may cause an electric shock injury or burn if disregarded Always mount the panel back onto the unit after removing the panel for inspection or cleaning Failure to close or re attach the panel may cause personal injury or electric shock during unit operation 6 2 Inspection and Cleaning HRG010 W HRG015 W 6 2 1st edition Aug 2006 Rev A May 2007 HRX OM J049 A Chapter 6 Unit Maintenance 6 2 1 Daily inspection Perform daily inspection of the items listed in the Table 6 2 If the check finds any abnormal event stop system operation and turn off the main power supply Request for service promptly Table 6 2 Daily Inspection Inspection item Inspection method No heavy object is placed on this unit This unit Installation Check of the condition of should not be subjected to external force condition unit installation Temperature and humidity fall within the specified range Fluid leak Check of the piping No leak of facility water and circulating fluid from the connector section piping connector sections Water supply Confirm the reading on the
3. The fluid level falls within the specified range level indicator Display check The diplsay assures sharp image and numbers Operation panel Circulating fluid Confirm the reading on the Normal temperature should be assured for system temperature LCD screen use Cire latino tuia Confirm the reading on the 9 circulating fluid pressure Normal pressure should be assured for system use outlet pressure gauge Bagana anan Confirm the reading on the a 9 refrigerant high pressure Normal flow rate should be assured for system use H gauge Operating Operating condition check No abnormal noise vibration odor and smoke condition Ge Check of facility water Temperature flow rate and pressure fall within the Facility water oi if condition specified range If the above check finds any abnormal event bring the unit to a halt and turn off the main breaker Make sure to perform lockout and tagout before requesting technical service Function check The lamp is ON HRG010 W HRG015 W 6 2 Inspection and Cleaning 1st edition Aug 2006 Rev A May 2007 6 3 HRX OM J049 A Chapter 6 Unit Maintenance 6 2 2 Quarterly inspection B Replacement of circulating fluid O Periodic replacement of circulating fluid fresh water Potential algae growth or aqueous corrosion may occur if the old fluid is reused Assure a periodic replacement of the fluid according to the situation O Cleaning of tank Check the circulating fluid in the tank for impur
4. HRG010 W HRG015 W 5 4 1st edition Aug 2006 Rev A May 2007 HRX OM J049 A Chapter 5 Error Message and Troubleshooting 3 Press the Reset switch RS yellow button on the control panel and make sure that the alarm lamp goes out Control panel Reset switch RS yellow button Fig 5 4 Location of Reset Switch RS Yellow Button B When the alarm lamp goes out by performing steps 7 to 3 4 Attach the front panel 9 Implement system startup and shutdown according to Chapter 4 Startup and Shutdown B When the alarm lamp remains on after performing steps 1 to 3 6 Press the reset button of each detector in the electrical unit f Follow step 3 to press the Reset switch RS yellow button The alarm lamp goes out accordingly 8 Implement system startup and shutdown according to 4 3 Unit Startup and Shutdown Pump overload reset button blue button Compressor overload reset button blue button E Front Facility water supply suspension P reset button red button Fig 5 5 Location of Reset Switch RS Yellow Button HRG010 W HRG015 W 5 3 Alarm Reset Alarm Lamp OFF 1st edition Aug 2006 Rev A May 2007 5 5 HRX OM J049 A Chapter 5 Error Message and Troubleshooting 5 4 Recovery from Power Failure POWER Lamp ON B Power error check 1 Request an expert engineer to eliminate the cause of a power failure such as a ground falut and overcurrent
5. CC k d 4 Screw Front panel pa m vm wm m mm um mw mm ww mw m wm ww ws aw den uw ws mw wm le N Fig 5 7 Removal of Front Panel HRG010 W HRG015 W 5 4 Recovery from Power Failure POWER Lamp ON 1st edition Aug 2006 Rev A May 2007 5 7 HRX OM J049 A Chapter 5 Error Message and Troubleshooting 2 Check the earth leakage breaker on the electrical board of the electrical unit Earth leakage breaker optional Electrical unit Fig 5 8 Location of Earth Leakage Breaker Optional 3 Switch off the earth leakage breaker once f Switch in the OFF position f e ay Kc Sts Es p Front P bi l me An Fig 5 9 Earth Leakage Breaker OFF 4 owitch on the earth leakage breaker and make sure that the POWER lamp comes on ds IS SH Zei Switch in the ON position d 3 Fe n Front T bi W o jj Fig 5 10 Earth Leakage Breaker ON 5 4 Recovery from Power Failure POWER Lamp ON HRG010 W HRG015 W 1st edition Aug 2006 5 8 Rev A May 2007 HRX OM J049 A Chapter 6 Unit Maintenance Chapter 6 Unit Maintenance 6 1 Control of Water Quality The circulating fluid used in this unit is fresh water tap water This unit may be damaged when unpermitted fluids are used Potential fluid leak may occur if disregarded which results in electric shock and ground fault ONLY use fresh water tap water which satisfies water quali
6. EJIN ulw Oo ON S9A LNO NI ON S9A ON S9A Jo ed GTA e uonounj Aejdsiq jueul amp pnr SSoud 1e Uu ayes mo y JO oDuey Jayem Ayoe4 ping Bunemoso NPIUNH due aueu JnoA Uone ejsu Jaye dn yejs sy uodn uomnipuoo Wa sAs ay pJooei 0 eJns eg eoueuoyure N jun 9 Ja1deyo jo uonoedsutr ON elas Ajieq ul uonoedsu Ajieq 7 9 a q8 ees ajoo5 OW SU aY UO susy uornoedsul Aep wyuoo O Spon jeeus uonoedsu Aled M SL099M M 0109 YH 19 009 ouueu NG 7 6 Daily Inspection Sheet 1 8 1st edition Aug 2006 Rev A May 2007 Product Warranty 1 Warranty If a failure is observed in our Thermo Cooler repair shall be provided in accordance with the warranty period and preconditions defined below at SMC s option Repair involves the inspection and or replacement and or modification of a defective part Removed parts shall become the possession of SMC 2 Warranty period The warranty period of the product shall be 1 year from the date of your purchase 3 Warranty exemption SMC s liability under this warranty shall not be available for the following troubles and damages 1 Troubles or damage caused by the neglect of our designated inspection daily inspection periodic inspection 2 Troubles or damages caused by mishandling such as using improper operating procedure and using with our specifications violated 3 Troubles or damages caused by unauthorized modification 4 Troubles or damages cause
7. IN Rc1 2 TRA Facility water OUT Rc1 2 Electrical unit Auto supply port Rc1 2 Circulating fluid OUT Rc3 4 Circulating fluid RETURN Rc3 4 Level gauge Manual relief valve Power cable access Cable Grip Signal cable access Cable Grip Port for overflow Rc1 2 4 013 F hor bolt For anchor bolt Tank drain port Rc1 2 Front plugged Right Left Fig 2 4 Name of Each Section HRG015 W HRG010 W HRG015 W 2 2 Name of Each Section 1st edition Aug 2006 Rev A May 2007 2 3 HRX OM J049 A Chapter 2 Appearance and Each Section 2 3 Control panel The control panel on the system front allows you to perform basic system operation including temperature adjsutment system start and stop 1 Digital display PV SV GSMC THERMO COOLER POWER RUN PUMP ALARMA ALARMZ 1 WUT TTT EG ll MODE DOWN Ar ET 10 11 12 Fig 2 5 Control Panel Table 2 1 Control Panel Indicates actual temperature of a circulating fluid Indicates set temperature of a circulating fluid POWER LED Lights up when the power is supplied CUMPLEN Lights up when the ON switch is pressed ALARM 1 LED Lights up when an alarm 1 arises 6 ALARMZ LED Lightsupwhenanalarm2arises o o 8 JON switch Thisisusedtoruntheuni 9 OFF switth Thisisusedtostoptheuni O 2 3 Control panel 2 4 See Chapter 5 Error Message and
8. Instructions 1 8 Material Safety Data Sheet MSDS HRGO010 W HRG015 W 1st edition Aug 2006 1 12 Rev A May 2007 HRX OM J049 A Chapter 2 Appearance and Each Section Chapter 2 Appearance and Each Section 2 1 Appearance Fig 2 2 Appearance of HRG015 W HRG010 W HRG015 W 2 1 Appearance 1st edition Aug 2006 Rev A May 2007 2 1 HRX OM J049 A Chapter 2 Appearance and Each Section 2 2 Name of Each Section 2 041 HRG010 W Top Y shaped strainer Rc1 2 accessory l Refrigerant high Power signal connection Eyebolt M12 PIS MEE gauge l l terminal block Control panel Circulating fluid pressure gauge Facility water IN Rc1 2 Facility water OUT Rc1 2 Electrical unit Auto supply port Rc1 2 Circulating fluid OUT Rc3 4 Circulating fluid RETURN Rc3 A4 Ventilating hole Level gauge Manual relief valve Power cable access Cable Grip L 7 Signal cable access Cable Grip Port for overflow Rc1 2 4 013 For anchor bolt Tank drain port Rc1 2 Left Front plugged Right Fig 2 3 Name of Each Section HRG010 W 2 2 Name of Each Section HRG010 W HRG015 W 1st edition Aug 2006 2 2 Rev A May 2007 HRX OM J049 A Chapter 2 Appearance and Each Section 2 2 2 HRG015 W Top Y shaped strainer Rc1 2 accessory Refrigerant high ressure gauge Power signal connection Evebolt M12 H 9 9 terminal block Control panel yebo Circulating fluid pressure gauge Facility water
