Home
LXE VX-7 User's Manual
Contents
1. The mouse pointer may not always be visible Please see Touchscreen and Mouse later in this manual for more details Input Panel Virtual Keyboard The Input Panel may be enabled via the Input Panel icon in the Windows CE NET Control Panel The Input Panel can be displayed as a large or small keyboard Virtual keyboards display the actual character a keypress results in For example pressing the lt Shift gt key on the virtual keyboard toggles the characters displayed on the keys between upper and lower case The lt 123 gt key toggles the keys displayed between alphabetic and numeric characters The lt gt key toggles the keys between standard and international symbols The lt Shift gt and lt gt keys can be used in combination for capitalized international characters Note When the virtual keyboard is displayed the physical keyboard is still active if attached Therefore it is possible to input data from both keyboards Enabling the Input Panel The Input Panel is disabled by default To enable the Input Panel select Start Settings Control Panel Input Panel icon Make sure the Allow applications to change the input panel state checkbox is checked and warmboot the VX7 Power Supply Vehicle power input for the VX7 is 12V to 80V DC and is accepted without the need to perform any manual adjustments within the VX7 See the section titled Installation sub section titled Vehicle 12 80V DC Direct
2. 5 avoid routing the power cable in close proximity to these devices 5 Provide mechanical support for the cable by securing it to the vehicle structure at approximately one foot intervals taking care not to over tighten and pinch conductors or penetrate outer cable jacket 6 Connect the output end of the extension cable to the power connector on the bottom of the VX7 by aligning the water tight connector to the power connector push down on the water tight connector and twist it to fasten securely 7 Turn the VX7 on Power Adapter Cable LXE offers an adapter cable part no 9000A077CBLPWRADPTR to adapt certain VX1 VX2 or VX4 DC power supplies to the VX7 Please read and follow all cautions below to determine if your present power supply can be used with the VX7 Caution This document assumes the VX1 2 4 DC power cable if applicable is already properly connected to your vehicle If this is not the case please refer to the VX1 User s Guide VX2 User s Guide or VX4 User s Guide for direct vehicle connection details Caution For use only with VX1 2 4 DC power cables with yellow colored cable containing 18AWG wires Do not use this cable with VX1 2 4 DC power cables with gray colored cable containing 22AWG wires These power cables must be replaced with a VX5 6 7 power cable Caution When a DC power cable that is eight feet or longer is in a 12V application there may be an excessive voltage drop over t
3. Connection An optional Uninterruptible Power Supply UPS battery pack is available for the vehicle power supply connection If 12V to 80V DC power is not available for example in an office environment an optional external Input Power Supply can be used to convert AC wall power to an appropriate DC level See the section titled Installation sub section titled External Power Supply Power input is fused for protection and the fuse is externally accessible See section titled Installation sub section titled Fuse Replacement for the VX7 Uninterruptible Power Supply Battery Pack An optional Uninterruptible Power Supply UPS battery pack is designed to provide power to the VX7 for short periods of time when vehicle power is unavailable such as when vehicle batteries are swapped Fully charged the UPS battery powers the VX7 for a minimum of 15 minutes at 259 C 779 F ambient temperature The Power Status LED on the VX7 indicates the UPS battery status Green Running on 12V 80V power input Solid Yellow Running on UPS battery battery is not low on power Flashing Yellow Running on UPS battery battery is critically low Backup Battery The internal 190 mAh Lithium backup coin cell battery provides power to maintain date and time when the VX7 is not powered from an external source Caution e Danger of explosion if battery is incorrectly replaced e Replace only with the same type or equivalent type
4. Hotkey If the mobile device uses LXE s Dual AppLock to allow the user to switch between two applications the default Activation key is Ctrl Spc The key sequence switches the focus between one application and another Data entry affects the application running in the foreground only Note that the system administrator may have assigned a different key sequence to use when switching applications Note The hotkey method can still be used if the touchscreen on the VX7 is disabled The Keyboards The following keyboard options are available for the VX7 e LXE 95 key QWERTY keyboard with integrated pointing device a customized rugged keyboard connected to the VX7 via a watertight connector e LXE 60 key QWERTY keyboard a customized rugged keyboard connected to the VX7 via a watertight connector e A standard PS 2 keyboard via an adapter cable attached to the Keyboard MOUSE port on the VX7 The adapter cable also provides a connector for a PS 2 mouse e A USB keyboard via a dongle cable attached to the Ethernet USB connector is available on certain VX7 s Your system administrator can determine if your VX7 supports a USB keyboard e A software keyboard or virtual keyboard can be displayed on the touch screen The virtual keyboard can be used in place of or in addition to a physical keyboard For more details on each keyboard type please refer to the appropriate section later in this chapter The 95 key QWERTY Keyboard
5. Note 1 4 Bolts not included I MPORTANT Mount to the most rigid surface available Step 1b Mount Vehicle RAM Clamp Mount Note If you are using the RAM ball base complete Step 1a and skip Step 1b 1 Determine the position for mounting the RAM clamp mount The clamp mount can be used on a beam such as on a fork lift truck up to 2 5 63 5 mm wide and approximately 2 50 8 mm thick The clamp may be attached to a thicker beam by substituting longer bolts not included Be sure to position the RAM clamp mount to allow access to the switches and ports on the bottom of the VX5 Position the upper clamp piece with ball A on the beam Place the bolts B through the holes in the upper clamp piece Position the lower clamp piece C below the beam Align the bolts with the holes in the lower clamp piece Place the nylon locking nuts D on the bolts and tighten the bolts Step 2 Attach RAM Mount Ball to the VX7 1 Turn the VX7 off before attaching the RAM mount ball 2 Place the VX7 face down on a stable surface 3 Position the RAM ball bracket on the rear of the VX7 aligning the curved edge on the RAM mount bracket with the curved edge on the VX7 Attach with four 1 4 20x5 8 bolts using one flat washer and one locking washer per bolt Place the locking washer on the bolt before the flat washer Caution Failure to use one flat washer and one locking washer per bolt can result in damage to the backplate
6. Speaker Volume Microsoft Windows CE NET provides volume adjustment by clicking the Volume and Sounds icon in the Windows CE NET Control Panel The volume control adjusts the built in speaker s volume Note The F8 and F9 keys on the 60 key LXE keyboard have no function as Windows CE NET controls the sound volume Microsoft Windows CE NET Event Sounds The VX7 includes a customized sound scheme The customized WAV files are preferable to the standard Microsoft Windows CE NET sounds when using the internal speakers Power Management All Power Management is handled through the Microsoft Windows CE NET Control Panel Since the VX7 is externally powered the only power management configuration is for the display and the display backlight Both the display and the display backlight are turned off at the same time The time interval can be configured using Start Settings Control Panel Display Backlight tab When enabled the display and backlight are turned off when the timer expires The timer is reset by the following primary events e Keypress or e Mouse movement or e Touchscreen touch For more information on configuring Microsoft Windows CE NET Power Management please refer to the VX7 Reference Guide Laser Barcode Scanner Warnings e Do not look into the laser s lens e Do not stare directly into the laser beam e Do not remove the laser caution labels from the scanner e Do not connect the laser
7. Underlined letter in a command name on an open Carry out the corresponding command menu ESC Cancel the current task The touchscreen provides equivalent functionality to a mouse e A touch on the touchscreen is equivalent to a left mouse Click e Many items can be moved by the drag and drop method touching the desired item moving the stylus across the screen and releasing the stylus in the desired location e A double stylus tap is equivalent to a double Click e A touch and hold is equivalent to a right mouse Click PS 2 Keyboard Mouse A standard PS 2 keyboard and mouse can be attached to the VX7 using the appropriate dongle cable The dongle cable attaches to the VX7 and provides two PS 2 connectors one labeled Keyboard and one labeled Mouse Please refer to documentation provided with the PS 2 keyboard and mouse for more information on their operation Note The PS 2 keyboard and mouse cannot be hot swapped Power down the VX7 before connecting or disconnecting these PS 2 devices The mouse pointer may not always be visible Please see Touchscreen and Mouse later in this manual for more details USB Keyboard Mouse A standard USB keyboard and or mouse can be attached to the VX7 using the appropriate dongle cable The dongle cable attaches to the VX7 and provides a USB connector Please refer to documentation provided with the USB keyboard and mouse for more information on their operation
