Home

Honeywell DOLPHIN 9900

1. EE a j ANALTZE Status LED color Indicates that the battery in the slot Solid Green Has completed the Analyze cycle Flashing Orange Is being analyzed Solid Red Encountered an error during the Analyze cycle To Analyze a Battery 1 Insert the battery into the Charge Analyze slot the 4th 2 Press the ANALYZE button The Status LED flashes orange to indicate that the analyzing cycle has begun The charger is accumulating battery pack information during the entire Analyze cycle Do NOT remove the battery until the cycle has been completed 3 Upon completion of the Analyze cycle the Status LED lights solid green and the Battery Capacity Indicator LEDs display the battery s capacity You can verify a battery s capacity by installing the battery in a terminal and checking the power see Power on page 6 12 14 5 Mounting The charger should be on a dry stable surface and can be mounted on a flat horizontal surface such as a desktop or workbench or a flat vertical surface such as a wall When choosing a location always bear in mind that e the mounting location must allow users easy access to power switch and power connector e the charger should be oriented so that users can easily insert and remove battery packs and read the labels especially for the Battery Analyzer Installation Hardware The DIN rail slot 7 5 X 35 mm on the bottom panel to enables secure moun
2. ccccsseeeeeeeeeeseeeeeeees Standard Configuration for the 9950 Standard Configuration for the 9951 Peripherals for the 9900 9950 and 9951 Accessories for the 9900 9950 and 9951 Front Panel 9900 9950 and 9951 ra Front Panel Features for the 9900 9950 and 9951 Back ANCL SOU aspas aa DS E Back and Side Panels 9950 and 9951 em OIE PANO isso E add adia a BaCk PANGI seepran nina nina ra no dd E Back Panel Features for the 9900 9950 and 9951 Side Panels 9900 9950 and 9951 eee E si pe Cl E E E ARMED E UR a RR RR RR AIG SIDE e E Installing a Memory Card cccccceccccsseeecceeeeeceeeeeeeeeeeeseeeessaaess Bottom Panel 9900 9950 and 9951 PO OSC O ais cm feio dana ia SU a Using the Touch Panel eee erre eerarrananeanao Installing a Screen Protector eee Healthcare Housing cccccsccsesceseecseseeseesenseeseueeseusenseeseneeseesenseeseas DONOS quina rasia nas a qu O ees etree attr eit eatin Main Battery Pack eee eere arena rrenanenn o Internal Backup Battery e eeereerereerrenerenao Managing Battery Power eee rrenrean o Checking Battery Power erre rerena ili MESSING ne Terminal sasaainigaossnf raiaiiaaiimagenes E A Ainaa ida ias ias adia gia 3 18 DO Reset VV AIM BO
3. a Ex Can qi File Explorer amp SysInfo txt To beam select a device eA Unknown device 4 Unknown device ei Unknown device Unknown device 5 Unknown device A Unknown device 3 HAILEA ei Unknown device en Unknown device a Fi File Explorer amp SysInfo txt To beam select a device 7 ITS620 en T43 MA 1 LABBBS EQ o 13 IBM IT Unknown device ei LINNE E CARTA 3 D9900 13 em LYNCHR i MELITTAJ ei SEVORETM 1 3 03 1 3 03 23 6K 10 11 07 14 2K Rename Beam File Al a BI d X Name Tap to send Tap to send Tap to send Tap to send Tap to send Tap to send Tap to send Tap to send Tap to send Tap to send Tap to send Tap to send Pending Tap to send Tap to send Tap to send Tap to send When a Bluetooth device is first found it appears as an Unknown device the ji ICON indicates that the device is a Bluetooth device As data is retrieved the device IDs appear in the list 7 When the file is being transferred the selected device reads Sending Making the Terminal Discoverable By default the Dolphin terminal is not discoverable which means that the terminal will not be found by other Bluetooth devices To make the terminal discoverable tap the Mode tab re Settings Bluetooth Turn on Bluetooth Make this device visible to other devices To connect to a device click on the
4. Q m ECO GG o OJOGO 0000 0000 O00000 0000 OOOO DOO GIOIOIO ae as START O T q 0 0 0 0 0 OO QO 00000 90000 OIOIOIGIO ae 20 ree 0000 All Keyboards Contain the Following e Backlit for easy viewing in various lighting conditions e Centrally located keys for both right and left hand operation e Color coding so you can clearly see the most common keyboard combinations e A silver background to enhance readability e Function navigation and modifier keys Keyboard Combinations See on page See on page See on page Common Buttons See Using the Function Keys on page 5 2 See Using the Modifier Keys on page 5 3 See Using the Navigation Keys on page 5 3 Using the Function Keys Backlight 9 Turns the keyboard backlight on and off Backspace TA Moves the cursor back one space each time the key is pressed If you are BKSP Ei typing text it deletes the previous character each time it is pressed Delete Es Deletes the next character forward each time the key is pressed DEL h no ey appears on the 56 key keyboard only 43 key keyboard Red Enter ENT Confirms data entry Cancels the current action Escape ESC Power Key Puts the terminal in and wakes the terminal from suspend mode see Suspend Mode on page 3 18 Activates the scan and wakes the terminals from sleep mode Its position allows convenient one han
5. _ e E a 5 Slide the SD card into the appropriate slot until it clicks into place a To remove an installed SD card tap on the edge lightly to unlock the card the card will pop out just enough for you to grab its edge and pull it out 6 Replace the access door and tighten the screws There is a rubber gasket on the inside of access door that must be in place when you seal the door This gasket performs the sealing action for the door Bottom Panel 9900 9950 and 9951 Description 00 000000 10 14112 13 14 15 161 00000000 I O Connector 9 USB PWR N C N C N C N C GND 5V OUT DTR USB USB DET RI DSR RXD RTS TXD CTS sI oO O71 amp Go MN 1O 5 e Note Signals referenced are for a DTE device I O Connector The I O connector powers the terminal charges the main battery and facilitates communication All Dolphin peripherals are designed to work exclusively with this connector The I O connector supports RS 232 and USB communication For RS 232 the maximum communication speed is 115 Kbps with seven baud rate settings For USB the communication speed is up to 12 Mbps Powering Out The I O connector also provides power out to peripheral devices 5V at 500mA This means that with the proper cable the terminal can power another device By default power out is disabled To enable power out alter the registry as follows HKEY_LOCAL_MACHINE Drivers Built
6. 2D Symbologies Composite Codes Postal Codes Codabar Code 3 of 9 Code 11 Code 32 Pharmaceutical PARAF Code 93 Code 128 EAN with Add On EAN with Extended Coupon Code EAN 8 EAN 13 GS1 128 GS1 Databar Interleaved 2 or 5 Aztec Codablock Code 16K Code 49 Composite Data Matrix GS1 Databar MaxiCode Micro PDF OCR PDF417 QR Code Aztec Mesa Codablock F EAN UCC GS1 Databar 14 OCR US Money Font MICR E 13 B and SEMI Font OCR A OCR B ISBT 128 Matrix 2 of 5 MSI Plessey PosiCode Straight 2 of 5 IATA Straight 2 of 5 Industrial Telepen Trioptic Code UPC UPC A UPC E Postnet and most international 4 state codes Australian Post British Post Canadian Post China Post Japanese Post KIX Netherlands Post Korea Post Planet Code Decoding The terminal supports two types of image decoding for use in various bar code reading and imaging applications full area imaging and Advanced Linear Decoding ALD Full Area Imaging Full area imaging provides omni directional reading of linear and non linear 1D and 2D bar codes OCR signature capture and picture taking When reading all bar code types using full area imaging a positive read can be obtained from many positions see Aiming Options on page 4 5 To achieve the best read the aiming beam should be centered horizontally across the bar code ALD ALD provides fast reading of linear and stacked linear bar codes To achie
7. KEP 7 7 Pin Description Internal Jumper to Pin 6 TXD RXD DSR GND DTR CTS RTS RI OONDOOABRWDN gt Note Signals referenced are for a DTE device The base is at a right angle to the printed circuit board PCB The ninth pin has a ring indicator Ri 11 5 Charging the Main Battery The base powers the terminal and fully charges its main battery pack in 4 5 hours The base contains an intelligent battery charging system that protects the battery from being damaged by overcharging The unit senses when a battery pack is fully charged and automatically switches to a trickle charge that maintains the battery at full capacity Therefore terminals may be stored in the base without damage to the terminals battery packs or E peripherals D To check battery power use the Power system setting see Power on page LOS 6 12 Ei 629 For more information about Honeywell Li ion batteries see Batteries on 2559 page 3 15 82888 Oo 6 Oo 0900 To Power a Terminal and Charge its Main Battery 90970 1 Install the battery pack in the terminal see Install the Main Battery Pack on page 2 1 1 Connect the base to the power supply provided by Honeywell 2 Slide the terminal into the terminal well until the Dock LED lights green to indicate that the terminal is proper
8. Navigate to the Start Menu folder Windows gt Start Menu Right click on an empty area and select Paste Shortcut On the terminal tap the Start menu o a OL de SO do Verify that program appears System Tab The System tab enables you to verify and sometimes alter system parameters To access the System tab go to Start gt Settings gt System tab Tap the appropriate icon to open that system setting gt Settings ag X f gt G E About Backlight Certificates PETT MNI 4 t fal va Clock amp Encryption Error Alarms Reporting s External Memory GPS OA ia i ro CE CET Personal System Bamas Smbtmacrompecio rower Smrmmempor EM ET mito Sowmncmpmeeis About The About system setting displays specific information about the terminal It contains three tabs Version Tab Displays the information about the software operating system and processor Device ID Tab Displays the information the terminal uses to identify itself to other devices It can be important to know this information if the Dolphin terminal is going to be part of a networked system of devices Device name Displays the system s default name This is the name used by ActiveSync Description Displays the description of the device ID Copyrights TabDisplays important copyright information Backlight The Backlight system setting enables you to customize backlight functionality for the display The backl
9. Proxy Server Connections If you are connected to your ISP or private network during synchronization the terminal should download the proper proxy settings during synchronization with the PC If these settings are not on your PC or need to be changed ask your ISP or network administrator for the proxy sever name server type port type of Socks protocol used and your user name and password Modify an Existing Connection Manage Existing Connections appears on the Connections tab after at least one network connection has been established Tap Manage Existing Connections on the Tasks tab and follow the setup screens se Settings ll a Tx ME lok Connections My ISP Add anew modem connection Manage existing connections You will usually be walked through the same setup screens used to establish the connection Advanced Tab The Advanced tab enables you to select the default network dialing rules and IP address exceptions for modem connections sE Settings fal qr Tx a ok Connections Select which networks are automatically used Select Networks Dialing Rules Create exceptions for intranet addresses Tasks Advanced Note You should not need to change Advanced settings because most ISPs now use DHCP addresses Online Help For more information about modem connection setup consult the online help on the setup screens by tapping the Help icon Dolphin Wireless Manager The Dolphin Wireless Ma
10. To do so you must determine if your host RS 232 device is e 9 pin or 25 pin and e configured as a DCE or DTE device Serial Connector The base connector is straight to the printed circuit board PCB The ninth pin sends 500mA at 5V power out This can power a peripheral device such as a mobile printer as long as that peripheral device can accept 500mA at 5V 12 8 Pin Description 1 2 3 4 5 6 7 8 9 Note Signals referenced are for a DTE device Internal Jumper to Pin 6 TXD RXD DSR GND DTR CTS RTS 5 VOLT OUT 13 Dolphin ChargeBase Device Overview This 4 slot charging cradle that can power 4 Dolphin terminals and charge their main batteries in 4 5 hours Charging The base powers to the intelligent battery charging system in all Dolphin terminals that senses when a full charge has been achieved and switches to a trickle charge to maintain the full charge As battery packs charge the charging circuitry follows the two step charging process CC CV that is recommended for Li ion batteries The process monitors changes in temperature current and voltage Convenient Storage Intelligent battery charging makes this base a safe and convenient storage receptacle for your Dolphin terminal Capacity The base can hold up to 4 Dolphin terminals Each charging slot charges each terminal independently of the other slots We recommend use of Honeywell Li lon battery packs Use of any non Ho
11. provides service for all its products through service centers throughout the world To obtain warranty or non warranty service contact the appropriate location below to obtain a Return Material Authorization number RMA before returning the product North America Telephone 800 782 4263 Fax 803 835 8012 E mail naservice Whoneywell com Latin America Telephone 803 835 8000 Telephone 800 782 4263 Fax 239 263 9689 E mail laservice honeywell com Brazil Telephone 55 21 3535 9100 Fax 55 21 3535 9105 E mail brservice honeywell com Mexico Telephone 52 55 5203 2100 Fax 52 55 5531 3672 E mail mxservice honeywell com Europe Middle East and Africa Telephone 31 0 40 2901 633 Fax 31 0 40 2901 631 E mail euservice honeywell com Asia Pacific Telephone 852 2511 3050 Fax 852 2511 3557 E mail apservice honeywell com Japan Telephone 813 3839 851 1 Fax 813 3839 8519 E mail apservice honeywell com Online Product Service and Repair Assistance You can also access product service and repair assistance online at www honeywellaidc com For ongoing and future product quality improvement initiatives 9900s 9950s and 9951s comes equipped with an embedded device lifetime counter function Honeywell may use lifetime counter data for future statistical reliability analysis as well as ongoing quality repair and service purposes Technical Assistance If you need
12. s Settings H ET P ok Power Main battery Lilon Battery power remaining a 100 Backup battery 0 i 100 For more information see Power on page 6 12 Resetting the Terminal There are two types of system resets a soft and a hard reset Soft Reset Warm Boot A soft reset re boots the device without losing RAM data You would perform a soft reset when e the terminal fails to respond e after installing some software applications e after making changes to certain system settings such as network cards 1 On the 56 key keyboard press and hold the CTRL SFT SFT keys for approximately 5 seconds On the 43 key keyboard press and hold the CTRL NUM keys for approximately 5 seconds 2 The decode and scan LEDs flash for approximately three seconds as the terminal resets When the reset is complete the Today screen displays Hard Reset Cold Boot A hard reset resets the operating system restores the terminal back to factory defaults and resets the terminal after a bootloader keyboard and kernel upgrade N A hard reset erases all of the data stored in RAM memory and all RAM installed applications 1 Press and hold the CTRL ESC SFT keys for approximately 5 seconds 2 The decode and scan LEDs light for approximately 3 seconds 3 The terminal re initializes see Initialize the Mobile Computer on page 2 8 Suspend Mode The terminal goes into suspend mode automatically when the terminal is
13. 19 25 This sets the Low Battery point to 25 19 hex 25 decimal When the battery hits the percentage charge specified here the user is notified by this icon in the Navigation bar nr If the main battery is low and the terminal is in suspend mode pressing the SCAN or Power button won t wake the Dolphin terminal you must replace the discharged battery with a battery charged over 25 mark before you can resume terminal operation CriticalBatt a 10 This sets the Critical Battery point to 10 a hex O decimal When the battery hits the percentage charge specified here the user is notified by this icon in the Navigation bar t Note Warnings do not appear when the terminal is on external power Setting Critical and Low Battery Points Developers can reset these parameters in the registry from O no warning to 99 would nearly always warn You can review and set these battery points in the RegEdit Power Tool 1 Tap Start gt Power Tools gt RegEdit 2 Drill down to HKEY LOCAL MACHINE gt System gt CurrentControlSet gt Control gt Power 3 Tap the Value Name to change the Value Data You can reset the Value Data from O no warning to 99 would nearly always warn 4 Tap OK to save changes For more information about the RegEdit Power Tool refer to the Dolphin Power Tools User s Guide available for download at www honeywellaidc com Checking Battery Power Tap Start gt Settings gt System tab gt Power
14. 29 2034 GlobalSign Root CA 1 26 14 GeoTrust Global CA 520 22 Equifax Secure Certific a 22 16 Personal Root ClearType Tuner This system setting enables you to adjust the level ClearType font rendering by moving a slider The sample text displays the setting results immediately Of course you must first enable ClearType font rendering to change the appearance of fonts on the screen see ClearType Tab on page 6 14 Clock amp Alarms This setting sets the system clock which means that all scheduled items run according to this setting The time and date need to be reset after every hard reset of the terminal so that the system clock is accurate On the Today screen tap the line that displays the time and date se Start Al ge Ty im Wednesday January 16 2008 Phone off The Clock Settings screen appears The selected time sets the system clock si Settings ala Ty E lok Clock amp Alarms GMT 8 Pacific US 7 12 06 33 PM B 1 14 2003 Visiting mesa A Encryption Encryption gives you the option of encrypting files placed on storage cards to that those files cannot be read by any other device J Settings Encryption Select this check box to encrypt Files as they are placed on 4 storage card Such files are readable only by this Windows Mobile based device Encrypt Files placed on storage cards Error Reporting Error Reporting gives you the option of enabling or dis