9. Location of hazard warning label eese nennen nennen nnn nnn nnns 1 6 1 4 Model LAD CG oet rto cr cc 1 6 S Safety IE DPI cS 1 7 1 5 1 e tactu secun no LE casement ee ee eee 1 7 1 5 2 Frotecuve equipImelit 3415 ciui tud aco Eee ANA Laval ia 1 8 L Emergency Measures Ai 1 9 Lif JDISDOSIUODB O Waste aria 1 10 1 7 1 Recovery of refrigerant and compressor OU 1 10 1 7 2 Circulating HUNG aisSDOSSl o rscestei timo A t See LO Er 1 11 1 7 3 A s date e LO SNL ANA 1 11 1 8 Material Safety Data Sheet MSDS 1eeeeeeeeeeeeeee eee nenne nnn 1 11 Chapter 2 Appearance and Each Section 2 1 K ME el e ne EE 2 1 2 2 Name of Fateh SC CUCM sucus e a EE AA 2 2 2 2 1 alie uim e 2 2 EE EE 2 3 2 3 end eh e E CI AA EET 2 4 Chapter 3 Transport and Installation 3 1 SX Mans DO eR 3 1 3 1 1 Transporting with forklift and unit lifting 20 0 cece eececeeeeeeeeeee esses eeseeeeseeeeaeeesaeeeeeeeeseeens 3 2 3 1 2 RE Eelere WIN Castiello ius La aM aerea ande debba RUE Lead 3 3 92 INSTA la ON AA NA AA 3 4 3 2 1 Iistallallon Condon Survival AA 3 4 3 2 2 Je te Reie DEE 3 5 3 2 3 Installation location and maintenance work arez 3 6 3 2 4 E m RTL orm 3 7 3 2 5 miei qae EE ra ir A 3 9 3 2 6 A A EAE AE OP EE E 3 13 HRG010 W HRG015 W 1st
10. POWER POWER O i SNC THERMO Geer POWER LED ma POWER RUN nE EN a o 5 ING ALARM 3 LED um sv MODE A P m G Y Fig 5 1 Control Panel ALARM 1 LED Table 5 1 Error Message Settin Svstem LED Operation Error stop R See e Off O On signal signal POWER RUN ALARM1 EN EN output output Open Closed Power error Stopped Sonia Stan ES EE SS Reverse of pump Open Open Lower limit E TARE NUG EVEI fluid level in Stopped Greene Open Open drop contact contact the tank Suspension of facility water Stopped Greene Open Open contact contact gom Open Open High temp LII 40 NN and Open Open Compressor Stopped Greene Open Open overload contact contact HRG010 W HRG015 W 5 1 Error Message 1st edition Aug 2006 Rev A May 2007 5 1 HRX OM J049 A Chapter 5 Error Message and Troubleshooting 5 2 Troubleshooting See 5 3 Alarm Reset for error recovery Table 5 2 Troubleshooting Alarmreset Lector RE E AOTT LOCO With the switch its ON position supply the No poner s supped mar power Only qualified personnel are allowed for power wiring Supply 3 p power R and ES Ow E phases EE personnel are allowed for power wiring 1 Supply a rated voltage Only qualified Lowvotaoe personnel are alowed forpowerwing 7 Reverse of Incorrect phase Rewire the power cable for tw jpf three pump and sequence of power phases phase sequ
11. Troubleshooting for alarms 1 to 3 HRG010 W HRG015 W 1st edition Aug 2006 Rev A May 2007 HRX OM J049 A Chapter 3 Transport and Installation Chapter 3 Transport and Installation The unit must be handled in correct manner Exercise caution to asure personnel safety during the installation operation maintenance and inspection of the unit Only personnel with sufficient knowledge and experiences with the unit and unit are allowed to transport install and conduct maintenance possibly exposed to dangerous situations 3 1 Transport The unit is heavy and poses potential danger at transportation To prevent damage to the unit be sure to follow the instructions below when transporting the unit If the forklift is used for transporting ensure that the fork is inserted in a place as specified in Fig 3 1 Forklift Insertion Position and Unit Lifting O f eyebolts are used for lifting ensure the unit is held at four points Keep each eyebolt at an angle from Min 60 degrees with repect to the postion of the center of gravity when lifting the unit Never set the unit on its side The refrigerant oil will drain into refrigerant piping from the compressor reducing its amount in the compressor It results in a compressor failure Drain the residual fluid from piping as much as possible to prevent spill If the forklift is used for transporting the unit be sure to prevent the fork from contacting the cover pane
12. by use for purposes other than the original intent This unit operates under high voltage and contains components that cause a rise in temperature and rotate All personnel are required to read and understand the safety related items in this manual before working with this unit This manual is not for comprehensive safety and hygiene education Such a manual should be provided by a safety training manager All personnel who work on or around this unit are to have proper training and education on dangers specific to this unit and safety measures against potential hazards O A safety manager is responsible for observing safety standards Operators and service technicians have individual responsibilies for their safety during operation of this unit in his her daily work Operators must individually take account of safety and assure a proper working area and working environment O The relevant personnel must receive proper safety education before working on this unit to prevent dangers Never conduct work training without giving proper consideration to safety Save this manual at a designated place for reference when necessary 1 1 Before Using this Unit 1 1 HRX OM J049 A Chapter 1 Safety Instructions 1 2 Danger Warning and Caution 1 2 1 Level of risk This unit is designed with the safety of workers and the prevention of system damage This manual classifies the risks into the following three categories according to
13. edition Aug 2006 Rev A May 2007 TOC 1 HRX OM J049 A Table of Contents 3 2 1 SUppiv OF circulating TUNG ad da acid 3 15 3 2 8 Kielen UE leie OU obio 3 16 Chapter A Startup and Shutdown eee eee 4 1 aa PIECE Ea NA Tx 4 1 4 1 1 INStalation CONAM gm oT nl 4 1 4 1 2 ideal AA NI i erc 4 1 4 1 3 Facility WALT DIDIN oos M rcr 4 1 4 1 4 PRIDNO Mio de o MPO PCR LA a AG ee oe 4 1 4 1 5 Supply OF Circulating TWIG aaa oi 4 1 4 2 ErSpotabotrtetetabt Hee 4 2 4 2 1 POWET SUPDIN umaga nie est sad aa aa si 4 2 4 2 2 Setting of circulating fluid temperature nannannnannnannnnnnannnnnnnrnnnrennnonrrenernrennrrnrrsnrrnnennrennen 4 2 4 2 3 3AddiuoDal walter Supply sd alto etie bodie tdt 4 3 4 3 Unit Startup and Shutdown iaa 4 4 4 3 1 bear AA 4 4 4 3 2 SIOPPIN AA 4 4 44 CHECK Ab SLAM WEE 4 5 Chapter 5 Error Message and Troubleshooting 5 1 21 rop lee 5 1 92 RE le Le Nga b 5 2 5 3 Alarm Reset Alarm Lamp OFF 1 11 11 eene nenne nnn nn nani 5 3 5 4 Recovery from Power Failure POWER Lamp ON eere 5 6 Chapter 6 Unit Maintenance 1 nennen 6 1 6 1 Control of Water lee eege AA 6 1 62 Inspection anda Cleaning su oie ociceaeicn a da 6 2 6 2 1 Dal ISOS C IO DNE mu m 6 3 6 2 2 a do E I En eL C i oi 6 4 6 2 3 BlannualNSpeel0N anan an E 6 4 6 2 4 Check during wintertime nennen nennen nnns nnns nne nnne sn
14. exposed to moisture may develop a short circuit which can result in an electrical shock fire and failure in the unit Install the unit on a flat and level floor which can support the weight of the unit Take measure to prevent the unit from tipping over Improper setup may cause water leakage from the unit and personal injury Keep ambient temperature of the unit between 5 and 40 C Unit operation at below 5 C may lead to failure in the compressor Operation at above 40 C will reduce effectiveness of the condenser and trigger the safety device which brings the unit to a stop 3 2 1 Installation conditions Do not use or store the unit in the following environments Potential unit malfunction and damage may occur if disregarded Environment that is exposed to water vapor salt water or oil mist Environment that is exposed to dust or powdery materials Environment that is exposed to corrosive gas flammable gas or solvent Environment that is exposed to direct sun light or radiant heat Environment where ambient temperature is out of the specified range between 5 C to 40 C Environment that is subjected to abrupt changes in temprature Environment that is subjected to strong electromagnetic noise incl strong electrical field strong magnetic field or surge voltage Environment that generates static electricity or condition in which static electricity discharges to the unit Environment that generates strong high