8. barcode module to any other device Caution Please read the caution labels Avoid exposure Laser light is emitted from the scanner s aperture Use of controls adjustments or performance of procedures other than those specified herein may result in hazardous radiation exposure The scanner uses laser light The following labels are representations of caution and warning labels placed on laser scanners Do not pour spray or spill any liquid on the scanner The Barcode Scanner contains the circuitry scanning motor and laser Handle with appropriate care Enter Data You can enter data into the VX7 through several different methods e The tethered scanner connected to the COMI serial port provides barcode data entry e The serial ports are used to input output data e The keyboards provide manual entry e The touchscreen also provides manual entry e fa voice application is present the VX7 accepts vocal data Keyboard Entry Refer to Appendix A Key Maps for specific keypresses The keyboard is used to manually input data that is not collected otherwise Almost any function that a full sized computer keyboard can provide is duplicated on the LXE keyboard but it may take a few more keystrokes to accomplish a keyed task Almost every key has two or three different functions The primary alpha or numeric character is printed on the key For example when the 29 key is selected pressing the desired second function key pro
9. keyboard supports all 101 keyboard functions However because the keyboard only has 60 keys all functions are not visible or printed on the keyboard Therefore the VX7 keyboard supports what is called hidden keys keys that are accessible but not visible on the keyboard The hidden keys supported by the VX7 are listed in Appendix A Key Maps Unused Key Functions There are several key functions on the 60 key keyboard that are not used on the VX7 These include e 2nd F3 The Resume Suspend function is not used as the VX7 does not support these power management modes e 2nd F4 and 2nd F5 The Display Brightness functions are not used as the display brightness is adjusted by the buttons on the VX7 control panel e 2nd F6 and 2nd F7 The Contrast functions are not used as the contrast is not adjustable on the TFT display on the VX7 e 2nd F8 and 2nd F9 The Volume control keys are not used as volume is adjusted via the Microsoft Windows CE NET Control Panel e 2nd lt F10 gt Please see Keyboard Backlight later in this section for details on toggling the keyboard backlight NumLock and the VX7 The 60 key keyboard does not have a NumLock indicator or key NumLock can be toggled On or Off using the 2 4 lt SHIFT gt lt F10 gt keypress sequence The default value for NumLock is On The warmboot behavior of NumLock can be configured Please refer to t
10. level surface push the fuse cover in and twist it one quarter turn counterclockwise A flat head screwdriver may be used to twist the fuse cover Remove the fuse Discard the fuse and place a new fuse in the holder Push the fuse in and twist it clockwise one quarter turn Reconnect the power cable to the VX7 au RB w Operation Powering On Off Connect the VX7 to a power source either AC or Vehicle The power on off button is located on the front of the VX7 The switch is sealed by a rubber membrane The Status LED on the LXE VX7 is illuminated when the power is on Green VX7 is operating from vehicle or AC e Solid Yellow VX7 Is operating from the UPS e Flashing Yellow VX7 Is operating from the UPS but UPS battery is critically low Press the power button to start the VX7 You are now ready to use the computer Enter data using the keyboard touchscreen or a Serial Barcode Scanner Note Always turn the computer off prior to connecting or disconnecting any power source The VX7 is designed for an orderly shutdown when using the power button An orderly shutdown first closes any open programs and then shuts down the Windows CE NET operating system DO NOT remove power from the VX7 without shutting down the VX7 The VX7 shutdown may be initiated in any of the following ways s Momentarily pressing and releasing the power button less than 5 seconds performs an orderly shutdown e Pressing and holding the power b
11. mounted on the vehicle Please refer to the Vehicle Remote Mount Antenna Installation Sheet for details Internal Antenna If the internal antenna option is ordered an antenna is mounted on the inside of the user access panel cover The internal antenna assembly has two antenna cables Attach the antenna cables to the radio card When this process is complete reattach the access cover screws using a torque wrench capable of measuring to 9 1 inch pounds force 1 016 11 N m The screws must be fastened to 9 inch pounds each The screws require a Phillips size 1 driver head Connect Serial Barcode Scanner Refer to the documentation received with the barcode scanner for complete instructions Read all warnings and caution labels Before using the scanner read section titled Operation sub section titled Laser Barcode Scanner Warnings Pin 9 of COMI is configured to provide 5V To change Pin 9 of the port please refer to Chapter 4 System Configuration in the VX7 Reference Guide The scanner cable is attached to the connector labeled COM1 SCANNER The scanner receives power from the VX7 The cable requires a nine pin D shell female connector for the VX7 Note Use of a shielded cable is required to maintain FCC and CISPR22 emissions compliance 1 Power off the VX7 before connecting the scanner cable to the VX7 2 Seatthe connector firmly over the pins and turn the thumbscrews in a clockwise direct
12. of the VX7 computer Step 3 Assemble Optional Keyboard Brackets 1 If using the optional integrated keyboard mount attach the keyboard mounting bracket to the RAM mounting bracket with three 1 4 20x5 8 bolts using one flat washer and one locking washer per bolt Place the locking washer on the bolt before the flat washer If using the optional integrated keyboard mount attach the keyboard to keyboard mounting plate using the appropriate screws e For the 95 key keyboard use four 8 32x5 8 screws e For the 60 key keyboard use four 10 32x5 8 screws Note Excess keyboard cable length can be looped around the hooks on the bottom of the keyboard mounting plate Step 4 Attach VX7 and Bracket Assembly to RAM Mount 1 If the optional integrated keyboard bracket is not used slip the RAM arm over the ball on the vehicle RAM ball bracket Insert the ball of the RAM mount bracket into the RAM arm Adjust the VX7 to the desired position and tighten the knob on the RAM arm using the supplied RAM wrench If using the optional integrated keyboard bracket there are two arms included Slip the larger RAM arm over the ball on the vehicle RAM mount bracket Insert the ball of the RAM mount bracket into the RAM arm Adjust the VX7 to the desired position and tighten the knob on the RAM arm using the supplied RAM wrench Slip the smaller arm over the RAM ball on the keyboard mounting bracket Insert the RAM ball on the keyboard mounting
13. protective film so that one of the edges of the film can be slid between the touchscreen and display housing when the protective film is re centered on the touchscreen Repeat for the other three edges ensuring the protective film is centered over the touchscreen when finished How to Remove Touchscreen Protective Film To remove the protective film slide the protective film in one direction until the edge clears Lift up on the edge of the film so it does not slide between the touchscreen and display housing when slid back Repeat until all edges are free and remove the protective film Remote LXE Keyboard Bracket Assembly Equipment Needed Phillips screwdriver torque wrench 1 Place the keyboard face down on a flat stable surface 2 Position the bracket on the keyboard base aligning the four screw holes in the keyboard with the four mounting holes in the bracket flanges When positioned correctly the bracket should overlap at the top of the keyboard 3 Attach the keyboard to the bracket with four screws included Tighten to 9 1 in Ib 1 02 N m 4 Attach the keyboard bracket assembly to the vehicle s mounting surface using four 1 4 bolts lock washers and flat washers or equivalent Note Bolts washers and wrench needed when attaching the bracket to the vehicle are not supplied by LXE I MPORTANT Mount to the most rigid surface available Remote Keyboard Mounting Dimensions The overall space required for the key
14. the plug is firmly seated in the audio jack 2 Replace the plug when the speaker or headset is removed from the audio jack 3 Use a strain relief clamp to secure the cable Connect Power Cable and Optional UPS Battery Pack 1 Turn the VX7 off before attaching the power plug 2 Connect the power cable to vehicle power See the following section titled Vehicle 12 80VDC Direct Connection or to an AC adapter See the following section titled External Power Supply 3 Several possibilities are available for routing the vehicle power to the VX7 See the following section titled Vehicle 12 80VDC Direct Connection for details 4 All plugs and receptacles are keyed and care must be used when connecting the cables Tighten the nut of the plugs clockwise until tight Secure the cable with the strain relief cable clamps 5 Turn the VX7 on External Power Supply Optional The LXE approved AC Power Adapter is only intended for use in a 252C 772F maximum ambient temperature environment In North America this unit is intended for use with a UL Listed ITE power supply with output rated 12 80 VDC minimum 75W Outside North America this unit is intended for use with an IEC certified I TE power supply with output rated 12 80 VDC minimum 75W The external power supply may be connected to either a 120V 60Hz supply or outside North America to a 230V 50Hz supply using the appropriate detachable cordset In a
15. with Pointing Device Designed for ease of use with the Windows CE NET operating system the 95 key keyboard with pointing device connects via a cable to the keyboard port on the VX7 Additional Windows keys the Windows logo key and the Application key and an integrated pointing device are provided for use with Windows CE NET operating system Note The 2 key function is available on the 60 key keyboard only Key Maps The 95 key keyboard supports all 104 keyboard functions 101 keyboard standard plus Windows keys and includes an integrated pointing device and left and right mouse buttons However because the keyboard only has 95 keys all functions are not visible or printed on the keyboard Therefore the VX7 keyboard supports what is called hidden keys keys that are accessible but not visible on the keyboard The hidden keys supported by the VX7 are listed in Appendix A Key Maps NumLock and the VX7 For the 95 key keyboard the NumLock key and the numeric keys are backlit green when NumLock is off When NumLock is on the backlight for the NumLock key and the numeric keys are amber The default value for NumLock is On The warmboot behavior of NumLock can be configured Please refer to the VX7 Reference Guide for more information CapsLock and the VX7 For the 95 key keyboard the CapsLock key is backlit green when CapsLock is off When CapsLock is on the backlight for the CapsLock key is amber The defaul