15. 9950 and 9951 terminals meet or exceed the requirements of all applicable standards organizations for safe operation However as with any electrical equipment the best way to ensure safe operation is to operate them according to the agency guidelines that follow Please read these guidelines carefully before using your Dolphin terminal Label Locations Dolphin 9900 Dolphin 9950 amp 9951 Compliance Label Compliance Label Ss 19 o a aa Laser Safety Label If the following label is attached to your product it indicates the product contains a laser engine or laser aimer SE1200 Laser Scan Engines Image Engines with Integrated Laser Aimers LASER LIGHT DO NOT STARE INTO BEAM CLASS 2 LASER PRODUCT 1 0 mW MAX OUTPUT 650nM IEC60825 1 1993 A1 A2 Complies with 21 CFR 1040 10 and 1040 11 except for deviations pursuant to Laser Notice No 50 dated June 24 2007 Laser Eye Safety Statement This device has been tested in accordance with and complies with IEC60825 1 1993 A1 A2 and 21 CFR 1040 10 and 1040 11 except for deviations pursuant to Laser Notice No 50 dated July 26 2001 LASER LIGHT DO NOT STARE INTO BEAM CLASS 2 LASER PRODUCT 1 0 mW MAX OUTPUT 650nM Caution use of controls or adjustments or performance of procedures other than those specified herein may result in hazardous radiation exposure LED Safety Statement The LED output on this device has been tested
16. Attach the mounting bracket to the wall using the Recommended Hardware see page 13 7 2 Oneach end of the base insert a screw into the round end of each of the 4 screw slots on the bottom panel Then slide each screw towards the narrow end of the slot until it snaps in place Use a washer nut set on each of the 4 screws to secure the screw in the slot Place the base on the mounting bracket match the holes up with the secured screws Use the remaining washer nut sets on each of the 4 screws to secure the base to the mounting bracket Recommended Hardware lf a metal or wood stud is present drill a 3 32 in pilot hole into the stud and use a 6 X 1 1 2 screw and washer to attach the bracket to the wall For any of the screws positioned so that they are going directly into dry wall use a sheet rock anchor screw set such as the one listed below For any of the screws attaching directly into concrete drill the appropriately sized pilot hole into the concrete and secure the bracket to the wall using concrete anchor screws such as those listed below Wal Recommended Anchors Sheet Rock Buildex E Z Anchor Stud Solver Medium Duty Drywall Anchor Model 25216 supports 50 Ibs screws included Buildex TAPCON concrete anchors 3 16 in X at least 1 in 13 7 13 8 14 Dolphin QuadCharger Device Overview This 4 slot charging station provides intelligent battery management for the Li ion battery packs used in Dolphin termi
17. Device gt IPSM gt Autoinstall will re install after the next hard reset For information about the hard reset process see Hard Reset Cold Boot on page 3 18 1 Tap Remove Programs In the list select the program you want to remove se Settings Remove Programs Programs in storage memory Hand Held Products Inc SmartDe SOTI Pocket Controller SDERT 20082 WM PowerTools 4 0041 Wh HHP 502 11G SAMSUNG SPI DRI Devicescape SWE Dolphin ODE A wm armigi Dolp Demos 4 0041 Wi Remove Total storage memory available 7390k 2 Tap Remove The following message appears The selected program will be permanently removed You may reload it from your desktop computer Are vou sure you want to remove it 3 Tap Yes Wait while the program is removed 4 Verify that the program no longer appears in the list Screen The Screen system setting contains three tabs Alignment Clear Type and Text Size Alignment Tab ClearType Tab Text Size Tab re Settings Screen Align Screen Align the screen if it is not responding accurately to stylus taps Align Screen Alignment ClearType You need to re align the screen if tapping buttons or icons with the stylus no longer seems to work appropriately Tapping Align Screen brings up the align screen window where you are guided to tap a target several times This re calibrates how the touch screen receives input e Alignment shou
18. Devices tab below Devices Mode com Ports Select Make this device visible to other devices and tap OK Selecting COM Ports You can select COM ports 0 9 For more information see 9900 9950 9951 COM Port Assignment Table on page 7 12 10 Working with GPS Overview The Dolphin 9900 terminal contains an integrated GPS module which allows location tracking of workers and vehicles providing better utilization of field assets Optional mapping and navigation software provides turn by turn driving directions and location information allowing workers to arrive on time Note The 9950 and 9951 are not available with GPS Assisted GPS Support The operating system software does not inhibit nor explicitly support assisted GPS modes which usually requires installing a vendor specific client on the terminal that communicates with the GPS module This client would then provide the almanac and or ephemeris data for warm or hot start modes of operation allowing a lower time to first fix TTFS The Client must be configured on the terminal active and provide the data to the GPS module through the standard COM port Powering the GPS Module The GPS module powers on automatically when accessed by a software application and powers off automatically when that software application closes You cannot manually power on and off the GPS module 10 1 Communication Ports There are two ways to access the GPS module through the actua
19. assistance installing or troubleshooting your device please call your distributor or the nearest technical support office 15 1 North America Canada Telephone 800 782 4263 Fax number 315 554 6705 E mail natechsupport O honeywell com Latin America Telephone 803 835 8000 Telephone 800 782 4263 E mail latechsupport O honeywell com Brazil Telephone 55 21 3535 9100 Fax 55 21 3535 9105 E mail brsuporte Whoneywell com Mexico Telephone 803 835 8000 E mail latechsupport honeywell com Europe Middle East and Africa Telephone 31 0 40 7999 393 Fax 31 0 40 2425 672 E mail eurosupport honeywell com Asia Pacific Telephone Hong Kong 852 3188 3485 or 2511 3050 Telephone China 86 21 6361 3818 E mail aptechsupport O honeywell com Japan Telephone 813 3839 851 1 E mail aptechsupport honeywell com Malaysia Telephone 603 6201 7020 E mail aptechsupport honeywell com Online Technical Assistance You can also access technical assistance online at www honeywellaidc com 15 2 Limited Warranty Honeywell International Inc HII warrants its products and optional accessories to be free from defects in materials and workmanship and to conform to Hll s published specifications applicable to the products purchased at the time of shipment This warranty does not cover any HII product which is i improperly installed or used ii damaged by accident or neglig
20. companies and are the property of their respective owners Patents Please refer to the product packaging for a list of patents Other Trademarks The Bluetooth trademarks are owned by Bluetooth SIG Inc U S A and licensed to Honeywell 2008 2009 Honeywell International Inc All rights reserved o Table of Contents Chapter 1 Agency Information Label LOCATIONS esinissiaieas ais tiene cidade aadida aaa caldas POUR i Ca Tea adia LED Salety Stalement onea inss asdec oii ipa doa na dEs patas desmaia Infrared LED Safety Statement eee UL and cUL Statement csse Approvals by COUNTIY ccccccsseceeceeeeeceeeeeeseaeeeeseueeesaaeeesseeseeesaeeeeeas R amp TTE Compliance Statement 802 11b g Bluetooth and or GSM Dolphin RF Terminal 802 11b g Bluetooth and or GSM For European Community Users ccccceeeeceeseeeeceseeeceeeeseaneessaees Waste Electrical and Electronic Equipment Information Chapter 2 Getting Started Out Of the BOX rara Today SCVCCM eeaeee E REENE NAVIO ANION DAR esre nina da den nd esa Command Bal cccccceeccccesececcesccecaesceeteueceesueecesseeeessueeeetsneeessaeeees Icons in the Navigation Bar cccccccsseecseceeeeeeseeeeeeeeseeeeeeesaeeeseeeenes Pop Up MENUS ise cscsadcaccersaceetewendenntictcvsntanieeeussesisnnesaiteateeoevendeaetaateens Chapter 3 Hardware Overview Standard Configurations for the 9900
21. e Messaging and e Tasks Font scaling means that you can increase or decrease the point size of the font on application windows To change the font size move the slider toward Smallest or Largest The Example text changes to reflect the font change Tap OK to save the new font size setting WAN Info When the GSM radio is active WAN Info displays useful statistics for the radio sk Start a AJ 42 lok WAM Information Radio version SIEMENS ia res REVISION 04 001 RIL version 1 2 5 5 MUM Version 1 2 2 0 RHA Version 1 2 5 5 Audio version 0 43 5 0 To verify whether or not the GSM radio is enabled check the Dolphin Wireless Manager see page 7 6 Windows Update Windows Update is designed to download Microsoft updates to the operating system directly from Microsoft 4 Communication Connections Tab The Connections system setting provides access to the terminal s various wireless communication options ni Settings 1 or xj EE x a E O Q me Beam Bluetooth Connections O F a Dolphin Network USE to PC Wirele Cards Personal System ok Enables infrared communication Bluetooth Configures the Bluetooth radio 9 1 This icon appears only if a Bluetooth radio and driver is installed 2 on the terminal M Connections Opens Microsofts connections manager 7 4 J Connections Dolphin Manages the wireless radios installed in the terminal Wireless Manager Enables advanced U
22. fim Battery levels 1 4 Tap this icon to open the Power system setting and see the charge a see page 3 17 Critical battery The charge percentage is at the critical battery point set in the registry the default is 10 For details about the critical battery point see page 3 16 Tap this icon to open the Power system setting and see the charge percentage see page 3 17 e Terminal is running on external power If a battery pack is installed that battery is charging The terminal is not connected to external power A battery is installed but is defective specifically its charge level cannot be measured No SIM card is installed a GPRS available Ca GPRS connected a EDGE available Icons in the Navigation Bar Indicator Meaning e omens a o o wo pee ooo To peame oe Tomo o re om E Pe eo p Pop Up Menus With pop up menus you can quickly choose an action for a selected item To access a pop up menu tap and hold the stylus on the item name of the action you want to perform the action When the menu appears lift the stylus and tap the action you want to perform Copy Rename Delete Tap anywhere outside the menu to close the menu without performing an action Selecting Programs To see additional programs loaded on your terminal tap Start gt Programs The Programs screen displays the programs that are not listed on the Start menu To open a program tap once on the icon N
23. graphic array VGA resolution is 1 4 240 X 320 pixel The color LCD is 16 bits pixel and uses thin film transistor TFT technology The backlight for the touch panel lights when the screen is touched but not when the Backlight key is pressed For more information see Backlight on page 6 8 The touch panel can be activated by the stylus included with the terminal or a finger For more information see Using the Touch Panel on page 3 13 Back Panel 9900 Image Scan Engine Window IrDA Port Stylus Slot Fastener for the Stylus Tether Fastener for the Stylus Tether QO QO Battery Well QO QO e 1 Microphone For a description of each callout see Back Panel Features for the 9900 9950 and 9951 on page 3 9 Back and Side Panels 9950 and 9951 The back panel of the 9950 and 9951 contains an integrated pistol grip handle for a more ergonomic grip in scan intensive applications The stylus is stored inside the handle for easy access Side Panel Image Scan Engine Window iii PR Scan Trigger Pistol Grip Handle Scan Trigger Press the scan trigger to activate the image or scan Pistol Grip Handle The pistol grip handle is integrated into the back panel of the terminal and ergonomically designed to be comfortable through repetitive scans Back Panel Image Scan Engine Window Rear Speaker Pistol Grip Handle Battery Well For a description of each
24. in accordance with IEC60825 1 LED safety and certified to be a Class 1 LED device The maximum power outputs for each diode are as follows Illumination LED 194 0 uW wavelength 626nm 30nm e Aimer laser 5300 engine 360 1 uW wavelength 655nm Aimer LED 5100 engine 81 6 uW wavelength 526nm 30nm e Laser 9951 models lt 1 5 mW wavelength 650nm scans second bidrectional 35 5 Infrared LED Safety Statement Caution Do not view directly with optical instruments The maximum power outputs for the IR LED is 145 1 uW LEDs are pulsed at a frequency of 115 200 Hz with a duty cycle of 18 75 where the ON time of a single pulse is 1 6275 x 10 seconds UL and cUL Statement UL and cUL listed UL60950 1 and CSA C22 2 No 60950 1 03 Approvals by Country FCC Part 15 Subpart C 15 247 UL60950 1 FCC Part 15 Subpart B FCC Part 22H FCC Part 24H FCC SAR OET 65 Supplement C Canada ICES 003 Class B cUL60950 RSS 132 RSS 133 RSS 210 European Community CE EN300328 1 2 EN60950 1 2000 EN55022 1998 A1 2000 A2 2003 EN60950 1 2001 A11 2004 EN55024 1998 A1 2001 A2 2003 EN60825 1 1994 A1 2002 A2 2001 EN301489 1 EN301489 7 EN301489 17 EN300328 3GPPTS 51 010 1 ETSI EN301511 EN301511 EN60360 June 2001 EN50361 June 2001 EN50371 June 2001 This Class 2 Laser Product is in accordance with the requirements of IEC 60825 1 Ed 1 2 Clause 6 2 a R amp TTE Compliance Statement 802 11b g Bluetooth and
25. in the slot has completed charging 14 4 Using the Battery Analyzer Purpose Using the Charge Analyze slot helps you monitor the charge capacity of Li ion batteries over time Location The battery analyzer is located in the 4th slot named the Charge Analyze slot of the ChargeBase Only a battery placed in this slot can be run through an Analyze cycle This slot contains Battery Capacity LEDs along the right side Analyze Cycle The Analyze cycle is initiated when a battery is placed in the Charge Analyze slot and the ANALYZE button is pressed In an Analyze cycle batteries are completely discharged then recharged to capacity The length of time it takes for a battery to complete the Analyze cycle varies depending on the initial state of the battery s charge Minimum time is 8 hours maximum time is 12 hours Battery Capacity LEDs The Battery Capacity LEDs are located along the right side of the Charge Analyze slot Each LED equates to 10 battery capacity These LEDs display the capacity of the battery at the end of the Analyze cycle Battery capacity is displayed as a percentage of measured capacity rated capacity Status LED The Charge Analyze slot also contains a standard status LED in the upper left corner of the slot When this slot is used for regular charging this LED operates in the usual manner see Status LEDs on page 14 2 When this slot is being used to analyze a battery the Status LED functions as follows
26. information about Microsoft s GPS Intermediate Driver follow this link http msdn2 microsoft com en us library ms850332 aspx 10 2 GPS Demo The GPS Demo demonstrates the main functionality of the integrated GPS module The GPS Demo uses COM To see the GPS Demo tap Start gt GPS Demo For complete information about how to operate the GPS Demo refer to the Demos User s Guide for Windows Mobile 6 1 which is available for download from www honeywellaidc com 10 3 10 4 17 Dolphin HomeBase Device Overview As the hub of your Dolphin system the Dolphin HomeBase charging and communication cradle supports both RS 232 and USB communications which make it able to interface with the majority of PC based enterprise systems When a terminal is seated in the base its main battery pack charges in 4 5 hours Charge Time The base completes a full charge of the main battery pack installed in the terminal seated in the terminal well in 4 5 hours The base completes a full charge of the main battery pack in the Auxiliary Battery Well see page 11 2 in 4 hours Charging Process The base also provides power to the intelligent battery charging system in all Dolphin terminals that senses when a full charge has been achieved and switches to a trickle charge to maintain the full charge Communications Reliable data communications at speeds of up to 115k baud can be transmitted by the base through the RS 232 serial port Using
27. initial use Storing Batteries To maintain optimal battery performance follow these storage guidelines e Avoid storing batteries outside the specified range of 4 to 104 F 20 to 40 C or in extremely high humidity e For prolonged storage do not keep batteries stored in a charger that is connected to a power source Guidelines for Battery Pack Use and Disposal The following are general guidelines for the safe use and disposal of batteries e We recommend use of Honeywell Li lon battery packs Use of any non Honeywell battery may pose a personal hazard to the user e Replace defective batteries immediately using a defective battery could damage the Dolphin terminal e Never throw a used battery in the trash It contains heavy metals and should be recycled according to local guidelines e Don t use a battery in any other manner outside its intended use in Dolphin terminals and peripherals e Don t short circuit a battery or throw it into a fire it can explode and cause severe personal injury e Excessive discharge damages a battery Recharge the battery when your terminal indicates low battery power e If you observe that the Honeywell battery supplied is physically damaged in some way please send it to Honeywell International Inc or an authorized service center for inspection Refer to the Product Service and Repair section of this guide e Although your battery can be recharged many times it will eventually be deplete