15. frequencies Environment at high altitudes of over 1000m Condition which allows strong vibrations and impacts to transmit to the unit Condition with external force or load to deform the unit Condition with an insufficient maintenance space as required Condition with no adequate space for ventilation 3 2 Installation HRG010 W HRG015 W 1st edition Aug 2006 3 4 Rev A May 2007 HRX OM J049 A Chapter 3 Transport and Installation 3 2 2 Installation location A water refrigerated thermo cooler is designed to exhaust heat through a supply of facility water Secure water sources listed below B Required water sources Table 3 1 Heat Discharge and Required Quantity of Facility Water HRG010 W HRG015 W Heat discharge n 5 Required water Model kW Facility water temp range C quantity L min HRG010 W Approx 16 5 to 32 HRG015 W Approx 23 Rated temp 25 B Outside installation HRG010 and HRG015 are IPx3 compliant rainproof systems but not rendered complete waterproof Install the system out of direct sunlight as well as direct rain and snow e g under the eaves HRG010 W HRG015 W 3 2 Installation 1st edition Aug 2006 Rev A May 2007 3 5 HRX OM J049 A Chapter 3 Transport and Installation 3 2 3 Installation location and maintenance work area Installation with maintenance space is recommended See Fig 3 4 Ensure an adequate ventilation space for the temperature controller F
16. high voltage inside that is isolated with the cover panel Only trained personnel are allowed to work including unit inspection around the power supply B High temperature hazards The unit reaches high temperature during operation and may cause burns when an operator comes in contact The attached label contains the symbol There is the presence of the surface in the unit that is at high temperatures during operation Potential burns may occur if touched Residual heat may cause burns despite the power being turned OFF Be sure of the surface reaching room temperature before work B Rotating object hazards The unit includes several parts that rotate during operation and may cause the operator to get the finger caught in these parts The attached label contains the symbol The unit contains a section which rotates when it is in action Potential personal injury may occur if touched A rotator is structured to come to a temporary stop and resume rotation Avoid performing work during system operation 1 3 Hazard Warning Label HRGO010 W HRG015 W 1st edition Aug 2006 1 4 Rev A May 2007 HRX OM J049 A Chapter 1 Safety Instructions 1 3 2 Type of hazard warning labels Do not remove or deface the warning labels Read the contents of the hazard warning labels with care to keep them in mind B Warning label on the front panel 1 Read manual before operation A 2 Setit up by qualification preson s pip
17. inspections designated in the Operation Manual shall be made as scheduled 3 Inspection record shall be entered in the Daily Inspection Sheet provided in the Operation Manual 6 Request for warranted repair As to warranted repair please contact the supplier you purchased this system from for service Warranted repair shall be on request basis Unrequited repair shall be provided in accordance with the warranty period preconditions and terms defined above Therefore the repair service shall be available on a chargeable basis if a failure is detected after the warranty period
18. meets the specification of the unit e Always establish a ground for safety e Do not connect the ground to a water line gas pipe or lighting conductor e Do not branch off the wiring to make multiple circuits Potential hot spots or fire may occur if disregarded B Power supply cable and GFCI breaker Select a cable for power supply and GFCI breaker corresponding to the model no provided in the following table Table 3 2 Cable for Power Supply and Current Leakage Powsncabls Round crimp contact size 14 58 6 core 0 75 mm Y shaped crimp contact size 1 25Y 3 Capacity of GFCI breaker Use the breaker with current sensitivity of 30mA at minimum HRG010 W HRG015 W 3 2 Installation 1st edition Aug 2006 Rev A May 2007 3 9 HRX OM J049 A Chapter 3 Transport and Installation B How to conduct wiring 1 Undo the screws 6 pcs and take off the front panel E d Screw Electrical unit Front panel Fig 3 7 Removal of Front Panel 2 Connect the power supply cable and signal cable as shown in the figure Power cable Signal cable Power cable access Fig 3 8 Electrical Wiring 3 2 Installation HRG010 W HRG015 W 1st edition Aug 2006 3 10 Rev A May 2007 HRX OM J049 A Chapter 3 Transport and Installation B Electrical wiring diagram O Prepare cables for the power supply and signal lines separately e Maintain polarities of DC24V when connectin
19. on the POWER lamp remains on and the RUN lamp remains off 2 Fully open valves laid with pipes on your unit to allow the circulating fluid to flow upon automatic pump operation B Antifreeze function automatic pump operation 1 After performing steps f and 2 automatic pump operation takes place when the circulating fluid drops 3 C or below 2 The circulating fluid is heated by pump power output The pump comes to an automatic stop when the circulating fluid reaches 5 C or higher 3 The circulating fluid is allowed to be in the 3 to 5 C range in temperature that is resistant to freezing e Contact expert engineers Complete prevention of freezing the fluid may if the unit is installed in an intensely cold place The above usage conditions require an addition of other antifreezing unit such as a commercial tape heater HRG010 W HRG015 W 6 2 Inspection and Cleaning 1st edition Aug 2006 Rev A May 2007 6 5 HRX OM J049 A Chapter 6 Unit Maintenance 6 3 Consumables Replace the following parts in response to the level of wearing out at inspection Table 6 3 Consumables Partnumber Part JI Qty Remarks HRG S0034 Mechanical seal set Service part for HRG010 HRG S0035 Mechanical seal set Service part for HRG015 6 4 Long term Storage Follow the procedures below for long term storage of the unit or for anti freezing of the fluid during wintertime 1 Turn off the main power
20. opa Indra pub indio jeubs ydo es ERES GM dos dung voqeedg uogewdg des bus HU g Dads 1exeeJq 1949 LK air d Gg T EE HSSE in i e dos Aouabiewa AOTT DOEN 7 EE rss E iz dogs Aauabuaur3 PWE AG ka dwe My Te 1 dogs Kauabraur3 SH duet gek RW ei Kiem uoqesado Top 20 aunyevecway yas ag Fesch M Kay dri AS lel A kay NMOO AS SI O Kang apa aga Jo app jes au JE GO Lung LAS ydio juo Lema Ms SH doe ERES da SH MS daO ID Cd ye si pang e uaga pasa INO IND Sg Dee D gangene si png e uaga udg TTT 5 18 IAEA moos AS 7 A nopea AS EE Basa pusa Teran se o an DO o BOBOBODOO O al eme Sch jw len te TT anopeas Aa Sch rs a oua c ibl Tart boda pepe mate pda penes pwee nins BE LE wd 20 MO mon pf Demos dung operado away UOPIRULIOS BOR EOIN ULC Kiel peccare cx Barm pry arp pesar me agar uoissiuSuen Jam breebase burg wa ap ange gg Lay uec a pg pusa LES arun UOQEDIUMUULUOZ TE hangad sadura Buurg poser p Musa a Lin Gaan Eurus uoqeorunuauo OU ups mo J Addins samod usamos au vadi des isaac Burp ag WPS DICT pierde TA TM jus Gu eubis duj peog ov Aids aod 9g mon leg Hp Dee den der AO Ed VOTE SERA Josssuduuo dung 109 Seen yeg Ajddns samod podul SCH ege Su va Doug uayen 0 348 LE e peed ucdn wade HE dogs Asuabrawe ye vado voesado jeuuou je paso Ge 2 indjno fe uoqesado orae vodn pasa x des Dusbaus
21. opened fitting of eternal piping stop manual operation of the pump and fix the leak HRG010 W HRG015 W 4 2 Preparation for startup 1st edition Aug 2006 Rev A May 2007 4 3 HRX OM J049 A Chapter 4 Startup and Shutdown 4 3 Unit Startup and Shutdown 4 3 1 Starting the unit 1 Press the ON switch on the control panel The unit starts operating and regulates the circulating fluid temperature The RUN LED and PUMP LED on the control panel come on RUN e RUN LED EM THERMO COOLER DTD MODE pA O ON switch F ig 4 5 Starting the Unit 4 3 2 Stopping the unit 1 Press the DFF switch on the control panel The unit stops The RUN LED and PUMP LED on the control panel go out c SNC THERMO COOLER RUN LED PUMP LED OFF O JU TU MODE FUNC gud OFF switch Fig 4 6 Stopping the Unit 4 3 Unit Startup and Shutdown HRG010 W HRG015 W 1st edition Aug 2006 4 4 Rev A May 2007 HRX OM J049 A Chapter 4 Startup and Shutdown 4 4 Check at startup Check the following items at startup of the unit When any abnormality is found press the OFF switch immediately to stop the unit and turn the main power supply off No leak from circulating fluid piping No circulating fluid flowing out of the overflow outlet and tank drain port Circulating fluid pressure within the specified range B Bypass valve Normally the bypass valve i