16. writing from LXE Inc Copyright 2006 by LXE Inc An EMS Technologies Company 125 Technology Parkway Norcross GA 30092 U S A 770 447 4224 Trademarks LXE and Spire are registered trademarks of LXE Inc RFTerm is a registered trademark of EMS Technologies Norcross GA Microsoft Windows and the Windows logo are registered trademarks of Microsoft Corporation in the United States and or other countries ava and Java based trademarks and logos are trademarks or registered trademarks of Sun Microsystems Inc in the U S or other countries and are used under license Intel and Intel XScale are trademarks or registered trademarks of Intel Corporation or its subsidiaries in the United States and other countries RAM and RAM Mount are both trademarks of National Products Inc 1205 S Orr Street Seattle WA 98108 The Cisco Square Bridge logo is a trademark of Cisco Systems Inc Aironet Cisco and Cisco Systems are registered trademarks of Cisco Systems Inc and or its affiliates in the United States and certain other countries Summit Data Communications Inc Summit Data Communications the Summit logo and The Pinnacle of Performance are trademarks of Summit Data Communications Inc All rights reserved Symbol the Symbol logo and Spectrum24 are registered trademarks of Symbol Technologies Inc All other brand or product names are trademarks or registered trademarks of their respective companies or organizations When
17. Lo p Te Enter T P Enie Enter numeric x Eler CapsLock Toggle x J T T E Back Space j j p fins Tab j LL Tab BackTab Px Tab Ctri Break x x T JF Pause iX x E Up Arrow Pp Arrow Down Arrow l j Down Arrow Right Arrow l LL Right Arrow Left Arrow j j Lee ft Arrow Insert IX ns BS Delete numeric x jJ DEE Home IX l Lee ft Arrow End xl Right Arrow Page Up Px Tp Arrow Page Down Px Down Arrow Right Shift Cas ae j ee o Right Alt iX x T EB Right Ctrl xw x ER ScrollLock x x F4 Press lt Ctrl gt then lt 2 9 gt then lt F2 gt to produce Ctrl Break Press These Keys and Then gn Press this key To get this key lt laloloalula o zizlolalol lol lol gt lz xl gt Inl lt lnlo N LL F1 Lo fP CapsLock Ctrl Px tx j T F110 Alt Shift L dq x j TR as ae r 5 i F j fFe icem OOo o Too So S To fFe ES F1 EE LLLI P F1 NumLock F10 F11 F12 ojal of of of c x lt E clol of w e a gt Z x d Ni lt mi o Press this key OlZ gt 2 2 per ISINI ev foo al oler Joo o lt eve lt r 19 o o LL A A A A A A Press These Keys and Then 24 T shnit Ctrl T Alt CapsLock Shift Ctrl Alt X To get this key 1 numeric 2 numeric 3 numeric 4 numeric 5 numer
18. PSACUS R Power Supply External AC No Power Cord VX5 VX6 VX7 9000A318PSACWW R UPS Battery and Cables Battery UPS Lead Acid VX5 VX6 VX7 9000A378UPSBATTPACK R Cable UPS Battery Remote Mount Extender 6 Ft 9000A074CBLUPSEXTNDR Antenna and Antenna Mount Kits Replacement antenna 2 4GHz 153180 0001 Remote Mount Antenna Assembly Kit 8 Ft Cable Remote Mount Antenna Assembly Kit 6 Ft Cable 9000A279ANTREMOTE8 9000A279ANTREMOTE8 R 9000A278ANTREMOTE6 R Right Angle Remote Mount Antenna Assembly Kit 6 Ft Cable 9000A280ANTREMOTE6RT Right Angle Remote Mount Antenna Assembly Kit 15 Ft Cable 9000A281ANTREMOT15RT Miscellaneous Stylus with Tethers and Sleeves 5 Pack 9000A510STYLUS Protective Film 12 in Display 10 Pack VX5 VX7 9000A511PROTFILM12l N Voice Recognition Accessories Headset coiled adapter cable with quick disconnect connector to a 2 5 mm audio jack A headset see below is required 9000A076CBLHEADSET1 Headset Single Band HX1A501SI NGHEADSET Headset Dual Band HX1A502DUALHEADSET Headset Behind the Ear Dual Ear HX1A503BTHHEADSET Foam Replacement Block Headset HX1A504HSBLOCKFOAM Yoke Replacement for Dual Band Headset HX1A505DUALYOKE Yoke Replacement for Single Band Headset HX1A506SI NGLEYOKE Replacement Microphone Foam Wind Screen 10 pack HX1A508WINDSREEN10 Replacement Microphone Foam Wind Sc
19. VX7 User s Guide Declarations of Conformity for the Wireless Transceivers and VX7 equipment all graphics and informational tables are in the full version of the VX7 User s Guide on the LXE Manuals CD and on the LXE ServicePass Website This user guide is designed for delivery on a LXE mobile device screen The reader is strongly encouraged to read Appendix B Regulatory Notices and Safety Information Important safety cautions warnings and regulatory information is contained in Appendix B in the full version of the VX7 User Guide LXE Copyright 2006 by LXE Inc All Rights Reserved E EB VX7UG E LANGUAGE ENGLISH Notices LXE Inc reserves the right to make improvements or changes in the products described in this manual at any time without notice While reasonable efforts have been made in the preparation of this document to assure its accuracy LXE assumes no liability resulting from any errors or omissions in this document or from the use of the information contained herein Further LXE Incorporated reserves the right to revise this publication and to make changes to it from time to time without any obligation to notify any person or organization of such revision or changes Copyright Notice This manual is copyrighted All rights are reserved This document may not in whole or in part be copied photocopied reproduced translated or reduced to any electronic medium or machine readable form without prior consent in
20. ard Backlight sesimin nnana a a N aAa eaer 13 POINUIMNG he eT 14 ThedU key OWERTY KeybOalgu y t Saath A nae os detente vitto ee debeo niae a qala 14 IBM 3270 Keypad 0 eU 14 BM 5250 KeypadiOVenlay carte asstearciasteceseaswsnaeee cated a alata dente lemtad cusa daaa 14 Key Maps ERES 14 Unused Key Uem 14 Nunmbock atid the VAT T 15 Keyboard Backlight cR 15 Keyboard n EET 15 CAPS aE 15 Secondary REV Se E RTT 16 Control KEYS wise M 16 General Windows CE NET Keyboard ShOFPECUES wcictuissianectdnenaiuandunarndandeaniaedindnenadhemeneentautaaadianenedniooredancedes 17 PS 2 Keyboard MOUSE u usu ida best apeuM eaaa aa acta Peli radia Meewbd cet haac iacu ners RARUS aux 17 USR Kyb I T 18 put Panel Viral KeyDbSEtl y y L uu aA A E based AA ENA 18 Enabling the luiet d T 19 POWer SUPPI oian a E E E A 19 Uninterruptible Power Supply Battery Pack T 19 Backup Battery M E 20 neo T 20 Manuals Ang ACCES SONE Scaieni a a a E AAE a ANa AA Aa 20 Manuals TTT 20 Pee IULII TUTTI 21 dicla e rr eeee ere ere inusuaus kanaan asiaa anaana anara araia kariaia aaaea anai 24 bistallMoufilngiBEdERBEo taona a aa a usos 24 RAM Mount SVSEBITI T 25 COMPONENTS rritu iasadan a aaa a a EAA EE AAS 25 Torque Measurements TT 26 ucc 26 Step IL Mount Vehicle RAM Mount Bracke cocto n era Eee Feet rro ripe di Eee Eheu periere god qaqa 26 Step Ib Mount Vehicle RAM Clamp MOUNE sirisser eter trea reb
21. at are very close together Note Do not position the scanner exactly perpendicular to the barcode being scanned In this position light can bounce back into the scanner s exit window and possibly prevent a successful decode Successful Scan When the scan is successful the scanner s good scan indicator illuminates the scan on indicator is off and the currently running application may produce a distinctive audible tone Unsuccessful Scan When the scan is unsuccessful the scan on indicator remains illuminated and the currently running application may produce distinctive audible tones Check the following e s the scanner programmed for the barcode being read e Check the barcode for marks or physical damage e g ripped label missing section etc e Try scanning test symbols of the same code type at different distances and angles Appendix A Key Maps 95 key Keypad with Pointing Device The key map table that follows lists the commands used for the VX7 Note that since the VX7 uses a Microsoft Windows CE NET operating system no DOS Terminal Emulation keypress sequences are provided Key Map 101 Key Equivalencies There are ten hidden keys on the 95 key keyboard Each of these hidden keys is accessed by pressing the lt Fn gt key plus another key To get this key Press These Keys and Then Insert Fn 0 on the number pad Home Fn 7 on the number pad Page Up Fn 9 on the number pad Delete Fn on the number pad End F
22. boards are e LXE 95 key keyboard 5 75 146 05mm x 13 40 340 40mm e LXE 60 key keyboard 4 40 111 50mm x 11 90 302 00mm UPS Battery Pack Remote Mount The optional UPS battery pack must be mounted remotely when using the RAM mount system or a U bracket designed for a previous model LXE computer The remote mount can also be used with the VX7 U bracket assembly if it is not convenient to mount the UPS battery pack to the U bracket A six foot extension cable is available to connect the UPS battery pack to the VX7 1 Position the UPS battery pack to allow cables to reach the vehicle battery and the VX7 2 Attach the UPS battery pack to the vehicle mounting surface using two 1 4 bolts lock washers and flat washers or equivalent fasteners Note 1 4 Bolts and washers not included I MPORTANT Mount to the most rigid surface available Connect Keyboard LXE Keyboard The VX7 has an external 9 pin connector for the keyboard All LXE keyboards are connected in a similar fashion The keyboard is attached to the connector labeled KEYBOARD The keyboard receives power from the VX7 1 Turn the VX7 off before attaching the keyboard cable Insert the keyboard cable into the VX7 keyboard connector Once the pins are firmly seated tighten turning clockwise the thumbscrews Secure the cable with a strain relief cable clamp Turn the VX7 on O 0 N PS 2 Keyboard and Mouse By using the optional dongle cable a s