28. o E o E CE CR E CERTO Downarow Voumesomn Pape own E sae a fest General Windows Keyboard Shortcuts Press these keys CTRL C CTRL X CTRL V CTRL Z DELETE CTRL Right Arrow Move the insertion point to the beginning of the next word CTRL Left Arrow Move the insertion point to the beginning of the previous word CTRL Down Arrow Move the insertion point to the beginning of the next paragraph CTRL Up Arrow Move the insertion point to the beginning of the previous paragraph SHIFT any of the arrow keys Select more than one item in a window or on the desktop or select text within a document CTRL A Select all CTRL ESC Display the Start menu Underlined letter in a command name on an open menu Carry out the corresponding command Backspace View the folder one level up in My Computer or File Explorer Overview System Settings Customized settings are available on the Start menu Tap Start gt Settings and settings screen opens displaying the Personal tab Settings consists of three tabs Personal System and Connections Personal Tab re Settings T rng A PE Fa Buttons Input Lock E Q Menus Owner Phone Information Gy iy Sounds amp Today Notifications System Tab re Settings a ny a K B About Backlight Certificates gr ap ph Clock amp Encryption Error Alarms Rep
29. on the screen gt Select the radio or radio combination and tap Apply The Radio Manager begins enabling your radio or radio combination 6 When enabled the Status field reads Success 9900 9950 9951 COM Port Assignment Table IrDA Serial Infrared SIR up to 115 Kbps Working with GSM Overview The Dolphin 9900 terminal can be configured with an integrated embedded GSM GPRS quad band radio module for WWAN communication GSM Short for Global System for Mobile communications GSM is an open non proprietary wireless WAN system that is constantly evolving and growing GPRS Short for General Packet Radio Service GPRS is a non voice value added service that allows packet switched data to be instantly sent and received across mobile telephone networks Note The 9950 and 9951 are not available with GSM Requirements Using GSM GPRS requires a e Network subscription to a GSM GPRS network you need to know what service providers are in your geographic area and e An installed SIM card that has been activated by the network service provider see SIM Card Installation on page 8 2 Quad Band Antenna The GSM radio features an external antenna that is optimized for power output and receiver sensitivity This is an omni directional antenna with zero dBm gain For the MC 75 radio there are two different antennas based on geographical location each supports two bandwidths Europe Supports 900 MHz and 180
30. operating You may need to reboot your workstation to complete the installation process Establishing ActiveSync Communication The Dolphin terminal is usually auto detected and configured by ActiveSync based on the communication cable If you are using an RS 232 cable ActiveSync will usually set up an RS 232 connection For more details see ActiveSync Communication on page 7 8 Connecting the Cables Connect the base to the host workstation or other device by plugging an RS 232 serial cable into the RS 232 Communications Port on the bottom of the base Plug the other end of the RS 232 serial cable into the correct port on the host RS 232 device The wiring of your cable depends on whether the other device is set up as a Data Communications Equipment DCE or Data Terminal Equipment DTE device The Communication Port is configured as a DCE device To communicate with a DTE device such as a workstation use a standard or straight through RS 232 cable To communicate with a DCE device use either a null modem adapter in line with a standard RS 232 cable or a null modem serial cable 12 7 RS 232 Pin Configuration Base Host Port DCE IBM AT DB9 IBM XT DB25 Modem DB25 DTE DTE DCE Pin Input Signal 2 RD 2 3 2 3 TD 3 2 3 5 SG 5 7 7 4 DTR 4 20 6 6 DSR 6 20 7 RTS 7 4 5 8 CTS 8 5 4 Refer to this table if you want to make your own cables
31. protector already installed You will need to replace the screen protector at regular intervals 1 After the current screen protector has been removed from the touch panel clean the touch panel thoroughly with a clean non abrasive lint free cloth Make sure nothing else is still attached to the touch panel 2 Align the exposed section of the protector with the bottom edge of the touch panel Make sure that the screen protector is flush with each side of the touch panel To reposition lift up gently and reapply 3 Press the screen protector firmly and carefully across the surface of the touch panel as you peel away the backing 4 If necessary smooth out any air pockets or bumps Healthcare Housing Some configurations of the 9900 terminal are available with an external plastic that is designed to resist the effecis of harsh chemicals in a healthcare environment The plastic is crystalline in nature which helps prevent chemicals from seeping through the housing Important The following cleaning solutions have been tested to assure safe cleaning of your terminal s disinfectant ready housing They are the only solutions approved for use with these terminals Damage caused by the use of cleaners other than those listed below may not be covered by the warranty e Sani Cloth HB wipes e Sani Cloth Plus wipes e Super Sani Cloth wipes e Isopropyl Alcohol wipes 70 e CaviWipes e Virex 256 e 409 Glass and Surface
32. slot charging station for 9900 9950 and 9951 Li ion battery packs The 4th slot features a battery analyzer that completely resets and re calibrates a battery and displays its resulting capacity For more information see Dolphin QuadCharger Device on page 14 1 Accessories for the 9900 9950 and 9951 Each of the following items is sold separately to enhance your terminal s capabilities Note When using accessories where the terminal is worn on the body the terminal s touch panel must face away from the body Dolphin Mobile Charger The Dolphin Mobile Charger is a charging cable that connects the terminal directly to a 12 Volt DC power source such as a Cigarette lighter port inside a vehicle eliminating the need for a cradle Intelligent battery technology on board the terminal ensures proper charging The Dolphin Mobile Charger is an ideal low cost charging solution for in transit mobile applications Dolphin Mobile Mount The Dolphin Mobile Mount which holds a Dolphin terminal securely in place inside a vehicle is an ideal low cost alternative to the Dolphin Mobile Base when communications are not required When used in conjunction with the Dolphin Mobile Charger the Dolphin Mobile Mount creates a complete mounting and charging solution for in transit applications The entire kit includes an adjustable vehicle mounting bracket Communication Charging Cables Dolphin communication charging cable kits are an all in one solu
33. the Windows Start Menu Programs folder For instructions about creating shortcuts see Using File Explorer on page 6 5 Additional Functions The Assign a program list also contains the following commands Command Description lt Input Panel gt Opens the soft input panel Command Description lt None gt Nothing happens when the button is pressed lt OK Close gt Performs the same function as tapping OK on the screen lt Scroll Down gt Scrolls down in the open application lt Scroll Left gt Scrolls left in the open application lt Scroll Right gt Scrolls right in the open application lt Scroll Up gt Scrolls up in the open application lt Start Menu gt Opens the Start menu lt Today gt Opens the Today screen Input The Input settings enables you to customize input from the SIP adjust word completion settings in Microsoft applications Input Method Word Completion Options Settings al nag Ts ok Settings a q Te M ok Settings fal en Ty lok Input Input Input Input method Keyboard Suggest words when entering text voice recording Format keyboard Letter Recognizer Suggest word s Default zoom level For writing 200 Space Transcriber Add a space after word Default zoom level For typing 100 Backspace n Enter Clear Stored Entries Capitalize First letter of sentence Enable Auto Correct Scroll upon reaching the last line Input Method Word Completion Input Method Word Completion Input Me
34. them in the future Installation Hardware Screw 3 16 in dia x 5 8 in long pan head screw Washer 1 2 in OD x 7 82 in ID x 3 64 in thick Nut 3 16 in dia Desk Mounting The DIN rail slot 7 5 X 35 mm on the bottom to allow for secure desk attachment of the unit if desired Serial and USB port location not in view Auxiliary Battery We DIN Rail 7 5 X 35 mm Slide the DIN rail slot along the bottom panel Then using the appropriate nuts and bolts secure the DIN rail to the desk or flat surface 11 10 Wall Mounting You can purchase a wall mount kit that contains e amounting bracket e three screws and e six washer nut sets The back wedge of the mounting bracket contains an open slot for the power and communications cables There is an extra space between this slot and the rear panel of the base to allow easy access to the power and communications ports For more details on both ports see Back Panel on page 11 3 To Mount Using the Wall Mount Kit 1 Attach the mounting bracket to the wall using the Recommended Hardware see page 11 11 2 On the base insert a screw into the round end of each screw slot on the bottom panel Then slide each screw towards the narrow end of the slot until it snaps in place Use a washer nut set on each of the three screws to secure the screw in the slot 4 Place the base on the mounting bracket match the holes up with the secured screws 5 Use the remaining washer n
35. 0 MHz bands North America Supports 850 MHz and 1900 MHz bands Signal Strength The signal strength of the GSM connection is indicated by the number of bars that appear in the signal strength icon in the Navigation bar at the top of the window DolphinWM ra Ty 4 lok WLAN OFF Icon Indicates The signal strength of the radio connection The signal strength of the phone voice connection see page 8 5 The signal strength of the data connection see page 8 8 Voice and Data Communication Dolphin terminals with integrated GSM GPRS radios are optimized for the following two way voice and data communications Voice GSM voice data dial up Data GPRS Class 10 Data transmissions average 40 60 Kbps available speed depends on the wireless network carrier You can use the GSM radio for voice communication and data communication but not at the same time If you want to communicate over the phone voice you cannot send data If you want to send data you cannot use the phone SIM Card Installation Short for Subscriber Information Module a SIM card stores the subscriber s personal information GSM GPRS radio settings security keys contacts etc SIM cards are installed in compatible mobile devices enabling you to switch devices without losing personal and setup information SIM Card Requirements Before installing the SIM card e The SIM card must be activated by the service provider e The termi
36. 0000 00000 I O Connector Front Panel Features for the 9900 9950 and 9951 Front Speaker The integrated speaker that sounds audio signals as you scan bar code labels and enter data The operating frequency range is 500Hz at 71 dB up to 80 dB I O Connector See I O Connector on page 3 12 Indicator LED The light emitting diode LED located at the top of the LCD display flashes and illuminates during resets and scanning imaging This LED can be programmed by various software applications Navigation Keys The centrally located navigation keys enable you to move and position the cursor through software programs The up and down arrows are programmed to perform specific functions when pressed in combination with the Blue and Red modifier keys For more details see Using the Navigation Keys on page 5 3 Recessed Keyboard There are three keyboard options 35 key numeric alpha keyboard 43 key numeric alpha keyboard and 56 key full alpha numeric keyboard For a complete overview of each keyboard see Using the Keyboards on page 5 1 SCAN Key The SCAN key is centrally located for easy access with the right or left hand When pressed the SCAN key activates the scanner imager The SCAN key also functions as an on or system wake up control for the terminal Touch Panel Display The color 3 5 inch liquid crystal display LCD touch panel is covered with an industrial protective lens for greater durability The video
37. Cleaner e Windex Blue e Clorox Bleach 100 e Gentle dish soap and water Batteries There are two types of battery power the main battery pack installed in the back panel and the backup battery located inside the terminal They are designed to work together to prevent data loss when the terminal is in use over long periods Both batteries must be completely charged before using a Dolphin terminal for the first time Main Battery Pack We recommend use of Honeywell Li lon battery packs Use of any non Honeywell battery may result in damage not covered by the warranty The 7 4V 18 5 watt hour Li ion battery pack is the primary power source for the terminal The Li ion battery is designed to operate in a temperature range of 10 to 50 C 14 to 122 F Charging Options When the Li ion battery is installed in the terminal use one of the following peripherals Dolphin HomeBase Device see page 11 1 Dolphin Mobile Base Device see page 12 1 Dolphin ChargeBase Device see page 13 1 Dolphin Net Base Please see the Dolphin Net Base Quick Start Guide on www honeywellaidc com Dolphin Mobile Charger When the Li ion battery is not installed in the terminal e Place the battery pack in the Dolphin QuadCharger device see page 14 4 e Place the battery pack in the Auxiliary Battery Well of the Dolphin HomeBase device see page 11 6 Charging Time The Li ion battery pack requires 4 5 hours to charge completely before
38. Dolphin terminal Dolphin HomeBase Device The Dolphin HomeBase device is a charging and communication cradle supports both RS 232 and USB communications which enable it to interface with the majority of PC based enterprise systems This device also contains an auxiliary battery well that charges a spare Li ion battery For more information see Dolphin HomeBase Device on page 11 1 Dolphin Mobile Base Device The Dolphin Mobile Base device is a charging and communication cradle is designed specifically for in premise and in transit data collection applications It features a flexible mounting bracket a cigarette lighter adapter or power cable to adapt it to your environment The serial connector supports RS 232 communication and power out to peripheral devices such as handheld scanners For more information see Dolphin Mobile Base Device on page 12 1 Dolphin ChargeBase The Dolphin ChargeBase is a 4 slot charging cradle that holds powers and charges terminals For more information see Dolphin ChargeBase Device on page 13 1 Dolphin Net Base The Dolphin Net Base is a 4 slot charging communication cradle that holds powers charges and communicates with terminals Ethernet communication occurs via statically and dynamically assigned IP addresses For more information about the Dolphin Net Base please consult the Dolphin Net Base Quick Start Guide Dolphin QuadCharger Device The Dolphin QuadCharger device is a 4
39. E 14 1 Parana F NCHONS eus tao ae aca ing E ad SUA a dun adasauaeent 14 2 SUPPIVIAO POW 6 Msaet ct ceeteenecscstadgosthactetguaeseqessavonhodeibonesctotencan astenisasoegeaas grees aenbedyiasiceseseweesicen 14 3 Inserting and Removing Battery Packs cccccceccsseeeseeeeeeeeseeeeseeeseeeeseeeesaeeseeesseeetaneenanes 14 4 onar BENGE eee eee er are O RN ee ee ee eee 14 4 Using the Battery Analyzer cccccccccsececseeeseeeeeeeeseeeseeeseeeese cess eesaeessaeeteeeeseeeteneeneeesaeeens 14 5 MOUNU s cescrsncrsers sects NR E RR RR RR RR RR 14 6 Desk Mounting erre ree ea reee arena ra aaa anca narra ae aa manera nana nana nana ana 14 6 WOM 6 6 a ING PRESSE RUDE EE DRE OR AD PR ER RR CD RR E RES RE 14 7 Troubleshooting erre erre aerea rena e anna anna aaa aan ra aan na nar nara nara na ananna 14 8 Chapter 15 Customer Support Product Service and REPAIl ccccseeccccssececeeeeecceeseecseseecsuneecseeeessegeeessuseeeseueeessueesesaeees 15 1 Online Product Service and Repair Assistance ii ereeesereerereneam 15 1 Technical Assistance eee rere rena eee era ee near er area enem ce acre er an erannnado 15 1 Online Fechinical ASSISIAN O sssssosassasas nisi adido Ea andes dna Dc riso qu 15 2 LMG Waranty o ER SR Do RR CARRO ORDER UDN OD NNE SPREAD 15 3 HOW to Extend Your Waranty ossessi niai dias wines adia sas dad 15 4 VII Vill Agency Information Dolphin 9900
40. Honeywell Dolphin 9900 Mobile Computers Dolphin 9900 Dolphin 9950 Dolphin 9951 with Windows Mobile 6 1 User s Guide Disclaimer Honeywell International Inc HII reserves the right to make changes in specifications and other information contained in this document without prior notice and the reader should in all cases consult HII to determine whether any such changes have been made The information in this publication does not represent a commitment on the part of HII HII shall not be liable for technical or editorial errors or omissions contained herein nor for incidental or consequential damages resulting from the furnishing performance or use of this material This document contains proprietary information that is protected by copyright All rights are reserved No part of this document may be photocopied reproduced or translated into another language without the prior written consent of HIl Web Address www honeywellaidc com Trademarks Dolphin Dolphin RF HomeBase Mobile Base and QuadCharger are trademarks or registered trademarks of Hand Held Products Inc or Honeywell International Inc Microsoft Windows Windows Mobile Windows CE Windows NT Windows 2000 Windows ME Windows XP ActiveSync Outlook and the Windows logo are trademarks or registered trademarks of Microsoft Corporation Other product names mentioned in this manual may be trademarks or registered trademarks of their respective
41. Images The image capture process is an intuitive split second operation for experienced users By following the basic guidelines new users can easily develop their own technique and with practice quickly learn to adapt it to different application environments Image Preview When the imaging process is initiated the touch screen displays a preview of the object This is a live video image of what the imager is currently viewing The live video image has a slightly degraded appearance compared to the captured image This is normal Scan Key On all 9900 terminals the SCAN key captures images On the 9950 and 9951 you can also use the Scan Trigger see page 3 7 File Formats Files formats supported for image storage include Bitmap BMP JPEG JPG and Portable Network Graphics PNG The default file format for images is a grayscale JPG Compression Digital images have a maximum image size of 640 x 480 pixels and may have up to a 256 grayscale image definition The image quality and related file size are determined by the data compression method used by the software application used to take images The average size of the image file is approximately 4 8K However the size of the image depends on the content of the image the more complex the content the larger the file size For the highest quality image take grayscale images Taking an Image The following steps are basic guidelines for taking images 1 Pointthe Dolphin term