22. to dispose of waste The release of refrigerant to atmosphere is banned by law Only personnel with sufficient knowledge and experiences with the unit and associated equipment are allowed to recover refrigerant and compressor oil The person must have proper license to perform refrigerant recovery Tips The type and amount of used freon can be found on the label 1 7 Disposition of Waste HRG010 W HRG015 W 1st edition Aug 2006 1 10 Rev A May 2007 HRX OM J049 A Chapter 1 Safety Instructions 1 7 2 Circulating fluid disposal As to the disposal of a circulating fluid ethylene glycol solution consign the specialized industrial waste disposal agency with the contents detailed 1 7 3 System disposal As to the disposal of this system consign the specialized industrial waste disposal agency in accordance with law on Waste Disposal and Cleaning 1 8 Material Safety Data Sheet MSDS Material Safety Data Sheet MSDS is supplied separately Contact the system supplier if you need the MSDS regarding chemicals used in this system For each chemical you purchased the relevant MSDS is to be obtained under your responsibility Keep the MSDS along with this manual in the condition that allows all personnel to check the contents anytime to gain the understanding of potential hazards HRG010 W HRG015 W 1 8 Material Safety Data Sheet MSDS 1st edition Aug 2006 Rev A May 2007 1 11 HRX OM J049 A Chapter 1 Safety
23. 20 TB27 Contact closed during Power off 0 0 75 Kao Operation signal output relay contact re normally close opened for error sq NA Contact open during power off Electrical unit Electrical circuit FG Frame ground d Remote operation input circuit Remote operation input circuit Hi Operation signal output circuit I O board Fig 3 10 Electrical Wiring Diagram HRG015 W HRG010 W HRG015 W 1st edition Aug 2006 Rev A May 2007 3 2 Installation 3 11 HRX OM J049 A Chapter 3 Transport and Installation B Procedures for communication cable wiring installation RS485 HRG010 W C HRG015 W C communication feature laden option The communication cables are to adhere to specifications shown below Table 3 3 Communication Cable Lo em Specifications Communcai n able Shielded twisted pair wire 0 75mm Y shaped crimp contact size 1 25Y 3 1 Connect the power cables properly as shown below HS EAS MESE td AA Dx e Ve Ng Be O b aq PO EE N OS y Vi Communication cable CH 1 c TNA AA Signal cable access TM communication cable access Fig 3 11 Communication Cable Wiring 2 Have the converters listed below available Establish connection with the computer with a RS232C terminal Table 3 4 Converter Example Specifications Part number KS 485 Manufacturer System Sacom D sub 9 pin male Part number AR 305 Manufa
24. G015 W 1st edition Aug 2006 1 2 Rev A May 2007 HRX OM J049 A Chapter 1 Safety Instructions 1 2 3 Symbols This manual provides the following symbols in addition to Danger Warning and Caution to present the warning details in easy to understand manner B Symbol of electrical hazard This symbol warns you of possible risk of electrical shock BH Symbol of heat hazard e This symbol warns you of potential burns B Symbol of rotating shaft hazard This symbol warns you of possible risk caused by a rotating object B Symbol of Don ts This symbol denotes the items that must not be attempted B Symbol of Dos This symbol denotes the obligation items which you must follow in operation of this unit HRG010 W HRG015 W 1 2 Danger Warning and Caution 1st edition Aug 2006 Rev A May 2007 1 3 HRX OM J049 A Chapter 1 Safety Instructions 1 3 Hazard Warning Label The hazard warning labels indicate where potential hazards are present during unit operation and maintenance The hazard warning labels are in appropriate sizes and colors They contain symbols in addition to the descriptions of warnings 1 3 1 Classification of risks B High voltage hazards The unit is operated at high voltage and may cause an electrical shock The attached label contains the symbol Only operate the unit with the cover panel attached The unit contains the power supply carrying
25. HRX OM J049 A 1st edition Aug 2006 Rev A May 2007 Water refrigerated Thermo cooler HRG010 W HRG015 W SMC Corporation Save This Manual Carefully for Use at Any Time 2006 SMC CORPORATION All Rights Reserved To the Customers Thank you for purchasing our THERMO COOLER HRG Series hereinafter called This unit For safety and efficiency be sure to read and understand this manual thoroughly before performing operation of this unit O All warnings and precautions defined in this manual shall be observed e This manual provides instructions for the installation and operation of the unit Only personnel who understand basic operation described in this manual are qualified to perform the installation and operation of the unit e Copying duplicating or transferring any part of or whole contents of this manual without SMC Corporation s permission is strictly prohibited HRX OM J049 A Table of Contents Table of Contents Chapter T Safety Instructions eoi Ana voces Essen res genee 1 1 1 4 Betore Using this hl bo ixi is 1 1 1 2 Danger Warning and Caution 1 227 nene nnn nnne nnn nnns nnn nnns 1 2 1 2 1 Level Or TSK ERE EE E D S DL ET 1 2 1 2 2 Definitions of Serious injury and Minor mun 1 2 1 2 3 Ee 1 3 1 3 Hazard Waring LADO ci A AA A AAA uc ania orale 1 4 1 3 1 ERA ee US SA 1 4 1 9 2 Type of hazard warning labels nennen nennen nnne nna nnn nns 1 5 1 3 3
26. L GK dE Ia Aedes Bupooo Burg uad mapala yes EIE att LE assado bung pian x mh ed si pn Um paa RG NINO yeubes ndng Addns aad secher dogs amadeo Bure edel Wu EE kasten vo Send ciep aseyd gt jguBis 1nduj peog oil Addins scd ag mun lea ABA ge dos audio dos du DR Ar Ou On SERA Jossadwon dung EUR Ou Apddns samod ynduj HdO Sei nd yo awod vodn vado 154 l d KT idos Asuabiawa ye uade TI MIA TN vogerado jeuuou je pasoo LI SN qidino jeug vogesado EDU eara Dein uodn pasagi dpi dens AauaGiawsa ye uad UNIO jewo le pasara D 34 82 ano peubis dope ga ENE zas SE NP indui euis voyesado apoway LEUL es Si lalala i LH D Z 5 i es 4 p er ir CA E zn sul mm RES A loy n Abze 20 ue 1 5 7 4 Electric Circuit Fig 7 3 Electric Circuit HRG010 W HRG015 W HRG010 W HRG015 W 1st edition Aug 2006 Rev A May 2007 HRG010 W BC HRG015 W BC HRX OM J049 A Chapter 7 Documents 7 4 2 Zotoon s paa may vag usd reng EN edo ugedo Eu ye paso edd asaan e und aunssaud meli BORD pra uogesado Eu Je beer uaap ansad bebe punu ping PEE uogdapap seg aay BT ug e a unoum u naajap UI SL SJH FL g PI 2 ao Daupaan pe ai Great ufa g uda boat puudu je Dos oa gou Je paso Dem Zen Tp papa HIER uonsapap z LLE ys Deum je usd uogezado puncu e mec bUL z nger sum adun em pa Si noun uogaejap E Vue 9 9eds uonoun uogeoiunuiuo ZK LSA ues
27. N LED f d B B B B sw 8 8 8 8 E B ALARM ALARM SAIS a 1 i ALARM1 LED ALARM3 LED Fig 5 2 Alarm Lamps ON ALARM1 ON Installation error ALARM2 ON Circulating fluid circuit error ALARM3 ON Refrigerating circuit error HRG010 W HRG015 W 5 3 Alarm Reset Alarm Lamp OFF 1st edition Aug 2006 Rev A May 2007 5 3 HRX OM J049 A Chapter 5 Error Message and Troubleshooting 2 Undo the screws 6 pcs to remove the front panel Only operate the unit with the cover panel attached The unit contains the power supply carrying high voltage inside that is isolated with the cover panel Only trained personnel are allowed to work including unit inspection around the power supply There is the presence of the surface in the unit that is at high temperatures during operation Potential burns may occur if touched Residual heat may cause burns despite the power being turned OFF Be sure of the surface reaching room temperature before work The unit contains a section which rotates when it is in action Potential personal injury may occur if touched A rotator is structured to come to a temporary stop and resume rotation Avoid performing work during system operation Screw Electrical unit L I Front panel Es L Fig 5 3 Removal of Front Panel 5 3 Alarm Reset Alarm Lamp OFF
28. Request for service service Press the RESET button of the compressor Baan maana ees GE electromagnetic switch MS2 Reduce a Manual reset BEE p calorific value output from your system blue button y overload Failure in the 4 button Failure NING tor Request for service Request Request for service service 3 compressor motor 1 The recovery from an error capable of manual alarm reset takes place with the use of the switch and reset button after the cause such as fluid level drop or abnormal temperature is eliminated 2 The recovery from an error capable of automatic alarm reset takes place when the cause such as fluid level drop or abnormal temperature is eliminated after waiting period 3 With the tripped detector located be sure to press the RESET button yellow button of the system electrical unit after the elimination of the error cause The alarm lamp goes out that enables the unit to resume 5 2 Troubleshooting HRG010 W HRG015 W 1st edition Aug 2006 5 2 Rev A May 2007 HRX OM J049 A Chapter 5 Error Message and Troubleshooting 9 3 Alarm Reset Alarm Lamp OFF B Error check 1 Check the alarm number currently activated and eliminate the error cause see Table 5 2 Adjust the unit usage and service condition ALARM ALARM ALARM2 LED POWER e gar THERMO COOLERZ POWER LED POWER RUN PUMP aav ALARM2 ALARMS olelelelle RUN o g oro RU