23. duces the 2 character i e lt 2 gt F1 toggles the CAPS Lock function The specific lt 2 d gt character is printed above the corresponding key Please refer to Appendix A Key Maps for instruction on the specific keypresses to access all PC compatible keyboard functions Touchscreen Entry Note This section is directed to the VX7 user The assumption is that the unit has been configured and the touch panel calibrated by the System Administrator prior to releasing the VX7 for use Note Always use the point of the stylus for tapping or making strokes on the display Never use an actual pen pencil or sharp object to write on the touch screen The touchscreen input performs the same function as the mouse that is used to point to and Click elements on a desk top computer The stylus is used in the same manner as a mouse single tap or double tap to select menu options drag the stylus across text to select hold the stylus down to activate slider bars etcetera Holding the stylus down for second performs the right mouse click function When using a stylus hold the stylus as if it were a pen or pencil Touch an element on the screen with the tip of the stylus then remove the stylus from the screen The touch screen responds to an actuation force touch of up to 4 oz of pressure The touch screen can be used in conjunction with the keyboard and an input output device connected to one of the VX7 s serial ports e Touch the
24. e 8ft 8510A326SCNRFZYDA9F 8510A326SCNRFZYDA9F R Scanner LS3408 Extended Range D9 Interface Cable 8ft 8520A326SCNRERDA9F 8520A326SCNRERDAQF R Installation Install Mounting Brackets Caution This device is intended to transmit RF energy For protection against RF exposure to humans and in accordance with FCC rules and Industry Canada rules this transmitter should be installed such that a minimum separation distance of at least 20 cm 7 8 in is maintained between the antenna and the general population This device is not to be co located with other transmitters Equipment Needed Phillips No 1 screwdriver and a Torque wrench capable of measuring to 50 inch pounds 5 64 56 N m Note Torquing tool is not supplied by LXE Bolts washers and wrench needed when attaching the bottom mounting bracket to the vehicle are not supplied by LXE Several types of mounting systems are provided for the VX7 RAM mount system e Available RAM ball base or RAM clamp mount e Optional integrated keyboard bracket U Bracket system e Optional integrated keyboard mounting bracket e Provision for integrated UPS battery mount e Available without U Bracket for vehicles previously equipped with an LXE vehicle mounted computer Remote mount for keyboard Remote mount for UPS battery pack Before installation begins verify you have the applicable vehicle mounting bracket assembly components necessary for your mount type as
25. e from Label TTT 56 SUCCESS SCAN asin u u u ITI LLL ILIUM 57 Drisuccessfill SCOTI 1 uuu aus aasanasqhaahusquawayasuwwasa assahuntanamaqhisaqha aytaqphasqamaqaqsa aqpissaqiatasqussawalaqawaspisutuqabasa 57 Appendix A Key Maps UI IL aua kann uaa et ssssasakusuwuwanuwawasukasawawakawayawahassuquyawskanssayasshana 58 95 kBy Keypad With Pointing DBVICB u wie roter m r t ee me Fou p anid idee ane t qia 58 Key Map 101 Key EQuivalencles sssini sioni veins vonne wade ex ek CEPR Hi eb xe Re HO HEEL USO E RRR X ERE VERBA R TREE R ODE e np cas 58 GOR Standard Keypad D Key Map 101 Key SiO 2 eT Safety Statements The VX7 Vehicle Mount Computer Introduction The VX7 Vehicle Mount Computer VMC is a rugged vehicle mounted Microsoft Windows CE NET equipped computer The VX7 is capable of wireless data communications from a fork lift truck or any properly configured vehicle The unit uses a 2 4 GHz radio for wireless data communications The VX7 is a tablet style computer and features a SVGA color TFT display The touch screen display supports graphic features and Microsoft Windows CE NET icons that the Windows CE NET operating system supports An illuminated keyboard is available to facilitate use in dimly lit areas The VX7 provides the power and functionality of a desktop computer in a vehicle mounted unit with a wide range of options e 400MHz Intel PXA255 CPU e 64 or 128MB of DRAM e Wireless LAN radios with interna
26. el with a scratch resistant finish that can detect touches by a stylus and translate them into computer commands In effect it simulates a computer mouse Only Delrin or plastic styluses should be used Note Always use the point of the stylus for tapping or making strokes on the display Never use an actual pen pencil or sharp object to write on the touch screen An extra or replacement stylus may be ordered from LXE See the Accessories section for the stylus part number Adjusting Screen Display Some VX7 s provide the option to adjust the screen resolution Please refer to the VX7 Reference Guide for more details The color TFT display is an active source of light The VX7 display brightness can be adjusted via the brightness control keys located on the VX7 control panel Pressing the brightness up button increases the display brightness incrementally until maximum brightness is achieved Likewise pressing the brightness down button decreases the display brightness until minimum brightness is achieved Because there are 64 incremental levels of brightness intensity a single press of either brightness adjustment button may not be noticeable The up or down button can be pressed and held to accelerate brightness adjustment Note The 2 functions F4 F5 F6 and F7 keys on the 60 key LXE keyboard have no function on the VX7 There are no provisions for adjusting the contrast of the display The display remai
27. enna is mounted on the inside of the Access Panel Cover Note COM is configured with Pin 9 5V COMS is labeled COM2 3 and is configured with Pin 9 RI Please see the VX7 Reference Guide for details The Full Screen Display The VX7 Display is a TFT color unit capable of supporting SVGA graphics modes The resolution is 800 x 600 pixels VX7 Control Panel The VX7 control panel contains the status LED power button and display brightness adjustment buttons Please refer to the Operation section later in this manual for details on the VX7 Control Panel Microsoft Windows CE NET Control Panel The Microsoft Windows CE NET Control Panel provides standard Windows CE NET options for configuring the VX7 such as e Sound volume e Display configuration Please consult your System Administrator or refer to commercially available Microsoft Windows CE NET user guides or the on line Help application for these standard Windows CE NET configuration options PCMCIA ATA and SD Slots The VX7 has two PCMCIA slots These slots are intended for use with Type or II cards such as LXE s 2 4GHz radios These slots are hot swappable per PCMCIA specifications The Compact Flash CF slot contains the Compact Flash ATA hard drive This drive contains the Operating System and the Documents and Settings The VX7 does not operate without this card installed The CF card is not hot swappable One Secure Digital SD slot is provided fo
28. f torquing to 50 inch pounds 5 64 56 N m Torque all screws and bolts according to the following table For these screws and bolts Torque to 8 0 5 in Ib 0 9 05 N m 16 041 in Ib 1 84 11 N m 50 0 5 in Ib 5 64 56 N m 6 screws 8 screws 1 4 bolts Procedure Step 1 Mount Bottom Mounting Bracket To Vehicle l 2 Position the bracket to allow access to the switches and ports on the bottom of the VX7 Attach the bottom mounting bracket to the vehicle mounting surface using a minimum of four 1 4 bolts or equivalent fasteners Note 1 4 Bolts and washers not included It is recommended to use lock washers and flat washers on the fasteners IMPORTANT Mount to the most rigid surface available After the bottom bracket has been attached to a rigid surface you are ready to assemble the VX7 bracket configuration Step 2 Attach Rear Bracket VX7 1 2 B Turn the VX7 off before attaching the rear bracket Place the VX7 face down on a stable surface Align the rear bracket with the holes on the back of the VX7 Attach with four 1 4 20x5 8 bolts using one flat washer and one locking washer per bolt Place the locking washer on the bolt before the flat washer Step 3 Attach VX7 Assembly To Bottom Mounting Bracket 1 Place lock washer first then flat washer on 1 4 20x5 8 bolt Next insert mounting bolts through the curved apertures in the bottom mounting bracket and into the screw holes on the side
29. g portions to learn about the VX7 and then referring to it when you need more information about a particular subject This guide takes you through installation and operation of the LXE VX7 In general the sequence of events is 1 Install Vehicle Mounting Bracket on vehicle and secure VX7 in Mounting Bracket Assembly see Installation later in this manual 2 Connect power cable to the VX7 The power cable can also be connected to a UPS battery pack which is then connected to the VX7 3 Connect accessories to VXT e g scanner antenna etc 4 Secure all cables to the VX7 with the Strain Relief Cable Clamps 5 Turn the VX7 on 6 When instructed calibrate the touchscreen 7 The screen may appear white while applications and drivers are loading When complete set Date and Time see the VX7 Reference Guide 8 Configure radio see the VX7 Reference Guide 9 Warmboot to ensure all registry settings are saved Device is ready for use The VX7 and its keyboard should be mounted in an area in the vehicle where it e Does not obstruct the vehicle driver s vision or safe vehicle operation e Can be easily accessed by anyone seated in the driver s seat If your VX7 has AppLock installed please contact your system administrator for setup and processing information AppLock is configured by an administrator to limit general users to only certain programs Note When the internal antenna option is ordered the internal ant
30. he VX7 Reference Guide for more information Keyboard Backlight The LXE keyboard keys are backlit with LEDs The backlight is manually controlled using the lt 2 gt lt CTRL gt F10 keypress sequence Keyboard LEDs The VX7 keyboard has two 2 LED indicators CAPS LED This LED indicates the state of the keyboard CapsLock mode If CapsLock is enabled this LED is illuminated green When CapsLock is off the LED is dark Press 2 then F1 to toggle CapsLock On and Off The default value of CapsLock is Off For information on configuring the behavior of CapsLock after a reboot please refer to the VX7 Reference Guide Secondary Keys LED The keyboard is equipped with several secondary keys These keys are identified by the superscripted text found on the keyboard keys The secondary keys are accessible by using two 2 keystrokes the 29 key followed by the superscripted key Once the lt 2 gt state is enabled by pressing the lt 2 gt key the Secondary Mode LED is illuminated and the 2 state is enabled until another key is pressed The lt 2 4 gt key is toggled on with a lt 2 9 gt keypress and then immediately off with another lt 2 4 gt keypress For example Press 2 and F1 to turn CapsLock on and off Press 2 and 1 to initiate the PgUp command Press lt 2 gt and lt Q gt to type the key Press lt 2 gt and lt BkSp gt to enter the Insert Ins m