42. In Serial4 Conn5Venable 1 Using the Touch Panel Honeywell defines proper use of the terminal touch panel as using a screen protector and proper stylus Screen protectors maintain the ongoing integrity i e prevent scratching of the touch panel which is why their use is recommended for applications that require a high to medium level of interface with the touch panel such as signature capture for proof of delivery Honeywell continues to advocate the use of screen protectors on all Dolphin devices We recommend implementing a screen protector replacement program to ensure that screen protectors are replaced periodically when signs of damage wear are noticeable For general use we recommend replacing the screen protector every thirty 30 days However replacement cycles vary according to the average level of touch panel use in your application Replacement screen protectors can be purchased directly from Honeywell Please contact a Honeywell sales associate for details Honeywell also mandates use of a proper stylus which is one that has a stylus tip radius of no less than 0 8mm Use of the Honeywell stylus included with the terminal is recommended at all times Honeywell warranty policy covers wear on the touch panel for the first 12 months provided that a screen protector is applied and an approved stylus is used for the 12 month duration covered by the warranty Installing a Screen Protector Dolphin terminals ship with a screen
43. JE m 1 Tap Start gt Settings gt Connection tab gt Connections connections 2 Under My ISP tap Add a new modem connection Enter a name for the connection Select Cellular Line GPRS as the modem and Tap Next ra Settings Alen ty Make New Connection Enter a name For the connection SEND GSM DATA Select a modem Cellular Line GPRS Cancel i 4 Enter the APN and tap Next se Settings Alert Mi SEND GSM DATA F Access point name TSP CINGULAR ms Back Fa Meit o 5 Enter the username and password from the account and tap Finish ra Settings Alen ty SEND GSM DATA User name ipdamcingulargprs com paganai Domain TF provided by ISP or network administrator Back ES Fith h 6 On the Connections window tap Manage existing connections The connection you just created should appear in the list on the modem tab si Settings l Al er Tl a ok My ISP F Tap and hold on an existing connection For more options SEND GSM DATA ISP CINGULAR General Modem 7 Tap and hold on the connection and select Connect on the popup menu E Settings Alen TI q lok My ISP F Tap and hold on an existing connection For more options TE OATA ISP CINGULAR Connect General Modern 8 The network icon in the navigation bar indicates the GSM radio is attempting to connect ei 9 When the connection is complete
44. Linear PDF417 UPC Data Matrix MaxiCode Working Range 3 5 in 3 1 in 2 1 in 2 3 in 3 1 in 2 0 in 8 9 cm 7 9 cm 5 3 cm 5 8 cm 7 9 cm 5 1 cm 9 in 13 2 in 10 2 in 8 8 in 13 0 in 19 3 cm 22 9 cm 33 5 cm 25 9 cm 22 4 cm 33 cm 5100 Smart Focus 5100SF 6 6 mil 7 5 mil 10 mil 10 mil 13 mil 15 mil PDF417 Linear Linear PDF417 UPC Data Matrix Working 017 cm 019 cm 025 cm 025 cm 033 cm 038 cm Range Near 2 7 in 2 4 in 2 1 in 2 1 in 1 9 in 1 7 in 6 8 cm 6 1 cm 5 3 cm 5 3 cm 4 8 cm 4 3 cm Far 5 9 in 6 4 in 7 5 in 7 5 in 8 8 in 7 4 in 14 9 cm 16 2 cm 19 cm 19 cm 22 3 cm 18 8 cm Available Laser Engines High Performance HP 5 mil 55 mil reflective Working Range Near 2 75 in 5 in 0 07 m 0 13 m Far 7 in 66 in 0 17 m 1 7 m Long Range LR 10 mil 100 mil reflective Working Range Near 11 in 60 in 0 28 m 1 5 m Far 24 in 240 in 0 6 m 6 1 m Advanced Long Range ALR 13 mil 100 mil reflective Working Range Near 19 in 125 in 0 48 m 3 2 m Far 39 in 360 in 1m 9 1 m Laser Specifications The maximum power outputs for each diode are as follows e Illumination LED 194 0 uW e Aimer laser 5300 engine 360 1 uW e Aimer LED 5100 engine 81 6 uW Supported Bar Code Symbologies Symbology Type Symbology Name 1D Symbologies
45. O DRDS RE EREE DT DR UE 3 18 Hard Reset Cold Boot erre erre eree nene een crer aa eren anna 3 18 SUSpPena 6 6 eee eee dns Sosa ee ne nee ee ee ee 3 18 Chapter 4 Using the Scan Image Engine WENE AD RR RR ts sas ce pastes DD T sauteed NI RSRS RR Bea RN ER 4 1 Angled IMAGINO keserken nE ENEAN a PRE REE cagada 4 1 Image Engine Specifications ssisecdievcateeneresdacexdl ented eeoerdenwudaanctanexdeacneensccwnnasedaieeehagietadeacesessee 4 1 Available Laser Engines cccccsccsseccesecssseecseeseeseeseeseseensseeeeeseuseseeseseeseesssseeseueensetseaeess 4 2 ASSP OS CICA ONS era E E E T E 4 2 Supported Bar Code Symbologies eee erereeaa ana ereeaa a eereenanana 4 3 SOC ONG pras e un MPR RR RR UR O RE RREO A OR RR RR sn 4 4 To Decode a Bar COGS eisai cicero ca ctannniiamsenannccondecinsceiedostanseosaimicteaeedosednnaenenssmasensmeneaAuiece 4 4 AMDI ODIO meaner mene Dq ee em ern oe nee ee Oe ee ND ey eer er ee en ee 4 5 Capung WINN AG CS aege e aE E EA EE EEE sean aeons Gaadeenenteavates isan estacuetunpocassmatanssenate 4 6 TANG am WAN AOS assassina donee E E EA E E E E E a xSacapewiantucessents 4 6 Uploading IMAC iria iria ag E 4 7 Chapter 5 Using the Keyboards PAV ONIN O IRC VO AS aasanasaraisniaa aE EA A EEEE AE Er 5 1 Keyboard CombinanoAS sesiirssi sesinin uia anaia aae i aia 5 1 COMMON BION areri en E E E Cape nasigesdiaiu s 5 2 Using ine FUNCION K OVS siesena AEE a a a 5 2 Using the Mo
46. R PR O E 6 8 lg ore cs SAR AR E RD 6 9 Ga VS TUNG casi cteceetatnsenewinn E E E A E 6 9 ROC EAI a ge A E E EET 6 9 PEACY PION ene A E eee 6 10 ENC REDONDO rerne E E E E n duce 6 10 mp4 21 gto GP er en eee ee ORE eee eee 6 10 MICO ga eras a Ga CR SA a 6 11 OW Sl oer e te sdcusencuare se aa da E DS 6 12 FAC COMMAS NOS PAP SRA RIR AN NO NR 6 13 Remove PIOGAMS qeapaso e seda a And Sa O Gg ernn e eneren 6 13 E EEE E ME RUN CERRADO RE DR SER E SR A AD 6 14 WAN HATO sir ess qiacineves E E sian simeneanersonacianees 6 15 Chapter 7 Communication COnnecuonS PAD as sousa posa o ld E Ca gi bd qa O ee ee ee a 7 1 USINA e IDA FON seser ert ten ere te rere err eet ee 7 2 FOA POR OC AVION i tctaaseteenoro uc ictawdncsucscareinesasacsneaceenniqes ia 7 2 Sending DATA acer a Sarees costs sn og eee sc eared E E 7 2 FS CO IVIFIGM DAE sets caeecaticgeeteaneeeentesciecaa E 7 3 Connections Manager sccccccsseeccceeececeeeececeueececeseeeseueeessaueeeseeeesseeeessaseeesageeessgeessaaes 7 4 To Access the Connections Manager eee renan ererenrena 7 4 TAS AD aaa terest E epa Si eq ir o sap oi ado sm ente 7 4 PRON UNG COE PAD casas soa Ladra EE T AD 7 5 Dolphin Wireless Manager 0 ccccccccseccseccneeceeseeseneenseeeeueeseeeesseeseesenseeseseessatensesseeeeneessnes 7 6 Dolphin Wireless Manager WINGOW ccccccceeeeseeeeeeeeseeeeseeeeeeeesseeeseessneeteeeaeeeseeeenes 7 6 EMI Me Radios senisesse Ear eiaa 7 6 Acces
47. S OF MERCHANTABILITY OR FITNESS FOR A PARTICULAR PURPOSE OR NON INFRINGEMENT HIPS RESPONSIBILITY AND PURCHASER S EXCLUSIVE REMEDY UNDER THIS WARRANTY IS LIMITED TO THE REPAIR OR REPLACEMENT OF THE DEFECTIVE PRODUCT WITH NEW OR REFURBISHED PARTS IN NO EVENT SHALL HII BE LIABLE FOR INDIRECT INCIDENTAL OR CONSEQUENTIAL DAMAGES AND IN NO EVENT SHALL ANY LIABILITY OF HII ARISING IN CONNECTION WITH ANY PRODUCT SOLD HEREUNDER WHETHER SUCH LIABILITY ARISES FROM A CLAIM BASED ON CONTRACT WARRANTY TORT OR OTHERWISE EXCEED THE ACTUAL AMOUNT PAID TO HII FOR THE PRODUCT THESE LIMITATIONS ON LIABILITY SHALL REMAIN IN FULL FORCE AND EFFECT EVEN WHEN HII MAY HAVE BEEN ADVISED OF THE POSSIBILITY OF SUCH INJURIES LOSSES OR DAMAGES SOME STATES PROVINCES OR COUNTRIES DO NOT ALLOW THE EXCLUSION OR LIMITATIONS OF INCIDENTAL OR CONSEQUENTIAL DAMAGES SO THE ABOVE LIMITATION OR EXCLUSION MAY NOT APPLY TO YOU All provisions of this Limited Warranty are separate and severable which means that if any provision is held invalid and unenforceable such determination shall not affect the validity of enforceability of the other provisions hereof Use of any peripherals not provided by the manufacturer may result in damage not covered by this warranty This includes but is not limited to cables power supplies cradles and docking stations HII extends these warranties only to the first end users of the products These warranties are non transferable The li
48. SB communication via ActiveSync which is wired communication Enables you to configure Wireless Zero Config This icon appears only if the 802 11b g driver is loaded on the terminal and the Honeywell WLAN Security Supplicant is not loaded By default the Wireless Zero Config is disabled and the supplicant is loaded This icon will appear only if you removed the supplicant and cold boot the terminal Note All server assigned IP addresses use Dynamic Host Configuration Protocol DHCP Using the IrDA Port Using the IrDA port you can send and receive data between the terminal and other devices equipped with infrared This can include but is not limited to Windows Mobile information such as Contacts and Tasks as well as software upgrades The maximum data transfer speed is 115 Kbps IrDA Port Location IrDA Port To send or receive the IrDA ports of both devices whether it s two terminals or a terminal and a host device must be aligned with each other and within a close range The maximum data transfer speed is 115 Kbps Sending Data 1 Align the IrDA ports 2 Open the program where you created the item you want to send and locate the item in the list You can also beam files but not folders from File Explorer 3 Tap and hold the item and select Beam File sE File Explorer Alen 1 x Cut Copy Rename Delete Send 9 15K Beam He Pace 4 The IrDA port searching for a rece
49. Spare Battery in the Auxiliary Battery Well on page 11 6 11 3 USB Port This USB Port is full speed and 2 0 compliant Using a USB cable you can connect the base to a peripheral device such as a workstation or printer When the terminal is seated in the terminal well it is connected to the peripheral device via the base The USB port on the base requires that you use ActiveSync 4 5 or higher RS 232 Port Use the 9 pin RS 232 cable from Honeywell to connect this port to a peripheral device for RS 232 data communication For more information see Serial Connector on page 11 5 DC Power Jack Use the power cable from Honeywell that comes with the base to supply power to this power jack For more information see Power on page 11 4 Power The terminal requires 9 5 Volts DC input for communications and battery charging the power adapter on the power cable converts the voltage from the power source to 9 5 volts DC Only the power adapter cable from Honeywell converts the voltage appropriately Honeywell recommends that you leave the base connected to its power source at all times so that it is always ready to use 1 Connect the power cable to the DC jack on the rear panel of the base 2 Connect the power cable to the power adapter 3 Plug the power adapter cable into the power source The base is now powered 11 4 Serial Connector The following diagram displays the pin diagram of the serial connector of the base a N O
50. abling the error reporting function of Windows Mobile 6 1 re Settings Error Reporting To help Microsoft improve the products you use Your device can collect information on software operation For later reporting in the event of 4 serious error Reporting this information when errors occur is completely voluntary and confidential ic Enable error reporting Cy Disable error reporting External GPS External GPS determines which port a third party GPS software application can use to access the GPS receiver E Settings aj ar Ty E GPS Settings Choose the port that programs will use to obtain GPS data Any program that uses GPS Will need to communicate with this port GPS program port Programs Hardware Access Note You need the installation parameters from the GPS manufacturer to configure the connection Memory The Memory system setting displays capacity and usage statistics for both RAM volatile and IPSM Storage Card non volatile memory Access this setting whenever you receive system messages about memory You cannot change the terminal s memory allocation in the Memory system setting To change the memory allocation you need to use the SetRAM Power Tool Start gt Power Tools gt SetRAM For more details please refer to the Honeywell Power Tools User s Guide which is available for download from www honeywellaidc com There are three tabs Main Storage Card and Running Program
51. an Installer An installer program is one that installs on the PC and the terminal simultaneously one process installs to both devices 1 On the PC double click the EXE or setup exe file The installation wizard begins 2 Follow the directions on the PC screen The installation process includes transferring the software to the terminal If the File is Not an Installer Some programs cannot be installed on PCs because they are designed for terminals In these cases the appropriate files must be stored on the host PC transferred via ActiveSync and installed on the terminal You will know the program cannot be installed on the PC if an error message appears when you try to install it stating that the program is valid but designed for a different type of computer 1 If you cannot find any installation instructions for the program in the Read Me file or documentation open ActiveSync and click Explore 2 Navigate to the My Pocket PC folder and copy the program file or files to the Program Files folder on the terminal e lf you want the program to be part of the Autoinstall that occurs after every hard reset place the program file in the Autoinstall folder My Pocket PC gt IPSM gt Autoinstall 3 Depending on the program you may need to open File Explorer on the terminal navigate to the folder where the program is located and tap on the program file to install it e If you copied the file to the Autoinstall folder you c
52. an either tap on the program inside the Autoinstall folder or perform a hard reset and the program will install as part of the Autoinstall process that occurs during each hard reset Remember a hard reset erases RAM data For more information see Hard Reset Cold Boot on page 3 18 After installation on the terminal is complete tap Start gt Programs and the program and its icon appears on the Programs screen Tap itto open the program Adding Programs Directly from the Internet When selecting programs verify that the program and version of the program are designed for Windows Mobile and your processor You can verify your processor by tapping Start gt Settings gt System tab gt About gt Version tab Make a note of the information in the Processor field 1 Determine your device and processor type so that you know which version of the software to install Tap Start gt Settings gt System tab gt About On the Version tab make a note of the information in the Processor field 2 Download the program to your device straight from the Internet using Pocket Internet Explorer You may see a single EXE or setup exe file or several versions of files for different device types and processors 3 Read any installation instructions Read Me files or documentation that comes with the program Many programs provide special installation instructions 4 Tap the file such as an EXE file The installation wizard begins Follow the directions
53. ances that could impact health and the environment if not properly disposed In order to avoid the dissemination of those substances in our environment and to diminish the pressure on the natural resources we encourage you to use the appropriate take back systems for product disposal Those systems will reuse or recycle most of the materials of the product you are disposing in a sound way Ed The crossed out wheeled bin symbol informs you that the product should not be disposed of along gt with municipal waste and invites you to use the appropriate separate take back systems for product disposal If you need more information on the collection reuse and recycling systems please contact your local or regional waste administration You may also contact your supplier for more information on the environmental performances of this product Pacemakers Hearing Aids and Other Electrically Powered Devices Most manufacturers of medical devices adhere to the IEC 601 1 2 standard This standard requires devices to operate properly in an EM Field with a strength of 3V m over a frequency range of 26 to 1000MHz The maximum allowable field strength emitted by the Dolphin terminal is 0 3V m according to Subpart B of Part 1 of the FCC rules Therefore the RF from the Dolphin terminal has no effect on medical devices that meet the IEC specification Microwaves The radio in the Dolphin RF terminal operates on the same frequency band as a microwave ove
54. andard serial cable and communications software Note There should only be one type of interface cable connected at a time either USB or RS 232 Requirements e A base powered by a power cable and power adapter cable e For RS 232 communications a serial cable e For USB communications a USB cable e ActiveSync v4 5 or above on the host workstation e Windows 98 Second Edition Windows Me Windows 2000 or Windows XP on the host workstation Note This base does not support Windows NT when using a USB connection because Windows NT does not support USB Windows 98 second edition provides full USB support Connecting the Communication Cables Note You must be using ActiveSync 4 5 or higher 1 Plug in the power supply and connect it to the back of the base Plug the USB or the RS 232 communication cable into the back of the base Connect the communication cable into the back of the workstation gt i N At this point the hardware is installed and operating You may need to reboot your workstation to complete the installation process Establishing Communication USB or RS 232 communication with the terminal is usually auto detected and configured by ActiveSync based on the communication cable If you are using a USB cable to connect to the workstation ActiveSync will usually set up a USB connection If you are using an RS 232 cable ActiveSync will usually set up an RS 232 connection For more details see ActiveSy