29. a na arsi 6 5 6 9 CODSUImmOaDIGS BATA ANA GG 6 6 64 Long term Storage iioii oo 6 6 Chapter DOCUMENIS sumisa 7 1 TA Standard E ET e de E 7 1 Te Optional SpeciliCallOliS sucias 7 3 T a e Ed RU ENEE EE 7 4 7 3 1 HRG010 W HRG010 W B HRG010 W C HRGO10 W BC HRG015 W HRGO15 W B HISGOT5 W C HROU019 W BQG iiie ados DEED e E ev En ce e e c Deren Ee 1 4 7 3 2 rs GOVO VV ALT HESQOTSSVV SAT maka NA atto nds 1 4 Td Electo ME 7 5 7 4 1 PIS GOTO RV e EEN EE 1 5 HRG010 W HRG015 W 1st edition Aug 2006 TOC 2 Rev A May 2007 HRX OM J049 A Table of Contents 7 4 2 HISGOTO VV BG HIRGOTSSVW BG ii iei ende eec eve ex RES E Ex DN PR S Se ON Lr D 7 6 LES ION Charo oo ee e io M dei 7 7 Ao Daily Inspection Sheets a a a 7 8 HRG010 W HRG015 W 1st edition Aug 2006 TOC 3 Rev A May 2007 HRX OM J049 A Table of Contents HRG010 W HRG015 W 1st edition Aug 2006 TOC 4 Rev A May 2007 HRX OM J049 A Chapter 1 Safety Instructions Chapter 1 Safety Instructions Be sure to read and understand all the important precautions in this manual before operating the unit 1 1 Before Using this Unit HRG010 W HRG015 W 1st edition Aug 2006 Rev A May 2007 This chapter describes the safety related items that users should be aware of upon handling this unit O This unit is an isothermal fluid circulation system housed in the tank SMC s liability under this warranty shall not be available for troubles caused
30. ailure to create sufficient space may lead to improper cooling and or controller stop Access maintenance work area should be required for maintenance E E O del t E O O 00 Top Min 800mm Min 800mm E O co Fig 3 4 Recommended Installation Location 3 2 Installation HRG010 W HRG015 W 1st edition Aug 2006 3 6 Rev A May 2007 HRX OM J049 A Chapter 3 Transport and Installation 3 2 4 Installation Preparation of anchor bolts suitable for floor material is your responsibility Prepare M12 anchor bolts 4 pcs for installation See 7 3 Outline Dimensions for mounting of the anchor bolts Keep the unit away from vibration Install the unit on a flat and stable surface Refer to 7 3 Outline Dimensions for the dimensions of the unit B Procedure for Installation 1 The anchor bolts foundation bolts are mounted on the level concrete foundation Lower this unit inserting the anchor bolts into the unit 2 Tighten the hexagonal nut to secure the unit onto the foundation 3 Make sure of no looseness between the anchor bolts and foundation Anchor bolt mounting hole 013 Hexagonal Ww Anchor bolt E sc E Td F Front Ky y N D E Concrete foundation N n a EA Fig 3 5 Procedure for Installation HRG010 W HRG015 W 3 2 Installation 1st edition Aug 2006 Rev A May 2007 3 7 HRX OM J049 A Chapter 3 Transport and Installati
31. breaker 2 Undo the tank drain hole plug to drain the fluid 3 Remove the top front panel Open the internal valve for draining facility water to drain facility water Drain facility water from the overflow outlet completely 4 Cover the unit with a plastic sheet for storage after draining is completed 6 3 Consumables HRG010 W HRG015 W 1st edition Aug 2006 6 6 Rev A May 2007 HRX OM J049 A Chapter 7 Documents Chapter 7 Documents 7 1 Standard Specifications Table 7 1 Standard Specifications 1 2 HRG010 W HRG015 W Rated ambient temp 32 C 5 to 40 C JUSWUOJIAUS Bunelado uonejejsu Humidity range 45 to 75 RH No condensation Fluid used Circulating fluid fresh water tap water or fluids resistant to corrosion of a wetted surface such as SUS304 and PVC Rated capacity of tank Supply voltage j 3 phase AC200 50Hzj AC200 to 220V 60Hz Recommended earth leakage breaker capacity 60A 30mA Sensitivity current 4 7 5 8 5 8 kW 18 0 19 0 19 0A Rated consumption electric energy 4 7 5 8 5 8kWh h Supply temp 25 C 5 to 32 C Flow rate Max 33 34L min IN OUT differential pressure Max 0 25 0 2MPa Max supply press 0 3 to 0 4MPa Exhaust heat Approx 16W Remote operation starts upon applicato of DC24V and 8 mA and stops at DCOV Supply temp 25 C 5 to 32 C Flow rate Max 38 40L min IN OUT differential pressure Max 0 25 0 2MPa Max supply press 0 3 to 0 4MPa Exhaust hea
32. cturer Arvel 3 2 Installation HRG010 W HRG015 W 1st edition Aug 2006 3 12 Rev A May 2007 HRX OM J049 A Chapter 3 Transport and Installation 3 2 0 Piping Only expert engineers or personnel who have adequate knowledge of and experiences with piping installation are allowed to install piping Potential fluid leakage or stagnant fluid may occur if disregarded O Install piping properly Failure to conduct proper piping installation may result in the entry of supplied and drained water into the inside of the building which may cause the work area and equipment to get wet Keep facility water pressure below 0 5MPa e Make sure the locations of IN and OUT ports for circulating fluid supply The reverse connection inhibits proper operation of the unit e Make sure no entry of dust and foreign materials into the water circuit during piping installation Hold the piping connected port with a pipe wrench when tightening the pipe Excessive force will damage the port and cause leaks if disregarded O Hold the piping connected port with a pipe wrench when tightening piping B Pipe diameter Table 3 5 Pipe diameter Diameter Recommended HRGO10 W HRGOISAW tightening torque B How to install piping 1 Hold the piping connected port with a specific wrench and tighten the pipe Tips Fig 3 12 Tightening of Pipe Install a valve at the drain port to facilitate the replacing and draining of the circulating f
33. d by the use of a not designated circulating fluid and facility water 5 Troubles or damages caused by wearing out such as fading on the coated or plated surface 6 Sensory phenomena that are considered no effect on the functions such as noise vibration 7 Troubles or damages caused by natural disaster such as earthquake typhoon water inevitable events and fire 8 Troubles or damages occurred under the installation conditions defined in the Operation Manual 9 Troubles or damages that are not compliant with the 5 Warranty preconditions 4 Escape clause 1 Expenses of daily inspection and periodic inspection 2 Expenses of repair consigned with neither SMC nor our authorized service station 3 Expenses of transport installation and removal of this system 4 Expenses of removal of non genuine parts and replenishment of non genuine fluids 5 Unavailability and loss due to this system being disabled such as telephone bill leave compensation commercial loss 6 Expenses and compensation for terms other than provided in 1 Warranty 5 Warranty precondition Proper use and inspection of this system is required to assure safe use of this system System warranty shall satisfy the following preconditions Please take note that warranted repair shall not be available if these preconditions are disregarded 1 System operation shall be conducted by following operating procedure defined in the Operation Manual 2 Daily and periodic
34. dition Aug 2006 Rev A May 2007 7 1 HRX OM J049 A Chapter 7 Documents Table 7 1 Standard Specifications 2 2 HRG010 W HRG015 W System stop function for low tank level tank level switch ALARMI pump compressor reverse rotation detection phase relay Protection against refrigerant pressure rise Ene gen System stop function f load trel tem stop function for abnormal stop ALARM2 ystem stop function for pump overloa overcurrent relay system stop function for abnorma circulating fluid temperature rise set temp of the temperature controller 43 C ALARMS Others Protection against supply pressure rise with a manual relief valve Antifreezing temperature control with an auto pump opera on temperature controller juswdinboa Joj UONIUN 9An9910Jgd External panel SUS tank pump impeller circulating fluid SUS tank circulating fluid IN OUT BC pump IN OUT BC pump casing hose fitting PVC impeller pump casing hose fitting PVC Nylon Nylon 12 Synthetic rubber pipe hose 12 Synthetic rubber pipe hose Polyurethane lt D e D gt Q ep oO 0 em D z O D Refrigerant supplied amount Accessories A power supply signal cable and connection terminal must be prepared under your responsibility 7 1 Standard Specifications HRG010 W HRG015 W 1st edition Aug 2006 1 2 Rev A May 2007 HRX OM J049 A Chapter 7 Documents 7 2 Optional Specificat
35. ence Only qualified TTT compressor wiring personnel are allowed for power wiring PA AREA yellow Inadequate quantity of 2 button HIE IUBE OE Replenish the circulating fluid fresh water 3 drop in the tanked fluid p 9 l level Manual reset yellow Suspension of Supplied facility water Press the reset button of the high pressure Manual reset facility water falls short of its specified cutoff switch red button supply volume Supply facility water standing at 5 to 32 C 1 Press the reset button of the pump Abnormal rise in fluid electromagnetic switch MS1 Adopt a pipe Mens ass supply pressure size suitable for circulating fluid flow or blue button yellow adjust the opening of the manual relief valve button 1 FAUTE e pump Request for service 3 motor l a 4 Improve ambient conditions to provide Abnormal rise in ambient ie l temperature ventilation and exhaust heat Keep the unit out of direct sunlight and radiant heat Excessive calorific value We Reduce a calorific value output from your unit of the chiller Manual reset Refrigerantleak Requestforservice High temp of a eek eques PE Auto reset yellow supplied fluid Compressor og Request for sens 2 button cane dne Request for service SCH electromagnetic switch q l Other errors in the l Request for service refrigerating circuit Failure in the em em Manual reset Request for service