31. he longer cable If this occurs a new power cable is required Caution Do not use this adapter with AC power supplies originally designed for the 1380 1390 VX1 VX2 or VX4 These power supplies do not have sufficient power for the VX7 Note For more information on the 12 80V DC direct UPS battery pack and extension cable connections please refer to the appropriate section earlier in this manual How To Connect Power Adapter Cable 1 The VX7 must be turned off and the power cable must be UNPLUGGED from the VX7 2 Attach the smaller end of the Power Adapter Cable to the VX1 2 4 power cable by aligning the water tight connector pins to the power cable connector Push down on the water tight connector and twist it to fasten securely 3 Connect the larger end of the Power Cable directly to the computer or to a UPS battery pack as desired Please refer to the appropriate section earlier in this manual for UPS battery pack connection details Fuse Replacement for the VX7 The VX7 uses a 100V 10A time delay slow blow high current interrupting rating fuse that is externally accessible and user replaceable Should it need replacement replace with same size rating and type of fuse Littlefuse 0234010 or Optifuse MSC 10A 5x20mm 1 Turn the VX7 off and disconnect the power cable from the VX7 Caution Fuse has voltage on it even when power is off Always disconnect input power before changing fuse 2 While holding the VX7 over a
32. he next cross After all locations have been touched either press lt Enter gt or click the Calibration button Touchscreen Protective Film LXE offers a replaceable touchscreen protective film to protect the touchscreen when the VX7 is used in an abrasive environment Installation and removal instructions can be found earlier in this guide Touchscreen and Mouse Please refer to the VX7 Reference Guide for information on identifying your VX7 Platform 1 VX7 s Because the touchscreen also functions as a mouse the pointer for on the 95 key keyboard a USB mouse or a PS 2 mouse may not always be visible on the screen The mouse pointer reappears when the 95 key keyboard pointer or external mouse is moved or clicked Please see USB Mouse earlier in this manual for more details e When a USB mouse is first attached to the VX7 the mouse pointer may not be visible However moving or clicking the mouse causes the pointer to appear e When the USB mouse is unplugged the pointer may remain visible until the touchscreen is tapped f the touchscreen is used for input the mouse pointer may disappear However moving or clicking the mouse or pointing device on the 95 key keyboard causes the pointer to reappear Platform 2 VX7 s The mouse pointer is not visible unless a mouse P S2 or USB mouse or 95 key keyboard with pointing device is attached If a mouse of any kind is attached the mouse pointer is displayed on screen Adjust
33. iat a quqamustyqa a qata phala 35 PS 2 Keyboard arid H eE 36 Connect trig 36 External Antbelilig samaistaa seatatkenttdtaba diesen aaa batis cetuandtas idt da atat cuta batalla bati TUN Tae 36 Remote Vehicle Mount Anterna uuu petat E nr preste ensue iub osa be Vnd eaaa RR IDE EE 36 liti Ee STU e ceo ee cd teet tutt tetsu at pent etae eren nerd dinde seeks te wea euh dota Se 37 Connect Serial Barcode Scanner u uyu uu a 27529 UE 2994 29922279 KS C 44T see Ne DE EDI ERO PRA E AE Dub COD PORK EA9924 37 Connect Serial S Tat eT o a PC TTT 38 Ethemetdnd USB POS arinina a aai aeaa A 39 USB MOUSG iicet o aeaa a a iae quqa aaa eget aeai aa 39 Connect External HeadSet T 40 Connect Power Cable and Optional UPS Battery Pack i2 LLL aa asaassaaqaqasqa aqua kawanqa 40 External Power Supply Optonalls scs sc 2tucossascasienasadcambiaciacdneceseeas sous h Disusui ssa kapas Eaa aa 41 Vehicle 12 80VDC Power CoOnm 0ection u uu unai reste dasanganceaasie a aaa aa n aiaa 42 POWER Adapter Cable EE 46 Fuse Replacement for the 6 u uuu aaah nanai XX RR RR ER D HN TR a ER SRR EXER VER VER PARRA MER Ro EUR ITO 47 Ore ATION TEE DEDI DLL DDLLLDILLLOLLLLLLLLDL LLL OLILLDDEDLOL LLL LOL 48 e Zae OM OTT P 48 Keyboard BackllgliE TTT 49 95 Key Keyboard misran noia uto ae Paibas ate cune npud ibi bin edutadbarcusa cci te RI Gt RP aa aq ua au d 49 O0 Key Key Oe ea eed verd tier ever dores me bot eviter ient etur s ese bona rr te
34. ic 6 numeric 7 numeric 8 numeric a uluo r 34 x lx zolalole ol 25 5 2 x NW Press this key To get this key Press These Keys and Then 24 T shnit Ctrl T Alt CapsLock Shift Ctrl Alt CapsLock 5 ele Se u ele ei 2 z S o loo 8 ur ec o o X 2 g N O SN c Oo pe 9 9 T Ol L Oo 2 9 we LI TES l l sl ENR JHE Ss 5329 9 z9 SEE E GI E lt EIS EISI ESI ole aE is Sle 3 8 5 amp 21 4 3 210 a S 5 a EIEIO lol Cc OIF S c a ol o 3 o a _ S l l S r o oo O v 4 A I l il I a peepee J U de Ale o J A Important This symbol is placed on the product to remind users to dispose of Waste Electrical and Electronic Equipment WEEE appropriately per Directive 2002 96 EC In most areas this product can be recycled reclaimed and re used when properly discarded Do not discard labeled units with trash For information about G EE proper disposal contact LXE through your local sales representative or visit www lxe com Safety Statements RF Safety Notice Caution This device is intended to transmit RF energy For protection against RF exposure to humans and in accordance with FCC rules and Industry Canada rules this transmitter should be installed such that a minimum separation distance of at least 20 cm 7 8 in is maintained between the antenna and the general population This device is
35. ical polarity is required for safe and proper installation Connecting the cable to the VX7 with the polarity reversed will cause the VX7 s fuse to be blown See the following figure titled Vehicle Connection Wiring Color Codes for additional wire color coding specifics How To Connect Vehicle 12 80VDC Connection 1 The VX7 must be turned off and the power cable must be UNPLUGGED from the VX7 2 While observing the fuse requirements specified above connect the power cable as close as possible to the actual battery terminals of the vehicle When available always connect to unswitched terminals in vehicle fuse panel after providing proper fusing ATTENTI ON For uninterrupted power electrical supply connections should not be made at any point after the ignition switch of the vehicle Route the power cable the shortest way possible The cable is rated for a maximum temperature of 105 C 221 F When routing this cable it should be protected from physical damage and from surfaces that might exceed this temperature Do not expose the cable to chemicals or oil that may cause the wiring insulation to deteriorate Note f the vehicle is equipped with a panel containing Silicon Controller Rectifiers SCR 5 avoid routing the power cable in close proximity to these devices Always route the cable so that it does not interfere with safe operation and maintenance of the vehicle Use proper electrical and mechanical fastening means for term
36. inating the cable Properly sized crimp type electrical terminals are an accepted method of termination Please select electrical connectors sized for use with 18AWG 1mm conductors Wiring color codes for LXE supplied DC input power cabling Vehicle Supply Wire Color 12 80VDC DC White Return DC Black Vehicle Chassis GND Green Vehicle Connection Wiring Color Codes Provide mechanical support for the cable by securing it to the vehicle structure at approximately one foot intervals taking care not to over tighten and pinch conductors or penetrate outer cable jacket Refer to the following sections to complete the power connection to the VX7 How To Connect VX7 without a UPS Battery Pack 1 Connect the power cable to the vehicle s electrical system as described in Connect Vehicle 12 80VDC Connection 2 Connect the power cable to the VX7 by aligning the water tight connector pins to the power connector on the bottom of the VX7 push down on the water tight connector and twist it to fasten securely 3 Turn the VX7 on How To Connect VX7 to a Integrated Mount UPS Battery Pack 1 Connect the power cable to the vehicle s electrical system as described in Connect Vehicle 12 80VDC Connection 2 Connect the power cable to the UPS battery pack by aligning the water tight connector pins to the input connector labeled From Vehicle push down on the water tight connector and twist it to fasten securely 3 Co
37. ion Do not overtighten 3 Use a strain relief clamp to secure the cable Press the power button to power up the VX7 When you have finished using the scanner remove it from the VX7 and store the scanner in a closed container or bag Refer to the documentation received with the barcode scanner for complete instructions Connect Serial Printer or PC Refer to the documentation received with the printer or PC for complete instructions Pin 9 of COM3 labeled COM2 3 is configured to provide RI To change Pin 9 the port please refer to Chapter 4 System Configuration in the VX7 Reference Guide The printer or PC cable requires a nine pin D shell female connector for the VX7 The printer or PC cable is attached to the connector labeled COM2 3 Note Use of a shielded cable is required to maintain FCC and CISPR22 emissions compliance 1 Power off the VX7 before connecting the cable to the VX7 2 Seatthe connector firmly over the pins and turn the thumbscrews in a clockwise direction Do not overtighten 3 Use a strain relief clamp to secure the cable Press the power button to power up the VX7 Ethernet and USB Ports An Ethernet port and different types of external USB ports are available via a dongle cable attached to the port labeled ETHERNET USB located on the bottom of the VX7 Please refer to th illustrations below for the different USB connectors available via dongle cable 1 Power off the VX7 befo