55. ap Talk or use the keyboard s Phone Al i mir de x Cingular i Dialing 1 803 835 8170 pm Speaker On Mute Hold Note Contacts ta End Keypad Menu Note The ll icon indicated that the phone is in use Ending Calls While the phone call is live tap End or use the physical keyboard Keyboard Combinations for Calls Keyboard To Send a Call Press To End a Call Press 43 key keyboard Blue NUM Blue ENT 56 key keyboard Blue SFT Blue ENT View Options Tap Menu gt View rig iE Open Speed Dial pqrs z E Calls and Contacts o s All Calls Speed Dial Setup Options Tap Menu gt Options Open Speed Dial Options The Phone Settings tab windows appear Phone Tab A er Yy 4E ok Phone 1 704 502 4390 e Settings Sounds Ring type z Ring tone Ring WindowsMob gt Keypad Short tones hd Security C Require PIN when phone is used Change PIN Establish or change a PIN on the Phone tab TA T 2 Cingular T Settings Enter PIN 3 attempts remaining 1 PE BcA Clear ati Bil mo ae oro e 7 pars ret pa p fee Services Tab Settings Phone To access settings For a service select it From the Following list and tap Get Settings voice Mail and Text Messages Fixed Dialing Get Settings Phone Services Meturork For each service the phone will read se
56. application in use Sticky Key Functionality Sticky key functionality is supported for the CTRL key which means that you don t have to press and hold the CTRL key when you press the next key Instead just tap CTRL and then the next key You need to open RegEdit and enable the AHKEY LOCAL MACHINEIHARDWAREIDEVICEMAPIKEYBD key i gT pa as TH 1 Tap Start gt Power Tools gt RegEdit Regedit 2 Tap the sign Tap HKEY LOCAL MACHINE gt HARDWARE gt DEVICEMAP gt KEYBD i os Regedit x oF q2 12 45 Dk ControlPanel Drivers Explorer ExtModerns HARDY ARE DEVICEMAP ab Keyboard Layout D Keyboard Funct D Keyboard SUBT keyboard Type Crivername 4 Inthe bottom half of the window double tap the StickyCtrlAIt key and change the Value Data from O to 41 o i RegEdit x oF d 12 46 ControlPanel Drivers Tap OK then OK in the upper right corner to save the change to the registry Press the CTRL key combination with other keys to verify that you do not need to hold them down while you press the next key For an example of CTRL key combinations see General Windows Keyboard Shortcuts on page 5 14 35 Key Alpha Numeric Keyboard Power key SCAN key Navigation keys __ Escape key Backlight Esc Tab key Shift o me Enter ke E s y Space key Backspace key Alpha key Delete key CTRL Blue Red ALT Modifier ke
57. as E A dia Peas ETA os aah de a e a e 8 7 OMA MC AMO corados ida acena iai read nb asd ru pu uia 8 8 Establishing Data Communication ee erer err erenane e eranana era ananrrranna 8 8 Ending the Data COMMESCUON isincsssucoctoeninaessageiathencasgsncutauuiesiecauhandtie aeianhdeuiinetwbbaumiimeoisaue 8 10 ROAMING sscnoanaptsnesdadendusdaoutsenagnubadecaiteanamasananiestadbequciaatetsiameessteeigsatsenastnpinwceseneadesassnesiudseeteenas 8 11 Chapter 9 Working with the Bluetooth Radio Enabling the Bluetooth Radio recorrer rerere error erteacrerenenteac nero neneracnetado 9 1 Connecting to Other Bluetooth Devices i eee eeren ae rereranaanna 9 2 Pairing and Trusted DEVICES uaras atas Rosa paca Eta TC RSRS 9 4 Types Of Devices and Services eee eeerererer an aerea aerea eren ecran creaaaceen o 9 5 Connecting to Bluetooth Printers eee eereee er erreree as errenen a erenanaaana 9 6 Connecting to Bluetooth Headsets cccccssccccccseseceeceesseeeeseeseceeseeseeeesseaeeeeessasseesnsaseeees 9 6 PAINTS GENIN To NOS RR q A AEE 9 7 Making the Terminal Discoverable errar rere aa rraaa eae arena nananana 9 8 CISCO CON OMG asas escvcmys E O 9 8 Chapter 10 Working with GPS USO sas esa eps GUS pete ca tes nace ssc aie eae SC GR tea ote 10 1 Assisted GPS SUDDOM sesiicsiiinsudiaanddirasddawlsbiuesbosoasasancdsaencd senteeansdecisdeugesmnaniduaanioeniteneia
58. attery pack is completely discharged or removed Before Initial Use Terminals are shipped with both batteries discharged of all power Charge the main battery pack for a minimum of 4 5 hours before initial use Time to Charge 4 5 hours for the main battery pack 8 hours for the internal backup battery the first time Connect the terminal to one of the 9000 series charging peripherals to charge see Peripherals for the 9900 9950 and 9951 on page 3 2 We recommend use of Honeywell peripherals power cables and power adapters Use of any non Honeywell peripherals cables or power adapters may cause damage not covered by the warranty Step 3 Boot the Terminal The terminal begins booting as soon as power is applied and runs by itself Do NOT press any keys or interrupt the boot process Only tap the screen when prompted When the boot process is complete the Today screen appears and the terminal is ready for use Note Because the Today screen appears a number of times during the boot process wait a few seconds before tapping anything on the Today screen Step 4 Set the Time and Date You need to re set the time and date after every hard reset of the terminal It is a good idea to set the time and date now before you begin using the device On the Today screen tap the line that displays the time and date is Start Alen 4a Wednesday 5 57 AM January 16 2008 The Clock Settings screen appears se Settings al en T
59. callout see Back Panel Features for the 9900 9950 and 9951 on page 3 9 Back Panel Features for the 9900 9950 and 9951 Battery Well The Battery Well is a recessed area on the back panel that holds the Li ion battery pack For more information see Batteries on page 3 15 Fastener for the Stylus Tether Stylus tethers can be purchased separately to help you keep the stylus attached to the 9900 when not in the slot to prevent loss A stylus tether is a coiled elastic cord with one end to attach to the stylus and another to attach fasten to the back panel Image Scan Engine Window The available image engines read and decode linear stacked linear e g PDF417 and 2D matrix bar code symbologies The available laser engines contain a laser aimer for greater accuracy The laser apertures for the laser aimers for both the image engines and the scan engines are contained behind this window For more details see Using the Scan Image Engine on page 4 1 Microphone The integrated microphone that provides audio input to the terminal when a headset is not plugged into the Audio Jack page 3 10 When a headset is plugged in the terminal defaults to the microphone on the headset Rear Speaker The integrated speaker that sounds audio signals as you scan bar code labels and enter data The operating frequency range is 500Hz at 71 dB up to 80 dB Stylus Slot The stylus is used to operate the touch panel The back panel features
60. d Replace it after the battery is unable to hold an adequate charge e If you are not sure the battery or charger is working properly please send it to Honeywell International or an authorized service center for inspection Internal Backup Battery Located inside the terminal the backup battery is a 3 6 Volt nickel metal hydride NiMH battery The internal backup battery prevents the terminal from being reset if you need to remove and replace the main battery pack It retains RAM data and allows the real time clock to remain operational for up to 30 minutes when the main battery pack is removed If the terminal is left without the main battery pack for more than 30 minutes the internal backup battery needs to be recharged to function according to its specifications Note Data and programs stored in Flash memory are not lost even if the internal backup battery fails However you must reset the real time clock see Set the Time and Date on page 2 2 Charging The internal backup battery is powered by the main battery pack Therefore charging the internal backup battery requires that the main battery pack be installed in the terminal and the terminal be connected to a charging device The internal backup battery must be fully charged before using the terminal for the first time The initial charge cycle takes approximately 8 hours After that if the internal backup battery becomes fully discharged of power it requires a minimum of 10 hou
61. daesss 10 1 Powering the GPS Module cccccccsseeeeceeeeeeceeeeeceeeeeeceeeeceeeeesseeeeesseeeeeseeeeesseeeesaeees 10 1 Communication Ports aaa arara aaa arara 10 2 Selecting the Port erre ereren e rer ana er eee erenaa rrenan cneeaacenen ernennen 10 2 ON ac RR OR RN ODDS DRI RD 10 2 GPS Intermediate Driver rara aaa rara 10 2 CRS DEMO jante oii a E a enon 10 3 Chapter 11 Dolphin HomeBase Device VEIO E ag cc tens E E E secs E dead ene ecoseteeaactea sa 11 1 Pans and FUACUONS virco cca oa teccecatinntisscaeeedetweceasasneaetauenawosebamsedaceunstdatmapos nen gasbenaceaiobueesseaedeaus 11 2 FOO sate a esse eect tele a a ee acts et ses ceca eae ES 11 4 Serial SOM Cl ON ae asas aro dann fier i ciactasinna E edson ad has ga mada 11 5 Charging he Main Batel ssnipe e DE SSI CO EDULIS oie S Sa 11 6 To Power a Terminal and Charge its Main Battery eee 11 6 Charging a Spare Battery in the Auxiliary Battery Well ccccccseeeeeeseeeeseeeeeeeees 11 6 COMUNA O PAR DR ERR SR RED RO SE PER O 11 7 Connecting the Communication Cables ccccccccsseeeeeeeeeeeceseeeeeeeeeeeeeeeeeseaeeeeesaenes 11 7 Establishing Communication erre erere eae eren an erenaerena nn erenanrenna 11 7 vi Communicating with the Dolphin Terminal e eee eee 11 7 Verifying Data Tranio eira 11 8 RS 232 Communications Cables ccc eeccccseeceeceeeeeceeeeeeceeeeecee
62. ded image taking and or bar code decoding SCAN Key Space SP Moves the cursor one space m jg Moves the cursor to the next tab stop or the next control on a form Using the Modifier Keys Mme rey The SFT key modifies only the next key pressed it must be pressed before each key you wish to modify SFT toggles the keyboard between uppercase alphabet mode and lowercase alphabet mode Double tap SFT to toggle Caps Lock on and off When Caps Lock is toggled on characters are uppercase when toggled off characters are lowercase CTRL The function of the CTRL key depends on the software application in use and the key combination Blue and The blue and red keys are used in combination with other keys to type special Red characters and perform system functions Each key modifies only the next key pressed The overlay of each keyboard is color coded to indicate the character typed or function performed when specific keys are pressed immediately after the blue or red modifier key Using the Navigation Keys Located in the center of each keyboard for easy access with either hand the navigation keys navigate the cursor through application screens Moves the cursor up one row or line OR Moves the cursor down one row or line Raises the volume Lowers the volume Moves the cursor one character to the right Moves the cursor one character to the left Note Additional functionality varies according to the
63. ded life main battery 2500mAh extended life main battery Adaptus Imaging Technology 5100SR SF Adaptus Imaging Technology 5100SR SF or 5300SR SF image engines or 5300SR SF image engines 802 11b g and Bluetooth e 802 11b g Bluetooth and GSM GPRS WPAN amp WWAN with GPS Microsoft Windows Mobile 6 1 Professional Intel XScale PXKA27x 624 MHz 256MB RAM X 1GB Flash Three in mold hard top keyboard options 2500mAh extended life main battery Adaptus Imaging Technology 5100SR SF or 5300SR SF image engines 802 11b g Bluetooth and GSM GPRS GPS Some configurations of the 9900 terminal are available with an external housing made of plastic that is specifically designed for the healthcare industry For more information see Healthcare Housing on page 4 Standard Configuration for the 9950 Microsoft Windows Mobile 6 1 Classic Intel XScale PXA27x 624 MHz 256MB RAM X 1GB Flash Three in mold hard top keyboard options 2500mAh extended life main battery Adaptus Imaging Technology 5100SR SF or 5300SR SF image engines 802 11b g and Bluetooth Standard Configuration for the 9951 Microsoft Windows Mobile 6 1 Classic Intel XScale PXA27x 624 MHz 256MB RAM X 1GB Flash Three in mold hard top keyboard options 2500mAh extended life main battery Laser scan engines HP LR and ALR 802 11b g and Bluetooth Peripherals for the 9900 9950 and 9951 Each of the following items is sold separately to enhance the capabilities of your
64. difier Keys aci een molaheniennatanenieaataenendeonaie 5 3 Using the Navigation Keys cccccscccssecssecenseceeseeseeeenseeeeueeseeseseeseeeensesssaeetsneesseesegeenaessees 5 3 DUCKY Ky FONCION aeres E E 5 4 35 Key Alpha Numeric Keyboard ccccseeecccseeeecceeeeeceeeseeceueeeseeueeecsaueeessaeeessageesssneeesaaes 5 5 35 Key Keyboard Combinations e reeeerreererena errar errar a erenan era 5 6 43 Key Alpha Numeric Keyboard ccccceccccseeececeeeeecaeeeeeceeeeeeseeeeseeeeeessaeeeesaeeesseneeesaeees 5 8 43 Key Keyboard Combinations e eerereeeeeerena errar errar eren anne 5 9 56 Key Full Alpha Numeric Keyboard oun eecccseeecccseeececeeeeeeceeeeeseaeeeeseeeeeeseaeeeseneeessegeeeeas 5 11 56 Key Keyboard Combinations eee ererena errar errenaerenannna 5 12 General Windows Keyboard Shortcuts cccccccsseeececeeeeeceeeeeeceeeeesseuseeseageeesegeeessegeeeeas 5 14 Chapter 6 System Settings rast ce RED RR SD RR PR RR RENNES NEN DR PEDERNEIRAS 6 1 Personal Tab iiincuieaencduauetnnwndt savstneuchrauednanscaamenticwsdiosin howe iuubauedbuenpivahabsunsdeacxanevenbaimesiuaesdmeushios 6 2 PUTON a ees ott ca ee nc ees eat Di aa ce atte Sd da a CR OU etsnaeanes 6 3 PI a RO RSRS RD RENDENDO ERROR DR RAR RR E 6 4 ICMS perna ento coradas E E rd id da si dan a a 6 5 OS LN US epi 6 7 ADOT smp iso Ran sad enced E SD O a 6 8 BAC FC OIINE GRADO qa MANN O CR A RN 7 RR RR RR ER U
65. eeeseeeeeeeseeeeseeeessseeeesaeees 11 9 Roe I COG UO enna areia pote tada de EA EE T E 11 9 MODU eea E E EE E 11 10 DESK MOUNU oea r mer nemckonuoledl 11 10 W NOG eeraa E E E E EE EE 11 11 Chapter 12 Dolphin Mobile Base Device NENION oiriin ro IRIS E E eee E ee ee ee 12 1 Fr GONE Tr UNC E E E E E E E E A E E E 12 2 POLON E aN epea a E R E nant catnigesaibelan ema ceanenniasdinaeien Gameamannacaeer 12 3 Powering the Dolphin Terminal cccccccesccceeeeeceseeeeseeeeeeeeseeeseeeseueeseeeeseeesaeeeseessaeesaaes 12 4 Charging the Dolphin Terminal eee era errar eren encena nanreena 12 4 MOGN Pe om E RR ER 12 5 FONO sexiest spencn asain tale sare tlacnanieunatadtne A E E E 12 6 Establishing Communication cxcsecnaccscscancdscesvecestlendscucedenasdneseawddawitedtduelanieciasvcciestsccepecesdonet 12 7 Connecting the Communication Cables cccccccccsseeceeeeeeeeeeeeeeeeeeseeeeeeeesseeaeeeesaeaes 12 7 Establishing ActiveSync Communication eee renan arena 12 7 Chapter 13 Dolphin ChargeBase Device OVO IME spa isa ensaiado aa a 13 1 FANS Ana FOUN CONS eea iara ligada ndo SaGec UR ada do ani ans do sic nada dei ig 13 2 UD VAI FF 0 en RD E RE RO E 13 3 Inserting and REMOVING Terminals erre rerererereenereren ente ac reracrerenenena 13 4 FV WINE Ty MIAN AAG e RR RR PR E RE RR ant encaaidonks 13 4 MOUNU eee pg O ASA Sad A 13 5 Chapter 14 Dolphin QuadCharger Device O sig is A
66. ence including failure to follow the proper maintenance service and cleaning schedule or iii damaged as a result of A modification or alteration by the purchaser or other party B excessive voltage or current supplied to or drawn from the interface connections C static electricity or electro static discharge D operation under conditions beyond the specified operating parameters or E repair or service of the product by anyone other than HII or its authorized representatives This warranty shall extend from the time of shipment for the duration published by HII for the product at the time of purchase Warranty Period Any defective product must be returned at purchaser s expense during the Warranty Period to HII factory or authorized service center for inspection No product will be accepted by HII without a Return Materials Authorization which may be obtained by contacting HII In the event that the product is returned to HII or its authorized service center within the Warranty Period and HII determines to its satisfaction that the product is defective due to defects in materials or workmanship HII at its sole option will either repair or replace the product without charge except for return shipping to HII EXCEPT AS MAY BE OTHERWISE PROVIDED BY APPLICABLE LAW THE FOREGOING WARRANTY IS IN LIEU OF ALL OTHER COVENANTS OR WARRANTIES EITHER EXPRESSED OR IMPLIED ORAL OR WRITTEN INCLUDING WITHOUT LIMITATION ANY IMPLIED WARRANTIE
67. ettings ler Aj ok Bluetooth Tap Odd new device to search For other Bluetooth devices Tap on a device to modify its settings Add new device Devices 2 Tap Add new device The terminal begins searching for discoverable Bluetooth devices re Settings Select a Bluetooth Device Searching for Bluetooth Devices JB HANDHELD ADGEES Me DRONAMRY MS LINNE pe Chris A s 3 Select a device in the list and tap Next r Settings Select a Bluetooth Device Select a device to connect with and tap Next me BURMEISE IDOOOOO0000000 Cancel 4 You are prompted to enter a passcode r Settings Enter Passcode F Enter a passcode to establish a secure connection with CARYM If the device has a specific passcode enter it in the Passcode field and tap Next If the device does not have a specific passcode enter one in the Passcode field and tap Next The Bluetooth radio tries to connect with the device r Settings Enter Passcode F Enter a passcode to establish a secure connection with CARYM e9 5 If you created a passcode you will be prompted by the other device to enter the same passcode Enter the created passcode to establish a paired connection If you entered a the passcode from the device you shouldn t have to do anything on the other device 6 When the connection is complete a list of matching and supported services on the device ap
68. ha mode is when you type letters with the letter keys Numeric mode is when you type numbers with the letter keys On the 43 key keyboard alpha mode is the default Toggling Between Alpha and NUM Lock Modes Press the NUM key only once to switch to NUM lock mode The NUM Lock Indicators above the letter keys in the NUM Lock Pad specify the number or character that will be typed when you press that letter key in numeric mode Note The NUM key is also used to perform a soft reset in combination with the CTRL key 43 Key Keyboard Combinations eop COR p po F 5 C CS CI CI TT RR E MR E o Pl RR CR CR O RR E CI TT RR I E Eo Ce E cmo dl CO COR e CO E ED COR E E CE eo e p p E CE imas o o er TT ivi x x CORA ERA COR AC a EC foa smo O r CC wwo o Ju Ju oe Pei lt lt i 43 Key Keyboard Combinations een on Shift Shift Shift Send a phone call yp 56 Key Full Alpha Numeric Keyboard SCAN key Navigation keys ape BB Tab key Ho on Enter key a Power key Backlight key Shift key o t Insert key Space key Backspace key Delete key 0000 0000 Covo ooo 00000 0000 0 0000 T exo OO E O CTRL Blue Red Modifier keys 56 Key Keyboard Combinations Pe o fee semi colon F2 CR E F10 Ce ee Cs traem He e O RR LI D FO e a Lo js a 56 Key Keyboard Combinations CR