36. g the signal cable for transmitting start stop command remote operation Refer to 7 4 Electric Circuit for the electrical circuit of the unit e HRG010 W User s preparation ELB Current leakage breaker 8 45 Power supply input f os R R a i CJ p AC200 200 220V Ka er Waa po 50 60Hz Sb ING 8 e 1 25Y 3 Remote operation signal input 24 24 Remote start upon input of DC 24V 207 25 W Remote stop upon input of DC OV ae i 28 Error deteced stop signal output relay contact IT 28 Signal cable 28 normally open closed for error niu 0 ery Contact closed during power off LL 30 0 75 Ka Operation signal output relay contact Bee EES 318 normally close opened for error T 31 CA Contact open during power off Electrical unit Electrical circuit FG Frame ground 5 T2 Y Remote operation input circuit Error detected stop signal output circuit Operation signal output circuit I O board Fig 3 9 Electrical Wiring Diagram HRG010 W e HRG015 W User s preparation 14 55 Power supply input I R Power suppl AC200 200 220V AM LS N cable 84 MIT A 50 60Hz SBI ING FOR us ELB Current leakage breaker E O 1 25Y 3 Remote operation signal input A Remote start upon input of DC 24V LL 25 Remote stop upon input of DC OV ao a 25 Error detected stop signal output relay contact Sm 28 Signal cable ENTE normally open closed for error 29
37. he system to alert them of your action Use appropriate tools and follow proper procedures See 1 5 2 Protective equipment on page 1 8 to wear protective equipment properly Refer to your safety manual for emergency evacuation Use assistance to carry object over 20 kg O Check that all parts and screws are returned to the pre work conditions at the end of work Do not work when intoxicated or feeling ill Accidents may occur if disregarded Do not remove a panel unless permitted in this manual HRG010 W HRG015 W 1 5 Safety Measures 1st edition Aug 2006 Rev A May 2007 1 7 HRX OM J049 A Chapter 1 Safety Instructions 1 5 2 Protective equipment This manual defines protective equipment according to work type Wear proper protective equipment as shown below according to work type B Forsystem transportation installation and removal O Protective footwear O Protective gloves e Hard hat B Forhandling circulating fluid O Protective footwear O Protective gloves O Protective mask O Protective apron O Protective goggles B For system operation O Protective footwear O Protective gloves HRG010 W HRG015 W 1 5 Safety Measures 1st edition Aug 2006 1 8 Rev A May 2007 HRX OM J049 A Chapter 1 Safety Instructions 1 6 Emergency Measures Press the OFF switch on the control panel located on the front of the thermo cooler only if the need to shut off the power arises due to emergency such a
38. ing and electrical work 3 Dont remove the externalprane while power supply hasu been turned on or is operating There is risk of the electric shock the burn and the laceration by rotation motor etc 4 Turn off the power supply when the alarm will be generated UU E k HOTE RK Ce MES ANAN Ti 3 KEE TE AE dE A WATE mu AG DEMOS AANER JET 4 REBEL BRATH ESL Fluorocarbon Collection and Destruction Law in Japan JOY EMRE REM GR This product uses Fluorocarbon HFC as a refrigerant 1 It is strictly forbidden to emit Fluorocarbon to the atmosphere 2 When disposing this product Fluorocarbon must be collected in an appropriate manner 3 The kind of Fluorocarbon and the amount used in this product is printed on the name label ZONBI ALT TOM HFC DMEDNTUEJ 1 POVLRHSEALYIKFARPICMMTSCLISRCSNATHEF 2 CONRERERT weit DOL HROOWAGESTT 3 70O ROMBRUMBEIS RRRS RR SIC Ux Fig 1 1 Warning Label on the Front Panel B Warning label for high voltage Fig 1 2 Warning Label for High Voltage HRG010 W HRG015 W 1 3 Hazard Warning Label 1st edition Aug 2006 Rev A May 2007 1 5 HRX OM J049 A Chapter 1 Safety Instructions 1 33 Location of hazard warning label e Recognize where the hazard warning labels are attached The user is not allowed to reposition the labels If the label is replaced due to being peeled off or worn out keep the previous position Sat it up by qualification prestas piping and electrical wor
39. ions B Caster Table 7 2 Caster with Brake Specifications For HRG010 W A HRG015 W A 63mm 59mm single Adjuster height adjustable 0 to 12 5mm range Caster SPCC Materials Wheel Nylon Base with casters SUS304 Allowable load 520kg 130kg per caster 4 pcs B GFCI breaker Table 7 3 GFCI Breaker Specifications For HRG010 W B For HRG015 W B Rated sensed current 30mA Rated interrupting current 40A 60A Para Mo noe 0 04s rated sensed ground fault current ground fault Display type Mechanical button B Communication Table 7 4 RS485 Communication Specifications For HRG010 W C HRG015 W C opec Adhering to EIA specification and RS 485 BCC check function Enabled default Data length 8 bits default Parity check function Disabled default otop bit length 2 bits default Baud rate 9600bps default Communication address 1 station default Delay transmission Omsec default Communication mode Writing and reading enabled default Connector number 37 38 Connector type M4 terminal block HRGO010 W HRG015 W 7 2 Optional Specifications 1st edition Aug 2006 Rev A May 2007 1 3 HRX OM J049 A Chapter 7 Documents 7 3 Outline Dimensions 7 3 1 HRG010 W HRG010 W B HRG010 W C HRG010 W BC HRG015 W HRG015 W B HRG015 W C HRG015 W BC 595 1300 Le 200 Front Right Fig 7 1 Outline Dimensions 7 3 2 HRG010 W A HRG015 W A 595 1300 83 Fig 7 2 O
40. ities and foreign matters and the tank for slime inside Assure a periodic cleaning of the tank B Cleaning of facility water Water quality standards for faciliry water should fall within specifications O Assure a periodic cleaning of faciliry water equipment and a periodic replacement of faciliry water 6 2 35 Biannual inspection B Check for leak from the pump mechanical sealing Remove the panel and check for leak from the pump mechanical sealing When a leak is found it is necessary to replace the mechanical sealing Contact the local distributor or SMC s sales branch O Leak from the mechanical sealing Leakage from the mechanical sealing occurs in structure Although JIS defines leakage for 3cc hr or less reference value 0 3cc hr or more is our leakage standard suggested for the replacement of the mechanical sealing A recommended replacement cycle of the mechanical sealing is 6000 to 8000 hours a year usually 6 2 Inspection and Cleaning HRG010 W HRG015 W 1st edition Aug 2006 6 4 Rev A May 2007 HRX OM J049 A Chapter 6 Unit Maintenance 6 2 4 Check during wintertime B Antifreeze of circulating fluid This unit 1s resistant to freezing of the circulating fluid during wintertime and nighttime Ensure the following measures are taken in advance if potential frost damage may occur in response to changes in the installation and use environments including operating period and weather 1 Leave the power
41. je vado vogesado eunou je paso des ge yid pubis des amp xaabrsur3 De i DIEA MA E as A090 b e djoquos 5 5 i o S AFz 20 181 211 EI T Laid O77 indus peubes uogerado apuray 3 ques E Ci los o HES D A EES ie gd A d su 490 E a E y ne WaS a Aa Dee CECR o zi ag Rev A May 2007 HRG010 W HRG015 W 1st edition Aug 2006 Fig 7 4 Electric Circuit HRGO10 W BC HRGO15 W BC 7 4 Electric Circuit 1 6 HRX OM J049 A Chapter 7 Documents 7 5 Flow Chart m HRG010 W HRG015 W regulating valve High pressure SW Refrigerant dryer Thermal expansion valve Evaporator cooler Capillary tube CRV Capacity control valve zn Z o 2 9 E Auto supply O Circulating fluid OUT Y Me noo BuneJjeBujos Circulating fluid RETUR Tank drain P4 Refrigerant high Over flow pressure gauge 4 Facility water and Circulating fluid flow lt Refrigerant flow L Limnimeter Temperature sensor p2 Circulating fluid pressure gauge LI n ping Dugem Fig 7 5 Flow Chart HRG010 W HRG015 W HRG010 W HRG015 W 7 5 Flow Chart 1st edition Aug 2006 Rev A May 2007 T Chapter 7 Documents HRX OM J049 A HRG010 W HRG015 W Jajem Aloe uonipuoo Bunesado ssaud ybiy 1ueueBujes sseid japo piny BuneImcu duet png Bunemoso jaued EN jang 1938M pini abeyea UO E E SU ynejep uone e su Jey