38. l single external or dual external antenna options e Ethernet port e USB Host and Client ports e Choice of screen display brightness based on ambient light in daily use e Available touch screen protective film e Available Uninterruptible Power Supply UPS Battery Pack e Available RAM MountTM options e Extended temperature version includes touchscreen heater e Support for voice applications such as LXE s TalkManager Note The VX7 Reference Guide contains VX7 technical information and advanced functions Environmental Specifications Feature Specification O Operating Temperature T Standard version 4 F to 122 F 20 C to 50 C non condensing Extended Temperature version 222 to 122 F 309C to 502C condensing Storage Temperate Standard version 22 F to 140 F 30 C to 60 C non condensing Extended Temperature version 22 F to 140 F 30 C to 60 C condensing Water Sand Dust IPG6perlEC60520 T pu ss Standard version Up to 90 non condensing at 104 F 40 C Extended Temperature version 100 Vibration Based on MIL Std SIE ESD 15 kV Quick Start This section s instructions are based on the assumption that your new system is pre configured and requires only accessory installation e g antenna external keyboard and or barcode scanner and a power source Use this guide as you would any other source book readin
39. ll cases connect to a properly grounded source of supply provided with maximum 15 Amp overcurrent protection 10 Amp for 230V circuits How To Connect External Power Supply 1 Turn the VX7 off 2 Connect the detachable cordset provided by LXE US only all others must provide their own cable to the external power supply IEC 320 connector Plug cordset into appropriate grounded electrical supply receptacle AC mains Connect the watertight connector end to the VX7 s Power Connector by aligning the connector pins to the power connector push down on the watertight connector and twist it to fasten securely 5 Turn the VX7 on Vehicle 12 80VDC Power Connection Caution For proper and safe installation the input power cable must be connected to a fused circuit on the vehicle This fused circuit requires a 10 Amp maximum time delay slow blow high interrupting rating fuse If the supply connection is made directly to the battery the fuse should be installed in the positive lead within 5 inches of the battery positive terminal Caution For installation by trained service personnel only Warning Risk of ignition or explosion Explosive gas mixture may be vented from battery Work only in well ventilated area Avoid creating arcs and sparks at battery terminals Note Please see Power Adapter Cable later in this section for information on adapting a VX1 VX2 or VX4 DC power supply to the VX7 Note Correct electr
40. n 1 on the number pad Page Down Fn 3 on the number pad Up Arrow Fn 8 on the number pad Left Arrow Fn 4 on the number pad Down Arrow Fn 2 on the number pad Right Arrow Fn 6 on the number pad Note The 2 key function is available on the 60 key keyboard only 60 key Standard Keypad The key map table that follows lists the commands used for the VX7 Note that since the VX7 uses a Microsoft Windows CE NET operating system no DOS Terminal Emulation keypress sequences are provided Key Map 101 Key Equivalencies When using a sequence of keys that includes the lt 2 gt key press the 24 key first then the rest of the key sequence Note This keyboard does not have a NumLock indicator NumLock is enabled by default The warmboot behavior of NumLock can be configured Please refer to Chapter 4 System Configuration in the VX7 Reference Guide When NumLock is off only the numeric 0 through 9 and DOT keys are affected All other keymaps are unchanged When the VX7 boots the default condition of Caps or CapsLock is Off The Caps or CapsLock condition can be set toggled with a lt 2nd gt lt F1 gt key sequence The CAPS LED on the keyboard is illuminated when CapsLock is On Press These Keys and Then 2 Shift Cti Alt CapsLock x ee H F10 To get this key Press this key Keyboard Backlight Suspend Resume Alt Alt Ctri Lo fo Esc ee C E Ese Space
41. nnect the output cable labeled To Computer from the UPS battery pack to the power connector on the bottom of the VX7 by aligning the water tight connector to the power connector push down on the water tight connector and twist it to fasten securely 4 Turn the VX7 on How To Connect VX7 to a Remotely Mounted UPS Battery Pack 1 Connect the power cable to the vehicle s electrical system as described in Connect Vehicle 12 80VDC Connection 2 Connect the power cable to the UPS battery pack by aligning the water tight connector pins to the input connector labeled From Vehicle push down on the water tight connector and twist it to fasten securely 3 Connect the output cable labeled To Computer from the UPS battery pack to the extension cable by aligning the water tight connector to the input end of the extension cable push down on the water tight connector and twist it to fasten securely 4 Route the extension cable the shortest way possible The cable is rated for a maximum temperature of 105 C 221 F When routing this cable it should be protected from physical damage and from surfaces that might exceed this temperature Do not expose the cable to chemicals or oil that may cause the wiring insulation to deteriorate Always route the cable so that it does not interfere with safe operation and maintenance of the vehicle Note f the vehicle is equipped with a panel containing Silicon Controller Rectifiers SCR
42. not to be co located with other transmitters Lithium Battery Safety Statement Lithium battery inside Danger of explosion if battery is incorrectly replaced Replace only with same or equivalent type recommended by battery manufacturer US AC Power Supply Safety Statement VX6 Output Rated 12 80 VDC Minimum 75W Optional A C Power Supply Outside North America this unit is intended for use with an IEC certified ITE power supply with output rated as stated at the top of this page US Vehicle Power Supply Connection Safety Statement Vehicle Power Supply Connection If the supply connection is made directly to the battery a 10A slow blow fuse should be installed in the positive lead within 5 inches 12 7 cm of the battery positive terminal US
43. ns on unless Microsoft Windows CE NET power management is configured to turn the display off after a certain period of inactivity Cleaning the Display Keep fingers and rough or sharp objects away from the display If the glass becomes soiled or smudged clean only with a standard household cleaner such as Windex without vinegar or use Isopropyl Alcohol Do not use paper towels or harsh chemical based cleaning fluids since they may result in damage to the glass surface Use a clean damp lint free cloth Do not scrub optical surfaces If possible clean only those areas which are soiled Lint particulates can be removed with clean filtered canned air Disabling the Touchscreen The touchscreen can be disabled if desired For more information please refer to Disabling the Touchscreen in the VX7 Reference Guide Disabling the Touchscreen Heater The touchscreen heater included on extended temperature VX7 models can be disabled on certain VX7 s if desired For more information please refer to Disabling the Touchscreen in the VX7 Reference Guide Calibrating the Touchscreen Although the touch screen is installed and calibrated at the factory users may make adjustments to it To calibrate the touchscreen select Start Settings and double tap the Stylus icon The calibration utility displays a cross on the screen Touch the center of the cross with the stylus and hold for a few seconds Release and repeat with t
44. ode Control Keys The keyboard has several control keys some of which are not used on the VX7 Note The 2 functions of the FA and lt F5 gt keys are not used as the display brightness is adjusted via the buttons on the control panel The 2 functions of the F6 and F7 keys are not used as the VX7 has TFT LCD screen with no provision for contrast adjustments The 2 functions of the F8 and F9 keys are not used as the sound volume on the VX7 is controlled with the Volume and Sounds icon in the Microsoft Windows CE NE Control Panel The F10 key is used to toggle the backlight as part of the keypress sequence lt 2 gt lt CTRL gt F10 This key sequence immediately toggles the status of the keyboard backlight Pressing lt 2 gt F10 has no effect on the keyboard backlight General Windows CE NET Keyboard Shortcuts Use the keyboard shortcuts in the chart below to navigate with any VX7 keyboard These are standard keyboard shortcuts for Windows CE NET applications Press these keys To CTRL C Copy CTRL X Cut CTRL V Paste CTRL Z Undo DELETE Delete SHIFT with any of the arrow Select more than one item in a window or on the desktop or select keys text within a document CTRL A Select all ALT ESC Cycle through items in the order they were opened CTRL ESC Display the Start menu T eter mg Display the corresponding menu
45. of the back mounting bracket Loosely tighten each bolt as it is inserted Important Do not torque bolts until all bolts are in place and viewing angle is adjusted Loosen the hex bolts on both sides to adjust the viewing angle of the mounted VX7 Torque the hex bolts to 50 5 in Ib 5 64 56 N m Note Test the torque on the bolts frequently during operation and re tighten if necessary to 50 5 in Ib 5 644 56 N m Step 4 Assemble Optional Keyboard Brackets 1 Fasten the keyboard to the keyboard mounting plate Use four 8 32x5 8 screws to attach the 95 key keyboard Use four 10 32x5 8 screws to attach the 60 key keyboard Note Excess keyboard cable length can be looped around the hooks on the bottom of the keyboard mounting plate Attach the keyboard mounting plate to the side mount brackets using the two adjusting knobs Adjust the angle of the keyboard by loosening the two adjusting knobs adjusting the keyboard angle and then tightening the adjusting knobs Step 5 Complete Assembly 1 If using a UPS battery pack the battery pack can be mounted to the bottom mounting bracket Place a locking washer and then a flat washer on a 1 4 20x2 bolt Thread the bolt through the UPS Battery Pack then through the 1 aluminum spacer and into the mounting bracket Connect all cables to the VX7 Secure the cables with the strain relief cable clamps ensuring a slack loop remains between the cable clamp and the accessory connecto