69. ight for the color display is user defined Tap Start gt Settings gt System tab gt Backlight si Settings T er Tx m ok Backlight Warning Using backlight while on battery power Will substantially reduce battery life Turn off Backlight iF Turn on backlight when a button is pressed or the screen is tapped Battery Power External Power Backlight There are two tabs The Battery tab determines the backlight timeout when the terminal is running on battery power The External tab determines the backlight timeout when the terminal is running on external power The options on each tab are the same Turn off backlight Select how many minutes you want to elapse before the backlight automatically turns off Turn on backlight Select this option if you want the backlight to turn on when the a button is pressed or the touch screen is tapped Backlight Intensity Tap the Backlight tab and move the slider to set the intensity of the backlight The default is 8 Certificates Certificates shows you which certificates are recognized by the operating system ra Settings fal gr Tx ok Manage Certificates Use root certificates to positively identify root certification authorities Issued By Expires Thawte Server CA 12 31 20 Thawte Premium Serv 12 31 20 Starfield Class 2 Certif 6 29 2034 Secure Server Certifico 17 10 http valicert c 6f25 19 GTE CyberTrust Globa 6 13 18 Go Daddy Class 2 Certi 6
70. iles on page 9 7 Types of Devices and Services When you tap Add new device on the Devices tab the Bluetooth radio scans for discoverable Bluetooth devices in range which are Bluetooth devices that have been made discoverable Device Types The types of devices in the vicinity of the radio appear in the list of ____ discovered devices ME HANDHELD ADGEES E 1007001F0003 E BURMEISK ap PicoBlue_8003ee 10 16 2 44 DAVTSIA Supported Services Only the services that are mutually supported on both devices appear on the Partnership Settings window Settings Partnership Settings Display Name CARY Select services to use From this device Wireless Stereo Serial Port Dialup Networking Headset Connecting to Bluetooth Printers as ue SO oS Se S N Make sure the Bluetooth printer is in range and set to be discoverable by other Bluetooth devices Look up the Bluetooth printers broadcasted ID Perform a device discovery Tap Settings gt Connections gt Bluetooth gt Add new device Look for the Bluetooth printer s broadcasted ID in the list of discovered devices Click on the Bluetooth printer s ID and wait for the prompt to enter a Passcode Enter the Passcode and tap Next The passcode may default to either 1111 or 0000 If there is no default consult the printer literature for the number Select a printing related service in the list of services Tap Finish to establ
71. inactive for a programmed period of time You can program this time on the Advance tab of the Power system setting see Power on page 6 12 To put the terminal into suspend mode manually press the Power key and the screen goes blank To wake the terminal from suspend mode press the Power or SCAN keys Ep Hardware Maintenance When needed clean the image engine window and the LCD display with a clean non abrasive lint free cloth The terminal can be cleaned with a damp cloth 4 Using the Scan Image Engine Overview The Dolphin terminal houses a compact image engine that instantly reads popular 1D and 2D bar codes and supports omni directional aiming and decoding for greater flexibility in real world settings The image engine can also capture digital images such as signatures and pictures of damaged inventory With the latest CMOS based technology the engine works like a digital camera and enables digital image capture signature capture and reading of OCR characters Angled Imaging All imager are installed at a 33 degree downward facing angle for enhanced comfort and maneuverability while scanning Image Engine Specifications Engines 5100SR SF Image Capture Aiming Pattern Omni Directional Aiming 5100 Green Aiming Beam page 4 5 5300 Red High Vis Aiming Pattern page 4 5 5300SR 5100 Standard Range 5100SR 5300 Standard Range 5300SR 8 3 mil 10 mil 13 mil 15 mil 35 mil
72. inal directly at the object The imager points straight out the top panel 2 To preview the image press and hold the SCAN key 3 The touch screen displays a preview of the object and the decode and scan LEDs light red 4 Adjust the terminal s position until the object appears on the screen the way you want it to appear in the image 5 Hold the terminal still and release the SCAN key or Scan Trigger The scan and decode LEDs flash red the screen flashes and the captured image appears on the screen 6 Unless otherwise specified by the application in use the image is saved to the My Device My Documents folder Start gt Programs gt File Explorer gt My Device gt My Documents Enabling the Aimer If your Dolphin terminal is configured with the 5300 imager you can enable the aiming pattern for imaging in the Imaging Demo For details about the aimer see 5300 Red High Vis Aiming Pattern on page 4 5 1 Tap Start gt Demos gt Imaging Demo gt Setup menu gt Aimer Aimer w Illumination Port Config w Sound Trace Mode File Image Setup Help 2 The aiming pattern is now enabled for imaging Uploading Images Image files can be uploaded to a host workstation via Microsoft ActiveSync and a Dolphin communication peripheral or your wireless radio connection Using the Keyboards Available Keyboards There are three keyboard options in the 9900 series ee lt gt 2 ND END
73. ion e Serial cable for RS 232 communication Software Requirements for Communication e To sync successfully ActiveSync v4 5 or higher must be configured for same communication type on both the host workstation and the Dolphin terminal ActiveSync must be setup on your workstation before you initiate synchronization from the terminal for the first time e Windows 98 Second Edition Windows Me Windows 2000 Windows NT 4 0 SP6 or higher Windows XP or Windows Vista operating systems Setting Up the Host Workstation Verify that ActiveSync is configured to use the appropriate communication type by clicking File gt Connection Settings For USB communication check For RS 232 communication Allow USB connections connect to COMA e Connection Settings e Connection Settings Device connected Device connected lw Show status icon in taskbar lw Show status icon in taskbar li Allow USB connections Allow USB connections jw Allow connections to one of the Following jw Allow connections to one of the Following Ps Note You can have both USB and RS 232 selected in the software without affecting processing However your hardware setup should use only RS 232 or USB not both Communicating with the Dolphin Terminal After setting up both the workstation and the terminal ActiveSync connection should be automatic 1 Connect the Dolphin terminal to a Dolphin communication peripheral 2 The Dolphin terminal auto
74. ish the connection on the terminal Complete any additional steps required by the printer Connecting to Bluetooth Headsets as oo oF oe 00 ID N Make sure the Bluetooth headset is in range and set to be discoverable by other Bluetooth devices Look up the headset s broadcasted ID Perform a device discovery Tap Settings gt Connections gt Bluetooth gt Add new device Look for the headset s broadcasted ID in the list of discovered devices Click on the headset s ID and wait for prompt to enter a passcode Enter the Passcode and tap Next The passcode may default to either 1111 or 0000 If there is no default consult the printer literature for the number Select Headset in the list of services Tap Finish to establish the connection on the terminal Complete any additional steps required by the headset Transferring Files 1 Tap Start gt Programs gt File Explorer 2 Navigate to the file you want to transfer 3 Tap and hold on the file and select Beam File on the popup menu 4 The Bluetooth radio begins searching for devices 5 Tap the device to begin sending the selected file 6 While trying to connect the selected device reads Pending I File Explorer IPSM DeviceConfig EjDeviceConfig EA EZConfigMenu 3 E2ConfigPPC igi ImageDemo Es Imagi Cut ian Netwec Copy lige Powe RAS ey RegBa fea Scant Delete Send
75. iving IrDA port in the vicinity The selected device reads Pending 2 PowerToolsInto txt To beam select a device 5 When the IrDA port finds the aligned IrDA port it immediately starts sending the selected file The selected device reads Sending File Explorer 2 PowerToolsInto txt To beam select a device Unknown device Sending 1 1 A Unknown device Tap to send 4 PicoBlue 8003ee 1 Tap to send fe a TRI TAP Tu lo emm 6 When the file transfer is complete the selected device reads Done amp PowerToolsInto txt To beam select a device Done Unknown device Tap to send lt 8 PicoBlue_8003ee 1 Tap to send Receiving Data The Beam Setting must be set to receive for the terminal to receive data from other infrared devices 1 Verify that beam settings are set to receive Tap Start gt Settings gt Connections tab gt Beam The Beam Settings window should appear as follows si Settings Beam Receive all incoming beams Align the IrDA ports Have the owner of the other device send the information to you Your terminal automatically begins receiving it Ye w N A popup message appears asking if you want to receive the incoming file Receiving Data Do vou want to save SysInfo Ext to your device 6 Tap Yes to receive the file Connections Manager Microsoft s connection manager sets up multiple network connecti
76. k installed in the terminal seated in this well in 4 5 hours Auxiliary Battery Well See Auxiliary Battery Well on page 11 3 DOCK LED Turns solid green when the terminal is properly seated in the base AUX Battery LED Indicates status of the battery charging in the auxiliary battery well see Back Panel on page 11 3 This color means Orange The auxiliary battery is charging Green The auxiliary battery has completed charging and is ready for use For information about charging a battery in the auxiliary battery well see page 11 6 11 2 COMM LED This is the communication LED It indicates the status of data transfer between the Dolphin terminal and the host device The color of this LED differs if the base is using the serial or USB port connection If using the serial port This color means Red Serial data is being sent from the host device to the base Green Serial data is being sent from the base to the host device Orange Serial data is being sent at high data rates If using the USB port This color means Green LED A USB Connection is established with the host workstation Back Panel Auxiliary Battery Well USB Port RS 232 Port DC Power Jack Auxiliary Battery Well The base enables you to charge an additional Li ion battery pack independently of the terminal well in 4 hours This feature ensures that you can always have a fully charged battery for your terminal See Charging a
77. l COM port which is COM7 or the GPS Intermediate Driver Which method you use depends on the software application you are using If the software application requires the actual COM Port set the operating system to use COMY If the software application requires the GPS Intermediate Driver set the operating system to use the GPS Intermediate Driver Selecting the Port 1 Tap Start gt Settings gt System tab gt External GPS 2 Inthe GPS program port drop down list select COM7 or GPD1 the GPS Intermediate Driver as required by the application re Settings GPS Settings Choose the pork that programs will use to obtain GPS data Any program that uses GPS Will need to communicate with this port PS program port Programs 3 Tap OK to save COM7 COM Port 7 can be set to the following baud rates e 4800 e 9600 This is the default baud rate and recommended for optimal GPS functioning e 19200 e 38400 Other baud rates are not possible The baud rate selected on COM7 is the actual baud rate with which the GPS will be communicating GPS Intermediate Driver When the first user of GPD1 opens the port the GPS Intermediate Driver in turn opens port COM7 The GPS Intermediate Driver allows multiple applications to open GPD1 and the GPS data is broadcast to all open poris When the GPSID driver is in use the COM7 port is allocated to GPSID as READIWRITE COM7 is still available for access mode of 0 For more
78. ld always be performed with a stylus designed for touch panel applications The small point is required for accurate calibration e Press the stylus firmly into the center of the cross hair target once and release Do not double tap the target Note By default dynamic screen rotation i e the ability to switch between landscape and portrait orientation is disabled on all 9900 terminals Please consult the Dolphin SDK Add on to find out how to enable dynamic screen rotation te Settings Screen ClearType ClearType smoothes the edges of screen fonts For many programs Enable ClearType General ClearType Text size Settings en Ty E ok Screen Adjust the text size to see more content or increase the readability in many programms Smallest Largest Example Dl get back to you General clearTyne Text Size The display supports ClearType font rendering which is a Microsoft technology that dramatically increases the readability of text on LCD displays To enable ClearType font rendering select Enable ClearType and tap OK To adjust the level of ClearType font rendering use the ClearType Tuner see ClearType Tuner on page 6 9 For more information about ClearType font rendering visit www microsoft com typography cleartype what htm fname 20 amp fsize The Text Size tab enables you to perform font scaling within certain views of the e Today screen e Contacts e Calendar
79. lot through the complete Analyze cycle For more information see Using the Battery Analyzer on page 14 5 Battery Capacity Indicator LEDs These LEDs give a readout of the remaining battery capacity after it has run through a complete analyze cycle For more information see Battery Capacity Indicator LEDs on page 14 2 Analyze Button Press this button to start an Analyze cycle see Using the Battery Analyzer on page 14 5 Status LEDs A status LED is located above each of the 4 battery slots The color of the LED indicates the charge status of the batteries in its slot Color This color indicates that the battery in the slot Green Has completed its charge cycle and is ready for use Orange Is being charged at a maximum charge rate Red Encountered an error during the most recent charge cycle 14 2 Back Panel Status LED Power Switch Power Supply Connector Power Switch Toggle the power switch to turn the charger on and off Power Supply Connector You attach the power supply to this connector The universal power supply accepts input voltages between 90 265 volts Supplying Power The charger must be connected to a power source via the Honeywell power adapter cable so that voltage is adjusted appropriately 1 Locate the AC power adapter cable and plug it into the power source 2 Connect the power cable to the power adapter 3 Connect the power cable to the supply connect
80. ly seated 3 The battery pack begins charging N Make sure the terminal is dry before placing it in the base Do NOT place a wet terminal in the base Doing so may cause damage not covered by the warranty Charging a Spare Battery in the Auxiliary Battery Well The auxiliary battery well located on the back of the base charges a spare battery independently of the terminal well The Aux Battery LED on the front panel indicates the status of the battery in this well Charge time is 4 hours see Auxiliary Battery Well on page 11 3 1 Insert the end of the battery without the locking tab into the bottom of the auxiliary well opening 2 Snap the battery into place with a hinging motion The Aux Battery LED lights orange 3 Use the AUX Battery LED to monitor charging progress 11 6 Communication USB Dolphin terminals support USB communications out of the box The base also supports USB communications via the USB port located on the back The base acts as a USB device by interfacing the USB signals of the Dolphin terminal to the USB of the host workstation Using a standard USB cable the base s USB interface allows the Dolphin terminal to communicate with a workstation or to be networked through a USB hub RS 232 The base supports RS 232 communications via the RS 232 Communications Port located on the back of the device This port enables the Dolphin terminal to communicate to a workstation modem or any RS 232 device using a st
81. matically opens ActiveSync to establish a connection Synchronizing with the Host Workstation After setup synchronization begins automatically whenever the terminal s mechanical connector connects to a Dolphin peripheral that is connected to a host workstation with ActiveSync installed Exploring the Terminal from the Workstation When the Dolphin terminal and workstation are connected open the main ActiveSync window on the desktop and click Explore Microsoft ActiveSync Sieg File View Tools Help Exp mer E The Mobile Device folder opens in Windows Explorer Connected E Mobile Device File Edit View Favorites Tools Help pack amp Ei r2 Search 1 Folders Heb x 7 Favorites E Address H Mobile Device Marne size Type B Application Data File Folder G 1PSM File Folder My Documents File Folder Other Places A o Me Camm iker The Dolphin terminal is now treated as a mass storage device and transferring files is as simple as dragging and dropping or copying and pasting Installing Additional Software In addition to the default programs installed on your terminal when it is first booted up you can install any program created for a Windows Mobile based device as long as the terminal has enough memory to store the program and the program has an EXE CAB or DLL extension The most popular place to find software on the Windows Mobile website www microsoft com window