42. k EE E In nun vta pone wi m A There is risk of the electric shock the bum and the laceration by rotation motor ele 4 Tum off the power supply when the alarm will be panaratad 1 BMA RE ANNE CEE 2 ET TERIEGNMERXRSSOTCHARL 3 AMEN AMARE CE A HATE BE ERRADA DAMA Fluarocarbon Collection and Destruction Law in Japan Seat CEA ZS Lr Ma This product uses Fiuorocarbon HFC as a refrigerant 1 It strict forbidden to emit Fluorocarbon to the atmosphere 2 When disposing Mis product Fluorocarbon must be collected in an manner A 7 3 The kind of Fluorecarbon and re amount weed in this product is printed E COBBCIUDENELT 7078 HC PRONTO high Left KEE gru ASpILEBYS6 rtEiMLSnrtPNT RG TEE CA KEE TEE AA 327002H8n IEEE ERREICER ANCL ET Warning label on the front panel Fig 1 3 Location of Hazard Warning Label 1 4 Model label Check the model no described on the label Fig 1 4 Location of Model Label 1 4 Model label HRG010 W HRG015 W 1st edition Aug 2006 1 6 Rev A May 2007 HRX OM J049 A Chapter 1 Safety Instructions 1 5 Safety Measures 1 5 4 Safety Precautions While this system is protected by various safety measures the following basic safety precautions should be observed to assure further safe operations Read and understand this manual thoroughly before operation of this system Before operating the system during maintenance inform all personnel who are working in the vicinity of t
43. l or pipe connection ports HRG010 W HRG015 W 3 1 Transport 1st edition Aug 2006 Rev A May 2007 3 1 HRX OM J049 A Chapter 3 Transport and Installation 3 1 4 Transporting with forklift and unit lifting Lifting position Min 60 Forklift insertion side Forklift insertion side Fig 3 2 Forklift Insertion Position and Unit Lifting 3 1 Transport HRG010 W HRG015 W 1st edition Aug 2006 3 2 Rev A May 2007 HRX OM J049 A Chapter 3 Transport and Installation 3 1 2 Transporting with caster B HRG010 W A HRG015 W A caster mounted option This unit is heavy which requires assistance for this work Exercise caution and look out for sloped surfaces including ramps Do not grab piping or panel handles when transporting the sytem with the casters Potential damage to piping and panels may occur if disregarded 1 Push the corners of this unit with the adjusters uplifted The unit becomes disengaged so that it can be transported with casters NG Turn 360 Turn 360 Caster w adjuster Uplift the adjuster Fig 3 3 Caster mounted Option HRG010 W HRG015 W 3 1 Transport 1st edition Aug 2006 Rev A May 2007 3 3 HRX OM J049 A Chapter 3 Transport and Installation 3 2 Installation Do not install the unit in a place possibly exposed to flammable gas Ignition may occur if leaked gas is collected around the unit This unit is NOT designed for outside use The unit
44. luid from the tank described in chapter 6 Unit Maintenance The valve needs to be prepared separately HRG010 W HRG015 W 3 2 Installation 1st edition Aug 2006 Rev A May 2007 3 13 HRX OM J049 A Chapter 3 Transport and Installation B Recommended piping installation 3 S 2 2 1 Facility water IN LT Se AE Facility water OUT Ki e 2 Auto supply port X Fluid supply 4 3 TRO ar 4 Circulating fluid OUT Pd Load device i gun EE Circulating fluid RETURN p bd AI Port for overflow 4 Tank drain port pit Fig 3 13 Recommended Piping Installation Table 3 6 Recommended Piping Installation 6 Y shapedstrainer Ron Tips Optional accessories listed below are available for the relieving valves shown in Fig 3 12 Recommended Piping Installation Separate order for optional accessories is to be placed upon designing the piping system if used for piping installation Table 3 7 Allied Products PartNo Name Qty HRG BP010 Bypass relieving valve piping set HRG010 optional accessory HRG BP015 Bypass relieving valve piping set HRG015 optional accessory 3 2 Installation HRG010 W HRG015 W 1st edition Aug 2006 3 14 Rev A May 2007 HRX OM J049 A Chapter 3 Transport and Installation 3 2 7 Supply of circulating fluid 1 Open the supply valve laid with pipes The fluid supply takes place with the use of the ball tap housed in the tank and
45. n charge of starting up and shutting down the unit 4 1 Pre check Check the following items before starting up the unit 4 1 1 Installation condition Make sure the unit is installed horizontally Do not put any heavy object on the unit or apply excess force by piping 4 1 2 Electric wiring Check that the power cable ground and I O signal cables are correctly connected 4 1 3 Facility water piping Check the I O piping of the facility water is installed correctly 4 1 4 Piping for circulating fluid Check the I O piping of the circulating fluid is installed correctly 4 1 5 Supply of circulating fluid Check the fluid level is within the specified range shown on the level indicator HRG010 W HRG015 W 4 1 Pre check 1st edition Aug 2006 Rev A May 2007 4 1 HRX OM J049 A Chapter 4 Startup and Shutdown 4 2 Preparation for startup 4 2 1 Power supply 1 Supply the power The following conditions are observed on the control panel upon power ON O After 4 sec display of the initial screen on the digital displays PV and SV temperature and set temperature of the circulating fluid will be displayed O The POWER lamp comes on in 6 sec GM POWER THERMO COOLER e 5 RUN bed a ALARM el ON OFFO POWER LED paga T Digital display SV set temp Fig 4 1 Power Supply 4 2 2 Setting of circulating fluid temperature 1 Press the UP and DOWN keys to set a desired temperature in the digital di
46. on B HRG010 W A HRG015 W A caster mounted option As to the HRG010 W A or HRG015 W A caster mounted option the adjusters should be lowered to secure the system after installation Caster w adjuster Lower the adjusters to secure the system Fig 3 6 HRG010 W A HRG015 W A Caster mounted Option HRG010 W HRG015 W 3 2 Installation 1st edition Aug 2006 3 8 Rev A May 2007 HRX OM J049 A Chapter 3 Transport and Installation 3 2 5 Electrical wiring e Do not modify the electrical wiring Incorrect wiring can cause an electrical shock and fire Failure to do so will void any warranty e The set value of the safety device must not be changed Changing the set value can cause unit failure and fire e Only qualified personnel are allowed to install wiring O Be sure to disconnect the power for safety Wiring installation with the unit energized is strictly prohibitted o Use the specified cables Properly apply strain relief to prevent an external force from being exerted on the terminals Poor or loose connection can cause electrical shock heat spots or fire e Supply the power to the unit from a reliable power source without surge or sag voltage O Be sure to use a GFCI breaker to prevent an electrical shock and burnt compressor motor The breaker with adequate capacity of current leakage and load should be selected in accordance with 7 1 Standard Specifications O Ensure that the power supply
47. s fully opened If the unit is started up with the valve fully closed circulating fluid supply may reach abnormal high pressure depending on external piping conditions Be sure to keep the bypass valve fully opened for initial startup of the unit installed Adjust the bypass valve to obtain required pressure and flow rate by checking on the external pressure gauge and flow meter that can be prepared by customer or mounted on external piping Bypass valve Right Fig 4 7 Bypass Valve HRG010 W HRG015 W 4 4 Check at startup 1st edition Aug 2006 Rev A May 2007 4 5 HRX OM J049 A Chapter 4 Startup and Shutdown B Bypass relieving valve piping set Tips Bypass relieving valve piping sets listed in table 3 7 Allied Products are of use for the omission of manual bypass valve adjustment Tips Relieving valve The relieving valve automatically opens when the circulating fluid outlet pressure of the thermo cooler surpasses the set value The relieving valve is designed to bypass the circulating fluid that prevents a pressure rise during fluid flow at low rate 4 4 Check at startup HRG010 W HRG015 W 1st edition Aug 2006 4 6 Rev A May 2007 HRX OM J049 A Chapter 5 Error Message and Troubleshooting Chapter 5 Error Message and Troubleshooting 5 1 Error Message This product stops when an error is detected Table 5 1 shows the LED conditions ON OFF and signal output in the event of the error