46. orn ones qaqas aaa qu RS sa qas PUMA PUER E 27 Step 2 Attach RAM Mount Ball tothe VXT cct e rete aa arpin 27 Step 3 Assemble Optional Keyboard Brackets L section sande 99 tte eL Da EUR de 099 EL Ra YER aud tL edd 28 Step 4 Attach VX7 and Bracket Assembly to RAM Mount ee eee 28 U Bracket Mount SVSEBITI zs dioec see oes to stature a qae uisatulua eta testa ies ast Itane aru aaa ia 29 Sceul siel EUER 29 Torque 1 EH ne HHT 30 dus TT 31 Step 1 Mount Bottom Mounting Bracket To Vehicle rissin mme 31 Step 2 Attach Rear Bracket VX7 uuu ua secco ei E dex REENA ena KL ER ERR E assay wakay LEE LEVER bet reet 3 Step 3 Attach VX7 Assembly To Bottom Mounting Bracket nn 31 Step 4 Assemble Optional Keyboard Brackets u LLL SL 3245 Sa emnes 32 Step 5 Complete Assembly mu sasuusawaspamayamamaqaaqqasqaqiwspaqupahaqassaqtanqaqiquiqhiaqhusqaqaaqaqtqaa kata 32 linstall Stylus Tether and SIS8SVe T 33 install REMOVE Touchscreen Protective FILM u LLL tico sapan aru AEE Fouad i aid eir pine 23 Remote LXE Keyboard Bracket Assemply ua e aaa e buta e a shane 34 Remote Keyboard Mounting DIMENSIONS sse 729 xt erprobt orbc udo RR da LUE HE ERES ERA qaqay XE EXE ALPE VZ VERRE assaka 34 UPS Battery Pack Remote MOULE uu anna ed prn ke encre eese rc opened tdi tees 35 Connect Keyboard P M 35 EXE ae aasma ataaphmaqaaqaiasqaaqqanmqhuqanqaqhkuayasauqqasaaqaskaqhua
47. plate into the RAM arm Adjust the keyboard to the desired position and tighten the knob on the RAM arm using the supplied RAM wrench Note Excess keyboard cable length can be looped around the hooks on the bottom of the keyboard mounting plate Make sure there is a minimum 1 25 4 mm clearance between the VX7 and the keyboard U Bracket Mount System Components Bottom Mounting Bracket This bracket is mounted to the vehicle The VX7 can be mounted to the bottom mounting bracket with or without an integrated keyboard mounting bracket Additionally the UPS battery pack may be mounted to the bottom mounting bracket If the optional UPS battery pack is to be mounted to the bottom bracket use the following parts included with the UPS battery pack not shown 1 long aluminum spacer w through hole 2 each 1 4 flat washer 2 each 1 4 locking washer 2 each screw pan head 1 4 20x2 2 each Back Bracket without Keyboard Mount 1 Rear Bracket 2 Hardware not shown 1 4 flat washer 8 each 1 4 locking washer 8 each 1 4 flat washer 8 each Back Bracket with Keyboard Mount 1 Rear Bracket 2 Adjustment knob 2 each 3 Keyboard Mounting Plate 4 Hardware not shown 1 4 flat washer 8 each 1 4 locking washer 8 each 1 4 flat washer 8 each Screws 8 32x5 8 4 each for use with the 95 key keyboard Screws 10 32x5 8 4 each for use with the 60 key keyboard Torque Measurements You will need a torquing tool capable o
48. r The vehicle mounted bracket and the VX7 are now ready to use Install Stylus Tether and Sleeve The LXE stylus kit includes the stylus tether and sleeves The tether allows the stylus to be mounted to the VX7 and the sleeve provides storage for the stylus when not in use How To Install Stylus Tether and Sleeves Locate the tether holes on the top of the VX7 see below Select the mounting hole most convenient for the particular VX7 installation Slide the clip end of the stylus tether into the tether mounting hole Determine a convenient location for the stylus sleeve Apply the adhesive baked Velcro loop strip to the VX7 or mounting bracket Attach the Velcro hook strip on the elastic stylus sleeve to the loop strip I nstall Remove Touchscreen Protective Film LXE offers a replaceable touchscreen protective film to protect the touchscreen when the VX7 is used in an abrasive environment How To Install Touchscreen Protective Film Make sure both the touchscreen and protective film are clean and dry before installation Please review Cleaning the Display later in this guide for instructions on suitable cleaning agents Center the protective film over the touchscreen The antiglare side must be facing outward Do not cut or trim the protective film The protective film is approximately 1 10 2 54cm larger than the touchscreen at the centers of the edged indicated by the arrows in the figure above Slide the
49. r SD memory cards The SD card is hot swappable Please see the VX7 Reference Guide for more details on the PCMCIA CF and SD slots AppLock and the VX7 AppLock may be installed and running on the mobile device AppLock restricts access to programs and the Windows CE NET Control Panel Please contact your system administrator for details Single Application AppLock Single application AppLock restricts a user to one application The user is unable to exit the application or if the application exits it immediately restarts Multi Application AppLock The appearance of taskbar icons are different on various mobile device platforms and may differ from the example shown below This example is shown only to aid in describing how the user can switch between applications using a stylus If RFTerm and Microsoft Word were the two applications locked and the user tapped the taskbar icon to place the popup menu on screen a switching menu showing both application icons is displayed on the screen Touch Tap the taskbar icon to place the popup menu on screen Tap one of the application icons in the popup menu The selected application is brought to the foreground while the other application continues to run in the background Stylus taps affect the application running in the foreground only Alternatively you can use the Tab BackTab and or cursor keys to move the on screen cursor Then press the Enter key to activate the highlighted choice
50. racket RAM Mount VX6 VX7 9000A023BRKTRAMMOUNT R Bracket Combo RAM VMT Mount w Keyboard Mount VX7 9000A027BRKTRAMWKBMN R Bracket VXX RAM ball on plate 9000A028RAMPLATEBALL R Bracket RAM keyboard mounting plate 9000A029RAMKBDPLATE R Bracket RAM keyboard arm 9000A030RAMKBDARM R Bracket RAM Squeeze Mount VX6 VX7 9000A031BRKTRAMSQZMT R Bracket Combo RAM Squeeze Mount w Keyboard Mount 9000A032BRKTRAMSQKBMT R Keyboard Brackets Bracket Remote Keyboard LXE SAO 9000A018BRKTMKBDRMT Bracket Remote Mouse Keyboard 9000A018BRKTMKBDRMT R Keyboards Keyboard LXE Standard D9 ANSI PC Overlay QWERTY See endl cin Liner M Keyboard LXE Standard D9 IBM 5250 Overlay QWERTY j o Keyboard LXE Standard D9 IBM 3270 Overlay QWERTY i O UN 9000A160MOUSEKBDD9 Keyboard Rugged PC Style w Mouse PS2 D9 9000A160MOUSEKBDD9 R Data Cables Cable Combo D15 to USB and Ethernet Adapter 1 Ft 9000A071CBLD15USBETH Cable Combo D15 to USB H USB C and Ethernet Adapter 9000A075CBLUSBHCETH Cable Keyboard Mouse Dual PS2 Adapter 1 Ft 9000A072CBLD9DUALPS2 9000A053CBL6D9D25 aad anll Dato H9 above part is not RoHS compliant Cable PC D9 to D9 9000A054CBL6D9D9 Power Cables Cable Input Power 12 FT VX5 VX6 VX7 9000A037CBLPWR12FT R Adapter Cable VX1 VX2 VX4 Power Cable to VX5 VX6 VX7 9000A077CBLPWRADPTR Power Supplies Power Supply External AC W US Power Cord VX5 VX6 VX7 9000A318
51. re connecting the D15 connector to the VX7 3 Insert the D15 end of the Ethernet USB dongle cable into the VX7 USB connector Seat the connector firmly over the pins and turn the thumbscrews in a clockwise direction Do not over tighten 3 Use a strain relief clamp to secure the cable Note The VX7 may be powered On any time after the D15 connector has been secured to the VX7 4 Plug the desired device such as a USB mouse or floppy drive into the end of the dongle cable with the USB port Refer to the documentation for your USB device for more details on installation USB devices may be installed removed or swapped without turning off the VX7 5 Insert the network cable and ensure it is firmly seated in the connector jack 6 TO remove the Ethernet cable press the release tab on the cable end USB Mouse The USB port may be used to connect a USB mouse to the VX7 however the mouse pointer may not always be visible Please see Touchscreen and Mouse later in this manual for more details Connect External Headset The VX7 provides an external headset connection via an audio jack connector labeled Audio The audio jack accepts a headset with a 2 5mm plug such as a mono headset with microphone or a stereo headset Please refer to the VX7 Reference Guide for information on configuring the audio port for a mono headset with microphone or a stereo headset 1 Insert the speaker or headphone plug into the audio connector making sure
52. re rrrr eT rat rere rent ee 49 P5 2 and USB Keyboards sais stasis errat tH EXSSR EXER MEER SER DRE ERR MEDIE EHE OEE DESE aquya qaqapa PUSH tU PA qaqas 49 Display and gee a T d a a a elec eUe etnies uel cataecateanatvanatanisaeteatataesure 50 Adjusting Screen Display uu iier doute ten bee negao Tee CU e EH E qusqa qaqata uS PE HL La RUE Edd a adu naate 50 Cleaning the DISPIAY eiue aasan ukaakksqusaa miaaqnaqakaqayanaqa aka asauqas anqaktanqassqataq AO AEA 51 Disabling the Rela Gren lt ssc cocks ul unn puqu aussi un au Sabu AT EEEa a 51 Disabling the Touchscreen LT uuu uuu eee pev aea oa sbt tn ud dua Qn pact E TCR ERO EROR st ud RE MOOR RR e MEA 51 Calibrating the Foren eL LUI LDILLT SLUT 51 Touchscreen Protective Film uuu u ani AA EAEE OE DEE EEEE SEEN TRRN REX RER aA 51 Touchscreen and MOUSE l u u SE ansa qasi nad 52 PO EMSTers UE 53 Microsoft Windows CE NET Event SOUFTOS u oer eros ote rune bor rere EEE pna nene d 53 Power Tale 2 lZ ice tas suspa ese DitbebalaapeipsbknR M IARORPRicelaTA li quar photed eecMpidceRih aa aaa Pa puasa 53 Laser Barcode Scanner Warnings scio noci ete betta Rue zoe LUE Eb pA OP c squa Rea eo cu ALL NR M Do D2 Eo Qta ped RS M ARENA 54 cM MEE 54 EVDO GRE 1 T M 55 delude UU 55 Right Glick EEUU 56 Scanner TCI seurs u u d 56 Aiming the Barcode Scanners uuu iiic isnt voisiewests cutee wasspaaq awqaqapawawhuyusshasankaqaaysaqsapuausqqashawaataswanqaia 56 Distanc
53. recommended by the manufacturer e Dispose of used batteries according to the manufacturer s instructions Getting Help All LXE manuals are now available on one CD and they can also be viewed downloaded from the LXE ServicePass website on the ServicePass Documentation page Contact your LXE representative to obtain the LXE Manuals CD or logon information for the ServicePass web pages You can also get help from LXE by calling the telephone numbers listed on the LXE Manuals CD in the file titled Contacting LXE This information is also available on the LXE website Explanations of terms and acronyms used in this guide are located in the file titled Glossary on the LXE Manuals CD Manuals and Accessories Manuals The following manuals are available on the LXE Manuals CD e VX7 Reference Guide e Contacting LXE e LXE Technical Glossary Accessories The table below lists the available VX7 accessories e Where two parts numbers are listed for a given part the part number ending in R is the ROHS compliant version e When only one part number is listed the part is RoHS compliant unless otherwise noted VX7 Brackets Bracket U Style VX6 VX7 9000A021UBRACKET R Bracket U Style w Integrated Keyboard Mount VX7 9000A025UBRKTWKBDMNT R Kit VXX U Bracket to VX6 VX7 Adapter 9000A022BRKTADPTKI T R Kit VXX U Bracket to VX7 Adapter w Keyboard Mount 9000A026BRKTADPKBDMN R B