82. mited duration of the warranty for Dolphins 9900 9950 and 9951 is as follows e The duration of the limited warranty for terminals with an integrated imager is two years e The duration of the limited warranty for touch screens is one year e The duration of the limited warranty for the Dolphin HomeBase device Dolphin QuadCharger device Dolphin Mobile Base Dolphin ChargeBase device Dolphin Net Base device and Mobile Charger is one year e The duration of the limited warranty for batteries is one year Use of any battery from a source other than Honeywell may result in damage not covered by the warranty Batteries returned to Honeywell International Inc in a reduced state may or not be replaced under this warranty Battery life will be greatly increased when following the battery instructions in this user s guide 15 3 How to Extend Your Warranty Honeywell International Inc offers a variety of service plans on our hardware producis These agreements offer continued coverage for your equipment after the initial warranty expires For more information contact your Sales Representative Customer Account Representative or Product Service Marketing Manager ffom Honeywell International Inc or your Authorized Reseller 15 4 Honeywell 700 Visions Drive P O Box 208 Skaneateles Falls NY 13153 0208 99 UG Rev E 7 09
83. n Therefore if you use a microwave within range of the Dolphin RF terminal you may notice performance degradation in your wireless network However both your microwave and your wireless network will continue to function The Dolphin Batch terminal does not contain a radio and therefore is not affected by microwave ovens 2 Getting Started Out of the Box Verify that the carton contains the following items e Dolphin 9900 or 9950 or 9951 mobile computer the terminal e Main battery pack 7 4v Li ion e Microsoft Getting Started CD e Quick Start Guide Note If you ordered accessories for your terminals verify that they are also included with the order Be sure to keep the original packaging in the event that the Dolphin terminal should need to be returned for service For details see Product Service and Repair on page 15 1 Step 1 Install the Main Battery Pack We recommend use of Honeywell Li lon battery packs Use of any non Honeywell battery may result in damage not covered by the warranty Step 2 Charge the Main and Backup Batteries The power supply for Dolphin terminals consists of two types of battery power the main battery pack installed on the back panel and the backup battery that resides inside the terminal The main battery powers the terminal The internal backup battery charges off the main battery and maintains the application data stored in RAM memory for up to 30 minutes when the terminal s main b
84. n install one memory card in Dolphin terminals see Memory Card Door on page 3 10 If a storage card is installed in the terminal you can select it in the drop down list and see capacity and usage statistics for the card Running Programs Tab Settings wove Displays the software programs currently using Storage Memory Memory Running Programs List E o ENS DE Check this tab when you are receiving out of memory errors or File Explorer when the mobile computer is running slowly You can e Select a program in the list and tap Stop to stop it from running and therefore from using memory or e Tap Stop All to automatically stop all running programs Main storage Card Card Running Programs Anytime you stop a running program it frees up RAM memory Be advised that when you stop a program here any unsaved data in that program is lost To free up memory N without risking data loss return to the running program save your data and close the application Power Power system settings contains three tabs Battery and Advanced Battery Tab aE na eae For more information see Batteries on page 3 15 Power Main battery Lilon Battery power remaining Backup battery o E 100 Advanced Tab Settings ppa ar Determines power time outs Power For On battery power select from the drop down list B ee the number of minutes of inactivity you want to pass editor before the terminal powers
85. nager provides a centralized interface that enables and disables all the on board radios Each radio has its own configuration program and the Dolphin Wireless Manager also provides shortcuts to the configuration utilities for each radio Dolphin Wireless Manager Window O Dolphin Tap Start gt Settings gt Connections tab gt Dolphin Wireless Manager wircie si DolphinWM 1 oa a ok If a rectangle is grayed out then the radio is not installed x OFF on the terminal These buttons show you the state of the radio arch On If applicable information about the radio appears when the radio is activated Enabling the Radios 1 Tap Start gt Settings gt Connections tab gt Dolphin Wireless Manager i DolphinWM T ay Te E ok Bluetooth 2 Tap anywhere inside the rectangle or the OFF button inside the rectangle A message appears asking if you want to turn on the radio Bluetooth E OFF 3 Tap OK and the radio begins activating Bluetooth 4 When the radio is activated i e transmitting a signal the OFF button changes to ON Phone te OFF Note If applicable information about the radio appears in the rectangle Accessing Radio Configuration Utilities Each of the three radios have their own configuration utilities that you can access through the Menu Turn all radios on Turn all radios off WLAN Settings Bluetooth Settings Phone Settings About ii sm There are
86. nal must be powered down Note If no SIM card is installed you can still make emergency phone calls such as 9 1 1 for example To Install a SIM Card Access to the SIM card is located under the battery well which enables easy access to the SIM card while securing it under an installed battery 1 Put the terminal in suspend mode and lay it face down on a flat surface 2 Remove the battery pack SIM Card Door Battery Interface Battery Well 3 Unscrew the faceplate of the SIM card door You must use a Torx T6 wrench You can purchase this wrench from Honeywell part number 100001700 4 Insert your SIM card Make sure the interface on the card is connected to the SIM Card interface in the slot the beveled corner is in the upper right corner 5 Place the SIM card door over the secured SIM card and fasten the screws Ss Screws SIM Card Door 3 Loy 6 Install the battery pack and turn on the terminal Enabling the GSM Radio Be default the GSM radio should be enabled after each hard reset Verify the status of the radio in the O Dolphin Wireless Manager Tap Start gt Settings gt Connections tab gt Dolphin Wireless Manager qa Wirele se DolphinwM Alen 1 4 a ok Bluetooth If the Phone is set to OFF tap the Phone rectangle and the GSM radio enables Voice Communication You can use the Dolphin terminal as a phone over the GSM radio Audio M
87. nals The 4th slot features a battery analyzer that completely resets a battery then displays its remaining capacity Capacity The charger holds 4 Li ion batteries Charging Time Charge time is 5 hours Charging Process Each charging slot works independently of the other three As battery packs charge the charging circuitry follows the two step charging process CC CV that is recommended for Li ion batteries The process monitors changes in temperature current and voltage and resets the battery pack We recommend use of Honeywell Li lon battery packs Use of any non Honeywell battery may result in damage not covered by the warranty We recommend use of Honeywell peripherals power cables and power adapters Use of any non Honeywell peripherals cables or power adapters may cause damage not covered by the warranty 14 1 Parts and Functions Top Panel Status LED o Battery Capacity lt LEDs Analyze Button Charging Slots Charge Analyze Slot Charging Slots There are 4 charging slots Each slot holds one Li ion battery and charges it independently of the other slots When a battery is placed in each slot it immediately begins charging Charge Analyze Slot This is the 4th slot and the only one that can be used to analyze a battery When a battery is placed in this slot it begins charging just as it does in the other three slots However if you press the ANALYZE button it runs the battery in this s
88. nc Communication on page 7 8 Communicating with the Dolphin Terminal To initiate communications between the Dolphin terminal and peripheral complete these steps 11 7 1 Insert the Dolphin terminal into the terminal well of the base e The DOCK LED illuminates green If the DOCK LED does not illuminate make sure that the terminal is properly seated You may need to remove and re insert the terminal e The Dolphin terminal activates if the power is off the terminal automatically powers on If the terminal does not power on verify that the Honeywell power supply is properly connected to the cradle and plugged into a functioning outlet e Ifthe base is connected to the workstation the Dolphin terminal automatically opens ActiveSync to establish a connection 2 The base can now transfer data between the terminal and the host device If communication does not occur check the port connections to ensure that the cradle is correctly configured Verifying Communication You can verify that the USB driver is functioning by watching the COMM LED on the USB base When the COMM LED illuminates solid green the base is communicating with the host device Verifying Data Transfer The COMM LED flashes when data is being transferred via the base For an RS 232 connection the COMM LED flashes red and green For a USB connection the COMM LED flashes green 11 8 RS 232 Communications Cables Connect the base to the host workstation o
89. neywell battery may result in damage not covered by the warranty We recommend use of Honeywell peripherals power cables and power adapters Use of any non Honeywell peripherals cables or power adapters may cause damage not covered by the warranty 13 1 Parts and Functions Front Panel Terminal Wells Dock Charge LED LED Terminal Wells The base contains 4 terminals wells Each well e Holds and charges the main battery pack of one Dolphin terminal e Contains the companion to the I O connector on the bottom panel of Dolphin terminals e Has two LEDs on the front the Dock LED and the Charge LED Dock LED Each terminal well displays a Dock LED on the front that lights solid green when a terminal is properly seated which means that the terminal and the base are connected Charge LEDs Each terminal well displays a Charge LED on the front that lights green to indicate charging For details see Charging Terminals on page 13 4 Back Panel Power Supply Connector Power Supply Connector This connector receives input from the power adapter Plug the power connector cable from the power adapter into this connector There is no ON OFF switch on the back panel of the base The power switch is on the power adapter 13 2 Power Supply The base includes a power supply that contains a power adapter to ensure the proper voltage The power adapter is
90. odes The back panel of the 9900 9950 and 9951 contains both a speaker and a microphone that you can use to send and receive audio signals over the GSM network see Back Panel 9900 on page 3 6 There are two audio modes Headset Headset mode is when you plug a headset into the audio jack and speak into the microphone You must use a 2 5mm plug no other audio plug will fit Hands Free Hands free mode is when you use the back panel as a speakerphone To switch the back panel to speakerphone in the Dialler tap Settings gt Speakerphone The audio levels adjust appropriately for speakerphone use Volume Control A Use the Dolphin keyboard to manually adjust the volume wal To raise the volume press the Blue modifier key up arrow To lower the volume press the Blue modifier key down arrow Accessing the Dialer Window When the GSM radio is active tap Start gt Settings gt Connections tab gt Dolphin Wireless Manager then tap Menu gt Phone Settings The Phone dialer opens Displays the network 3g Phone A Ac 4 IX carrier from the SIM card gt mere Displays the most recent calls meee i 3012 835 8170 1 Voicemail SS 1 pa HS cao mno is Speed Dial Dial ports 7 E pe Dialing Once the dialer window is open you can dial out two ways e Tap the buttons on the dialer window e Use the physical keyboard when it s in numeric mode Sending Calls After the number is dialed t
91. off when running on battery power On external power Turn off device if not 5 minutes minutes ee For On external power select from the drop down list the number of minutes of inactivity you want to pass before the terminal powers off when running on external power Note You can also set automatic turn off times for the terminal to conserve power When the terminal is turned off that means that it goes into suspend mode see Suspend Mode on page 3 18 Regional Settings Regional Settings enables you to customize the appearance and formatting to your geographic region Specifically you can customize numbers i e number of decimal places allowed currency i e using the or symbol time and date These specifications apply to all screens including the Today screen The Region tab displays an overview of the region selected in the drop down list at the top The terminal is loaded with a number of pre programmed regional settings Select one from the list and the results appear on the screen To see specific settings or change a specific setting tap on one of the tabs make the change and tap OK to save it Remove Programs Remove Programs enables you to remove programs installed on the terminal Use this setting to troubleshoot when you receive messages that the terminal is out of memory The programs removed are removed from RAM memory Any program usually CAB or DLL files stored in the Autoinstall folder My
92. ons to Internet Service Providers ISPs via external modem Do NOT enter connection parameters in the connections manager if e You are using one of the on board wireless radios to connect to a network The Dolphin terminal uses the settings from each radio s configuration utility to connect e You are using Wireless Zero Config WZC By default WZC is disabled on Dolphin terminals To Access the Connections Manager p o Tap Start gt Settings gt Connections tab gt Connections icon connections e Settings lal gn Ty WE lok Connections My ISP Add a new modem connection My Work Network 4dd a new modem connection 4dd a new YPN server connection Set up my proxy server Tasks Task Tab The Task tab enables you to initially configure then manage network settings when using a modem Select an item in this list and then complete the setup screens that follow with the appropriate information for your network My ISP The links under this heading enables you to add and manage modem connections to an ISP To complete the setup screens obtain the following information from your ISP e ISP dial up access telephone number e Username e Password e TCP IP settings My Work Network These links enable you to establish the following connections types e Modem e Virtual Private Network VPN e Proxy server connection To complete the setup screens obtain the network parameters from your system administrator
93. or GSM Dolphin RF terminals are in conformity with all essential requirements of the R amp TTE Directive 1999 5 EC This product is marked with 0682 in accordance with the Class Il product requirements specified in the R amp TTE Directive In addition this product complies to 2006 95 EC Low Voltage Directive when supplied with the recommended power supply Honeywell shall not be liable for use of our product with equipment i e power supplies personal computers etc that is not CE marked and does not comply with the Low Voltage Directive The equipment is intended for use throughout the European Community PAN European Frequency Range 2 402 2 480 GHz Restrictions for use in France are as follows e Indoor use Maximum power EIRP of 100 mW for the entire 2 400 2 4835 GHz e Outdoor use Maximum power EIRP of 100 mW for the 2 400 2 454 GHz band amp maximum power EIRP of 10 mW for the 2 454 2 483 MGHz band For further information please contact Honeywell Imaging amp Mobility Europe BV Nijverheidsweg 9 5627 BT Eindhoven The Netherlands Dolphin RF Terminal 802 11b g Bluetooth and or GSM This device complies with Part 15 of the FCC Rules Operation is subject to the following two conditions 1 this device may not cause harmful interference and 2 this device must accept any interference received including interference that may cause undesired operation This equipment has been tested and found to com
94. or on the back of the charger 4 Press the power switch to the ON position The power LED illuminates green and the charger performs a self diagnostic test that lasts approximately five seconds 14 3 Inserting and Removing Battery Packs To insert a battery pack place the end of the battery without the locking tab into the bottom of the charging pocket and snap the battery into place with a hinging motion The Status LED for that particular slot illuminates orange when the battery has been properly inserted To remove a battery pack push the locking tab down and pull the battery out from the charging slot with a hinging motion Recommendations for Storing Batteries To maintain top performance from batteries follow these storage guidelines e Avoid storing batteries outside of the specified temperature range of 4 to 104 F 20 to 40 C or in extremely high humidity e For prolonged storage do not keep batteries stored in a charger that is connected to a power source Charging Batteries For best results battery packs should be at room temperature before recharging them temperature has a marked effect on charging The recommended temperature range is 50 to 95 F 10 to 35 C 1 Setup the charger 2 Power the charger 3 Insert batteries into the appropriate slots The Status LED for each slot turns orange to indicate that the battery has begun a charge cycle 4 When the Status LED turns green the battery
95. orting External Memory GPS e Personal System Connections Tab se Settings aa A gt O t o E Beam Bluetooth Connections O F Dolphin Network USE to PC Wirele Cards Personal System Personal Customizes buttons set SIP options and adjust headset settings See Personal Tab on page 6 2 Adjusts system settings See System Tab on page 6 7 Establishes network connections settings See Connections Tab on page 7 1 Personal Tab To access the Personal tab go to Start gt Settings The screen opens displaying the Personal tab mi Settings ler Te E x Buttons Input Lock Menus Owner Phone Information E Sounds amp Today Notifications re E o eens tasks rot Stnins Seitnoy Senor ms Stine wstepnsnteStme Smo nen Owner Information Enter your contact information This information will appear on the Today screen When the GSM radio is enabled tap this icon See Setup Options on page 8 7 to set up user parameters Sounds amp Set the sound volume enables and disables sounds for Notifications specific actions and sets sound parameters for system notifications Today Customize the look and the information displayed on the Today screen Note Personal settings are stored in RAM memory They are replaced by system defaults after each hard reset For more information about resets see Soft Reset Warm Boot on page 3 18 Buttons The Button