48. s natural disaster fire earthquake or personal injury With the press of the OFF switch the thermo cooler comes to a stop The power supply however is designed not to stop which enables the motor circuit to remain partially energized Make sure to turn off the main power supply main breaker before proceeding with the next task 1 Press the OFF switch on the control panel to bring the thermo cooler to a stop RUN car RUN LED PUMP LED OFF O OFF LED Fig 1 5 Thermo Cooler OFF 2 Always turn off the main breaker for your power supply equipment Fig 1 6 Main Power Shutdown Breaker OFF HRG010 W HRG015 W 1 6 Emergency Measures 1st edition Aug 2006 Rev A May 2007 1 9 HRX OM J049 A Chapter 1 Safety Instructions 1 7 Disposition of Waste 1 7 4 Recovery of refrigerant and compressor oil The unit belongs to Class 1 in the Fluorocarbon Recovery and Destruction Law and uses freon type refrigerant HFC and compressor oil When these fluids need to be recovered read the instructions below and ensure thorough understanding of them If you have any questions contact the local distributor Only service personnel or qualified personnel are allowed to open the panel of the unit Do not mix the compressor oil with domestic waste for disposition Also incineration is permitted only at an authorized incinerator Comply with municipal ordinances or regulations
49. splay SV GM THERMO COOLER POWER RUN Ka m ALARM ALARM 3 o leo Digital display SV set temp UP E 5 D r NA 3 DOWN key UP key Fig 4 2 Setting of Circulating Fluid Temperature Note Circulating fluid setting temp range is 5 to 35 C 4 2 Preparation for startup HRG010 W HRG015 W 1st edition Aug 2006 4 2 Rev A May 2007 HRX OM J049 A Chapter 4 Startup and Shutdown 4 2 3 Additional water supply B TS switch pump manual operation switch This unit has the TS switch pump manual operation switch to purge air from the circulating fluid circuit at initial startup Remove the front panel and purge air according to the procedures given below TS switch green Fig 4 3 TS switch pump manual operation switch 1 Press the TS switch for several seconds monitoring the fluid level gauge Air is purged from the pipe and the fluid level is lowered O The ALARM1 lamp comes on error The lamp goes out with the press of the RS switch after the circulating fluid reaches the range specified on the level indicator See Chapter 5 Error Message and Troubleshooting for error messages Control panel Reset SW RS yellow button Fig 4 4 Location of Reset Switch Yellow Button 2 Supply the circulating fluid again according to section 3 2 7Supply of circulating fluid If leakage occurs due to faulty piping including an
50. stops automatically Keep the fluid level in the tank between HIGH and LOW If the circulating fluid is out of the range the fluid may overflow Ensure piping is installed to the overflow outlet and drain pit Indicating range Level gauge Fig 3 14 Level Gauge HRG010 W HRG015 W 3 2 Installation 1st edition Aug 2006 Rev A May 2007 3 15 HRX OM J049 A Chapter 3 Transport and Installation 3 2 8 Reinstallation of unit If the unit is relocated only personnel with knowledge of the unit and associated equipment are allowed to perform unit reinstallation Precautions described below must always be followed When the unit is transferred to and reinstalled in a different place after operation at the original place including trial run perform transporting and installation of the unit according to the procedures described below and in Chapter 3 B Disconnection of power supply cable Be sure to cut off the power supply when disconnecting the power supply cable e Only qualified personnel are allowed to install wiring O Be sure to cut off the power supply for safety Wiring with the unit energized is strictly prohibitted 3 2 Installation HRG010 W HRG015 W 1st edition Aug 2006 3 16 Rev A May 2007 HRX OM J049 A Chapter 4 Startup and Shutdown Chapter 4 Startup and Shutdown Personnel with adequate knowledge and experiences of this product and peripheral devices shall be i
51. t Approx 23W Start stop command signa 20 1 0 C only under given load condition WEEN 10 0 11 0 kW 14 5 16 5kW Jvc poU Hz 20 C at outlet 37 49L min of flow 50 60 Hz 20 C at outlet 42 54L min of flow Je 75kW of pump motor output only 37 49L min 42 54L min 50 60Hz 25 25m of the max head 50 60Hz 25 25m of the max head 0 29 0 33MPa of supply pressure E 0 28 0 31MPa of supply pressure 48 60L min 54 65L min 50 60Hz 0 0m of the max head 50 60Hz 0 0m of the max head 0 05 0 09MPa of supply pressure Relay contact AC250V of contact capacity 1A resistance load Contact closes during operation and contact opens during stop and during power off signal Emergency stop Relay contact AC250V of contact capacity 1A resistance load Contact closes while alarm light signal remains OFF and during power off and contact opens while alarm light remains ON Combined use of temperature control through compressor operation ON OFF and capacity control through solenoid valve control ON OFF 7segment digital display capable of display in 0 1 C increments Operation panel PV operating temp ak display in green SV set temp 4 digit display in red Temperature control Refrigerant high pressure cuum du dd suum e E A II Range 0 1 to 3 5 MPa Refrigerant pressure Range 0 to 1 0 MPa Level indicator j SMC 2 10 tube TU1065C transparent HRGO010 W HRG015 W 7 1 Standard Specifications 1st e
52. the level of the hazard Danger Warning and Caution Read the statements carefully and thoroughly understand them before operating this unit DANGER WARNING and CAUTION signs are in order according to severity DANGER gt WARNING gt CAUTION See below for the details A DANGER DANGER denotes that there is an imminent hazard which will cause serious personal injury or death during operation WARNING denotes that there is a hazard which may cause serious personal injury or death during operation CAUTION denotes that there is a hazard which may cause minor personal injury during operation CAUTION without an exclamation symbol denotes that there is a hazard which may cause damage or failure of this unit facility or devices Tips Tips are provided when there is information personnel are required to be aware of for system operation and maintenance If the task carries useful information the relevant tips are given as well 1 2 2 Definitions of Serious injury and Minor injury B Serious injury This term describes injuries such as loss of eyesight wound burns frostbite electric shock fracture and toxication that leaves aftereffects which may require prolonged treatment and hospitalization B Minor injury This term describes injuries that do not require prolonged treatment or hospitalization injuries other than serious injuries described above 1 2 Danger Warning and Caution HRG010 W HR
53. ty standards as shown in the table below Table 6 1 Water quality standards for fresh water tap water Facilit t spec pH 25 C 6 0 to 8 0 Electrical conductivity 25 C us cm 100 to 300 Chloride ion mgCI L 50 and below Sulfuric acid ion mgSO L 50 and below Acid consumption pH4 8 mgCaCO L 50 and below Total hardness mgCaCO L 70 and below Calcium hardness mgCaCO L 50 and below Standard lon silica mgSiO L 30 and below Iron mgFe L 0 3 and below Copper mgCu L 1 0 and below Sulfide ion mgS L Not detected Ammonium ion mgNH L 0 1 and below Residual chlorine mgCl L 0 3 and below Free carbon dioxide mgCO L 4 0 and below Filtering um o and below Refrigeration and Air Conditioning Equipment Water Quality Guideline JRA GL 02 1994 1 Electrical conductivity Min 100 uS cm 72 0 003 to 0 01 if the unit of M Qecm is used If the periodic inspection finds a nonconforming substance in the facility water wash the tank and the cirulating circuit and replace the water in the tank Water will evaporate and impurities will build up Even if no abnormal event occurs it is recommended to replace the water in the tank once every three months Refer to section 6 2 Inspection and Cleaning for the periodic inspection HRG010 W HRG015 W 6 1 Control of Water Quality 1st edition Aug 2006 Rev A May 2007 6 1 HRX OM J049 A Chapter 6 Unit Maintenance 6 2 Inspection and Cleaning
54. utline Dimensions HRG010 W HRG015 W 1st edition Aug 2006 1 4 Rev A May 2007 7 3 Outline Dimensions HRX OM J049 A Chapter 7 Documents Ir cul HRG010 W HRG01 d 7 4 Electric C 7 4 1 Fotoen sa pn op o ud unsaid Vu E URC uogmedogeuuou ye peso aseud assa je wd ansaan ELLOS e paren IC pana uoguzado Eug pasar ro anssaud gaben SAAR NIE era sel acini AS lt A tan WEY gt ES SL SdH FL 8 si A duda jus uasa je usd voged jeuuou ye pasari VOR JURLIFCURAD dung DJS udp z uu emp je ad RT uogevado uuu e pasiri 4 Va Lion JOS ama sadunp cul Ei t AA uonaeyap E uewe m ons gaubewapag Indo pubs deg gus ndyno pubs dep dung uwmesdg ugedo do Pusbauz NEEN os ee mmm ee EN g dus Axuebiau e Oup Wen z dogs Asusbiawa fal Q Aag ucgaun j ee e D rang aur pes uogesado dung mpyaaa pen D sanan M Aen qn AS duwe ANNA LINO LAS ZAJ KA voquiedo dno poor mg 84 WMO AS we An Dal O Addins samog D nag so a Spiny e UA peo ya PINO Kay apo due 43MOd Io 540020 ping E uapa usd TIT dore EAS mopem AG DOEN MAS ES ENT SH MS 440 SdJO pers UU popes Ad EE 58 e num f A B DOGO ILL D MS NO gt pm ex ID on e bz loz ler bal DILO zu En ESSE umm si sz 2 v gt HR n A m 54 Sieg idw Garden tapa opm ak Goen dui sosuas eunjesodwe A O TENT smod 28 MOMO eeneg pes rien cuado au n DEEN J
Download Pdf Manuals
Related Search