54. reen 50 pack HX1A509WINDSREEN50 Replacement Headset Foam Ear Cover 10 pack HX1A510FOAMEAR10 Replacement Headset Foam Ear Cover 50 pack HX1A511FOAMEAR Scanners Scanner Powerscan SR 8 Cbl WW 8300A326SCNRPWRSR8DA9F 8300A326SCNRPWRSR8DA9F R Scanner Powerscan SR 12 Cbl US 8300A327SCNRPWRSR12DA9F above part is not ROHS compliant Scanner Powerscan SR Low Temp 8 Cbl 8300A332SCNRS8D9FLT above part is not RoHS compliant Scanner Powerscan SR Low Temp 12 Cbl 8300A333SCNRS12D9FLT above part is not RoHS compliant Scanner Powerscan LR 8 Cbl WW 8310A326SCNRPWRLR8DA9F 8310A326SCNRPWRLR8DAQF R Scanner Powerscan LR 12 Cbl US 8310A327SCNRPWRLR12DA9F 8310A327SCNRPWRLR12DA9F R Scanner Powerscan LR Low Temp 8 Cbl 8310A332SCNRL8D9FLT above part is not RoHS compliant Scanner Powerscan LR Low Temp 12 Cbl 8310A333SCNRL12D9FLT above part is not ROHS compliant Scanner Powerscan XLR 8 Cbl WW 8320A326SCNRPWRXLR8DAQF 8320A326SCNRPWRXLR8DAQF R Scanner Powerscan XLR 12 Cbl US 8320A327SCNRPWRXLR12DA9F above part is not ROHS compliant Scanner Powerscan XLR Low Temp 8 Cbl 8320A332SCNRX8D9FLT above part is not RoHS compliant Scanner Powerscan XLR Low Temp 12 Cbl 8320A333SCNRX12D9FLT above part is not RoHS compliant Scanner LS3408 Fuzzy Logic SR D9 Interface Cabl
55. shown in the following figures RAM Mount System Components RAM Mounting Assembly The RAM mounting assembly consists of the following parts 1 VXX RAM ball bracket 2 RAM arm size D 3 RAM ball base Qr RAM clamp mount RAM Clamp Mount includes Upper Clamp Piece with Ball Lower Clamp Piece Bolts 2 each Nylon locking nuts 2 each 4 Hardware not shown Bolts 1 4 20x5 8 4 each Washers 1 4 locking 4 each Washers 1 4 flat 4 each RAM wrench RAM Integrated Keyboard Mount The optional RAM integrated keyboard mount consists of the following parts 1 Keyboard mounting plate 2 RAM arm size C 3 Keyboard mounting bracket 4 Hardware not shown Screws 8 32x5 8 4 each for use with the 95 key keyboard Screws 10 32x5 8 4 each for use with the 60 key keyboard Bolts 1 4 20x5 8 3 each Washers 1 4 locking 3 each Washers 1 4 flat 3 each Torque Measurements You will need a torquing tool capable of torquing to 50 inch pounds 5 64 56 N m Torque all screws and bolts according to the following table For these screws and bolts Torque to 1 4 bolts 50 0 5 in Ib 5 64 56 N m Procedure Step 1 Mount Vehicle RAM Mount Bracket l Determine the position for mounting the RAM ball base Be sure to position the RAM bracket to allow access to the switches and ports on the bottom of the VX7 2 Attach the RAM ball base to the vehicle mounting surface using four 1 4 bolts or equivalent fasteners
56. stylus to the field of the data entry form to receive the next data feed e The cursor begins to flash in the field e The unit is ready to accept data from either the keyboard or a device connected to a serial port Right Click A right click can be simulated on the touch screen To perform a right click touch the touch screen with the stylus and hold it in the same location for a short time Scanner Entry The following section is directed toward a generic tethered scanner connected to the COM1 serial port on the VX7 Aiming the Barcode Scanner Aim the scanner awayfrom you direct it at the barcode and press the trigger to scan The Scan On LED or equivalent turns red to indicate the scanner is on Adjust the aim so that the thin red laser beam covers the entire length of the barcode Some scanners use a laser aiming beam which then spreads into a wide beam when the scanner s Aiming Beam Timer expires Place the aiming beam in the center of the barcode and hold the scanner steady until the beam spreads and the barcode is decoded Beeps may be heard as the barcode is decoded Refer to the barcode scanner user s guide for information on the Aiming Beam Timer and beep sequences and the TE reference guide for host generated beep sequences The scan beam must cross every bar and space on the barcode Distance from Label Large barcodes can be scanned at the maximum distance Hold the scanner closer to small barcodes or with bars th
57. t value for CapsLock is On The warmboot behavior of CapsLock can be configured Please refer to the VX7 Reference Guide for more information Scroll Lock and the VX7 For the 95 key keyboard the Scroll Lock key is backlit green when Scroll Lock is off When Scroll Lock is on the backlight for the Scroll Lock key is amber The default values for CapsLock and Scroll Lock are Off Keyboard Backlight The 95 key keyboard backlights each key with an LED The keyboard backlight is manually controlled using the backlight key in the upper right hand corner of the keyboard Pressing the backlight key cycles the keyboard backlight through the levels of backlight intensity Off e Maximum intensity e Medium intensity e Low intensity Pointing device The mouse pointer may not always be visible Please see Touchscreen and Mouse later in this manual for more details The 60 key QWERTY Keyboard The 60 key keyboard has 101 keyboard functions including a numeric keyboard pad Please refer to Appendix A Key Maps for keypress combinations IBM 3270 Keypad Overlay The 60 key keypad is available with an IBM 3270 overlay designed to allow the user to enter terminal emulator commands when running LXE s RFTerm program IBM 5250 Keypad Overlay The 60 key keypad is available with an IBM 5250 overlay designed to allow the user to enter terminal emulator commands when running LXE s RFTerm program Key Maps The 60 key
58. tandard PS 2 keyboard and mouse may be attached to the VX7 1 Turn the VX7 off before attaching the keyboard dongle cable Insert the 9 pin connector end of the dongle cable into the VX7 keyboard connector Once the pins are firmly seated tighten turning clockwise the thumbscrews Secure the cable with a strain relief cable clamp Attach a PS 2 keyboard and or PS 2 mouse to the appropriately labeled PS 2 connector on the dongle cable 6 Turn the VX7 on Note The PS 2 keyboard and mouse cannot be hot swapped The VX7 must be turned off to connect or disconnect PS 2 devices ML P O O Connect Antenna Several antenna options are available for the VX7 Options include single or dual external antennas remote vehicle mount antennas and an internal antenna External Antenna Note VX7 s are equipped with a radio and require an antenna Some VX7 s may be equipped with a dual antenna option For these VX7 s an external antenna must be connected to each antenna connector Place the antenna over the antenna connector Push down and twist clockwise until the antenna is secured Repeat for second antenna connector if present Adjust the antenna angle to improve RF communications with the computer network Note Substitution of antennas is not permitted unless authorized by LXE Use of unauthorized antennas will void the FCC emissions certification of the VX7 Remote Vehicle Mount Antenna The external antenna or antennas can be remotely
59. this manual is in PDF format Acrobat amp Reader Copyright O 1987 2006 Adobe Systems Incorporated All rights reserved Adobe the Adobe logo Acrobat and the Acrobat logo are trademarks of Adobe Systems Incorporated applies Revision Notice Notices Updated copyrights and trademarks Accessories Updated Accessories listing and included ROHS classifications Input Panel Virtual Keyboard Revised section Table of Contents The VX7 Vehicle Mount Computer uuu auam nasus U Q J Q Q J T 7 IHIKOCIUCHODu a a uma ELE 7 Environmental Specification Soarian taa t tete ut Rees udo BOR RU ad uta properat Re Duk MR lua ED e tup na AE NEU e data td dius 8 Quick Sharr uuu cace secas veta ya asss inasa bau ER MT DUUM Pcr MU DII IDE leg sika Rais da pha 9 The Full Screen PI 10 VA PECOUT h TTT 10 Microsoft Windows CE NET Control Panel sirnana ieee aiaiai 10 PEMGIA ATA and SDS GUS on Ea E Gene ea eee ae 10 AppLock and the TTT 11 Se elec E Tae cmm Pm 11 M lti Applicatiom APPLOCK T 11 be ATR NAN A N A E O bawah hasa 11 lii T 11 The Lorem nan ae E a a aa adaa a aeaii 12 The 95 key QWERTY Keyboard with Pointing Device u unanqa ini NE aS 12 Key Ts 12 NumLock andl iMe VAT T 13 CapsLock and thi VXT orpoaren nna a A a Aa EAAS Ea a EA a aa aa 13 ScrollLock andthe NAT urunane E E A E A AE 13 Keybo
60. utton for more than five seconds forces a shutdown Any open programs and the Windows CE NET operating system are shut down before power off Use this option to shut down the VX7 when the operating system is not responding For more information on the Windows CE NET shutdown process please refer to the Windows CE NET help function or commercially available help guides Keyboard Backlight LXE keyboards feature LEDs that illuminate the individual keys 95 Key Keyboard The backlight is manually controlled using the backlight key in the upper right hand corner of the keyboard Pressing the backlight key cycles the backlight through the levels of backlight intensity Off e Maximum intensity e Medium intensity e Low intensity 60 Key Keyboard The keyboard backlight may be toggled manually by pressing lt 2 gt lt CTRL gt lt F10 gt This key sequence immediately changes the state of the keyboard backlight as follows e Turns the backlight Off if it is currently On e Turns the backlight On if it is currently Off PS 2 and USB Keyboards Standard PS 2 and USB keyboards generally do not feature keyboard backlighting Display and Touchscreen The VX7 Display is a thin film transistor display capable of supporting SVGA graphics modes Display size is 800 x 600 pixels The display covering is designed to resist stains The touch screen allows signature capture and touch input The touch screen is a Resistive Pan
Download Pdf Manuals
Related Search
Related Contents
User Manual Additel 920 User Manual Intermec DX1A06E00 Hotpoint GB Ultima S-Line Washing Machine SWMD 9437 User's Manual User`s Manual E asyCan Digital IMRIE 3000 - imrie.com.au ChlorMaker DO TM OPERATING INSTRUCTIONS Shure P4HW User's Manual Copyright © All rights reserved.
Failed to retrieve file