96. ote Some programs have abbreviated labels underneath the icon To see the full spelling of an abbreviated label tap and hold the stylus on the label Drag the stylus off the label so that the command is not carried out File Explorer You can also use the File Explorer to find files and organize these files into folders Tap Start gt Programs gt File Explorer File Explorer E My Documents Name m My Music Li My Pictures L jh My Ringtones LJ Personal LJ Templates Tap the Up button at the bottom of the screen to move up one level in the directory Up ES Menu You can move files in File Explorer by tapping and holding on the item you want to move and then tapping Cut or Copy and Paste on popup menus Search The Search feature helps you quickly locate information Tap Start gt Programs gt Search search Enter the text you want to find select a data type and then tap Go to start the search To quickly find information that is taking up storage space select Larger than 64 KB in the Type drop down field 3 Hardware Overview Standard Configurations for the 9900 WLAN amp WPAN WLAN WPAN amp WWAN WLAN Microsoft Windows Mobile 6 1 Professional Intel XScale PXA27x 624 MHz 256MB RAM X 1GB Flash Three in mold hard top keyboard options Microsoft Windows Mobile 6 1 Classic Intel XScale PXA27x 624 MHz 256MB RAM X 1GB Flash Three in mold hard top keyboard options 2500mAh exten
97. other than those specified by our company The correction is the responsibility of the user Use only shielded data cables with this system In accordance with FCC 15 21 changes or modifications not expressly approved by the party responsible for compliance could void the user s authority to operate the equipment CAUTION Any changes or modifications not expressly approved by the grantee of this device could void the user s authority to operate the equipment Canadian Compliance This Class B digital apparatus complies with Canadian ICES 003 Operation is subject to the following two conditions 1 this device may not cause harmful interference and 2 this device must accept any interference received including interference that may cause undesired operation To prevent radio interference to the licensed service this device is intended to be operated indoors and away from windows to provide maximum shielding Equipment or its transmit antenna installed outdoors is subject to licensing Cet appareil num rique de la Classe B est conforme a la norme NMB 003 du Canada For European Community Users Honeywell complies with Directive 2002 96 EC OF THE EUROPEAN PARLIAMENT AND OF THE COUNCIL of 27 January 2003 on waste electrical and electronic equipment WEEE Waste Electrical and Electronic Equipment Information This product has required the extraction and use of natural resources for its production It may contain hazardous subst
98. pears rr Settings Partnership Settings Display Name CARY Select services to use From this device Wireless Stereo Serial Port Dialup Networking Headset 7 Select the services you want to use and tap Finish The services on the new devices have to be selected or else the pairing won t include those services even though the devices are paired If services are not selected you will be continually re prompted for the passcode from the device 8 The device appears in the list on the main window re Settings Bluetooth Tap Add new device to search For other Bluetooth devices Tap on a device to modify its settings Devices COM Ports 9 After the passcodes have been accepted on both sides you have a trusted paired connection Pairing and Trusted Devices The terminal does support pairing Pairing happens during general connection setup Paired devices are trusted devices This means that there is unrestricted access to all services including services that require authorization and authentication A connection can exclude pairing A device that is connected to the terminal but not paired with it is considered an untrusted device Content can still be passed to untrusted devices by requiring authorization with each attempt for example with the initialization of a file exchange The Beam File method of file transfer on the can be used to pass a file as an untrusted device see Transferring F
99. plugged into standard AC DC outlets Power Adapter x Power Connector Cable ON OFF Switch Power Cord Supplying Power tah Be sure the power switch on the power adapter is in the OFF position Plug the power cord into the power adapter Plug the power connector cable into the power connector on the back panel of the base Plug the power cord into a standard wall outlet GU eo Se do On the power adapter turn the power switch to the ON position The LEDs illuminate as the base powers up 6 The base is ready to begin charging terminals 13 3 Inserting and Removing Terminals 1 To insert the terminal hold the terminal with the bottom panel perpendicular to the base 2 Slide the terminal into the well until the Dock LED lights solid green 3 Charging begins immediately Note To remove a terminal grasp it firmly in your hand and lift it up and out of the terminal well The LEDs for the terminal well turns off Charging Terminals The main battery of each terminal charges in 4 5 hours The intelligent battery charging system incorporated into all Dolphin terminals prevents overcharging which means that Dolphin terminals may be seated in the base indefinitely without damage to the terminals battery packs or the base 1 Power the base see Supplying Power on page 13 3 2 Insert a terminal into a terminal well see Inserting and Removing Terminals on page 13 4 3 The Charge LED ligh
100. ply with the limits for a Class B digital device pursuant to Part 15 of the FCC Rules These limits are designed to provide reasonable protection against harmful interference in a residential installation This equipment generates uses and can radiate radio frequency energy and if not installed and used in accordance with the instructions may cause harmful interference to radio communications However there is no guarantee that interference will not occur in a particular installation If this equipment does cause harmful interference to radio or television reception which can be determined by turning the equipment off and on the user is encouraged to try to correct the interference by one or more of the following measures e Reorient or relocate the receiving antenna e Increase the separation between the equipment and receiver e Connect the equipment into an outlet on a circuit different from that to which the receiver is connected e Consult the dealer or an experienced radio TV technician for help If necessary the user should consult the dealer or an experienced radio television technician for additional suggestions The user may find the following booklet helpful Something About Interference This is available at FCC local regional offices Our company is not responsible for any radio or television interference caused by unauthorized modifications of this equipment or the substitution or attachment of connecting cables and equipment
101. r other device by plugging an RS 232 serial cable into the RS 232 Communications Port on the rear of the base The wiring of your cable depends on whether the other device is set up as a Data Communications Equipment DCE or Data Terminal Equipment DTE device The Communication Port is configured as a DCE device To communicate with a DCE device use either a null modem adapter in line with a standard RS 232 cable or a null modem serial cable To communicate with a DTE device such as a workstation use a standard or straight through RS 232 cable You can make your own cables by following the pin configuration in the chart below To do so you must determine if your host RS 232 device is 9 pin or 25 pin and whether it is configured as a DCE or DTE device RS 232 Pin Configuration Base Host Port IBM AT DB9 IBMXTDB25 Modem DB25 DCE DTE DTE DCE Pin Input Signal Note This base cannot be daisy chained 11 9 Mounting Set the base on a dry stable surface such as a desktop or workbench near an electrical outlet Be sure to provide enough workspace with good lighting for the user to view and operate the Dolphin terminal while it is in the base When choosing a location bear in mind that e the mounting location must allow users easy access to the Auxiliary Battery Well and e the serial and USB ports as well as the power jack face straight out of the rear panel and you will most likely want easy access to
102. r program configurations by accident Using Copy and Paste Shortcut as opposed to Cut and Paste ensures that the program files remain where they need to be for the system to find them to perform system functions 1 Tap Start gt Programs gt File Explorer and navigate to the program File Explorer opens to My Documents by default to see a list of all folders tap the folder name and then My Device se File Explorer al o Tye x a My Device IPSM IPSM E My Documents 2 Tap and hold on the program then tap Copy on the pop up menu 3 Navigate to the Windows folder and open the Start Menu My Device gt Windows gt Start Menu tap and hold a blank area of the window and tap Paste Shortcut on the pop up menu e File Explorer Ean Ty E E Start Menu Name _ Programs Settings Calendar 1 1 03 34B Contacts 1 1 03 34B Demos Refresh 6B E Internet Messaqi amp Phone Show All Files Paste Paste Shortcut New Folder 4 Tap the Start menu to verify that the program now appears on it Using ActiveSync on the Workstation Here you are performing the same basic process as on the terminal except that you are using the Explore utility Windows Explorer to copy and paste the shortcut 1 Open ActiveSync gt Explore and navigate to the program Right click on the program and select Create Shortcut Select the shortcut right click and select Cut
103. racket to the appropriate location Latch Spring Arm Assembly Ball Joint R Turnscrew DARE VA Ball Joint Power supply and RS 232 e connectors not in view rere Bracket Back Panel Latch The latch sits on top of the spring arm assembly and holds the back of the terminal securely in place The 9950 9951 version of the base contains a special latch to accommodate the integrated pistol grip handle Locking Tabs When positioned as shown in the above graphic the locking tabs secure the spring arm assembly latch and terminal in place When seating a terminal turn both arms up to allow the spring arm to move as necessary while the terminal is being inserted After the terminal is seated turn both arms toward the center to lock them Both locking tabs must be pointing up to insert or remove a terminal in the base 12 5 Spring Arm Assembly The spring arm assembly is the column that connects the latch to the back of the base Ball Joints There are two ball joints one on the back of the base and one on the mounting bracket Both ball joints are inserted into the bracket and secured to mount the base Connectors The power and RS 232 connectors are located on the bottom panel For more information see Bottom Panel on page 12 3 Brackets Bracket The bracket contains the turnscrew and two slots Ball joints are inserted into each slot and secured with the turnscrew Turnscrew The turnscrew is located on the top of the bracket Rota
104. ral sold manufactured by Honeywell such as the charge communication cable Use of any peripheral not sold manufactured by Honeywell may cause damage not covered by the warranty Capabilities e Back up and restore your device data e Copy rather than synchronize files between your device and workstation e Control when synchronization occurs by selecting a synchronization mode For example you can synchronize continually while connected to your workstation or only when you choose the synchronize command e Select which information types are synchronized and control how much data is synchronized For example you can choose how many weeks of past appointments you want synchronized Communication Types The Dolphin terminal supports the following types of communication via ActiveSync through its I O Connector see page 3 12 on the bottom panel USB The USB cable and hardware peripherals allow the terminal to communicate with a workstation or to networked through a USB hub The Dolphin terminal supports full speed USB communication USB 1 1 maximum data transfer rate is 12 Mbps The Dolphin terminal defaults to USB communication out of the box RS 232 The RS 232 cable allows the terminal to communicate with a workstation modem or any RS 232 device Maximum data transfer rate is 115 Kbps Hardware Requirements for Setup e Dolphin communication peripheral or cable e Dolphin power cable from Honeywell e USB cable for USB communicat
105. rs of charging time to function normally Guidelines for Use Follow these guidelines to maximize the life of the internal backup battery e Keep a charged Li ion battery pack in the terminal the backup battery prematurely discharges if there is not at least a partially charged battery in the terminal e Keep the terminal connected to power when the terminal is not in use Managing Battery Power Data and files saved on Dolphin terminals may be stored in RAM memory which does not persist through a hard reset Therefore to help prevent data loss maintain a continuous power supply to the terminal Letting the backup battery become fully discharged causes the terminal to lose all data in RAM Therefore you should keep a charged battery pack in the terminal at all times The internal battery discharges prematurely if there is not at least a partially charged battery in the terminal When you remove a battery pack insert another charged battery pack in the terminal immediately Default Critical and Low Battery Points When the terminal is running on battery power as opposed to external power warnings are displayed when the battery reaches critical and low battery points The warning points are determined by the following registry entry HKEY_LOCAL_MACHINE System CurrentControlSet Control Power There are two DWORD values in this registry entry LowBatt and CriticalBatt The default values for these entries are as follows LowBatt
106. ry Keep the base plugged into the power source so that the Dolphin terminal battery pack stays fully charged For more information about powering the base see Power on page 12 6 Charging the Dolphin Terminal The base supplies charging power to the Dolphin terminal so that the terminal can monitor the charging of its battery pack This charging method protects the battery from being damaged by overcharging Therefore the Dolphin terminal may be stored indefinitely in the base without damage to the terminal the battery pack or the base 1 Insert a battery pack into the terminal 2 Slide the terminal imager window up and the LCD visible into the terminal well until it stops 3 When the terminal is properly seated the DOCK LED on the base illuminates solid green The terminal begins charging automatically 12 4 Mounting The adjustable mounting bracket holds the terminal securely in place and gives the user a variety of options for mounting the base When selecting a location keep in mind that the power supply and serial connectors point straight out the bottom panel 1 Loosen the turnscrew 2 Insert the ball joint of the mounting bracket to the back of the bracket 3 Insert the ball joint on the back of the base into the other side of the bracket 4 Tighten the turnscrew to secure both ball joints 5 Secure the mounting b
107. s Main Tab Storage Card Tab te Settings Memory Storage Program Total 13 56 ME Total 104 75 ME Inuse 6 36 MB Inuse 22 41 MB Free 7 22 ME Free 82 34 MB Main Storage Card Running Programs Fi Settings Memory Total storage card memory 71 47 ME In use 5 04 ME Free 67 63 ME o o Main Storage Card Running Programs Programs This tab displays the usage statistics of the on board volatile RAM memory Columns Storage RAM memory used to store programs and program data Program RAM memory used to run programs Rows Total Displays the current MB of memory allocated for use In use Displays the total MB of that allocated memory being used Free Displays the total MB of memory available This tab displays the current capacity and usage statistics of the selected memory type IPSM or Storage Card Select the memory type from the drop down list IPSM is selected by default Total storage card memory The total MB of memory capacity of IPSM or Storage Card In use The MB currently being used Free The MB that is still available for use IPSM Short for Internal Persistent Storage Manager this is the on board Flash memory that is non volatile Because this memory is non volatile data or programs stored in IPSM are not affected when power is removed Autoinstall programs for example are stored in IPSM so that they are always installed at cold boot startup Storage Card You ca
108. s The base also provides power to the intelligent battery charging system in all terminals that senses when a full charge has been achieved and switches to a trickle charge to maintain the full charge Communications The base transmits data to other devices at speeds of up to 115K baud via its RS 232 serial port Convenient Storage Intelligent battery charging makes the base a safe and convenient storage receptacle for your Dolphin terminal Capacity The base holds one terminal We recommend use of Honeywell Li lon battery packs Use of any non Honeywell battery may result in damage not covered by the warranty We recommend use of Honeywell peripherals power cables and power adapters Use of any non Honeywell peripherals cables or power adapters may cause damage not covered by the warranty 12 1 Front Panel The following graphic features the base with a terminal inserted into the terminal well Terminal Well Mounting Bracket DOCK LED SW COMM LED Terminal Well Place the terminal in this well Once seated the terminal can communicate with a host device and its main battery pack begins charging Mounting Bracket Used to mount the base to a fixed location DOCK LED lluminates solid green when the Dolphin terminal is properly seated in the terminal well COMM LED Indicates the status of data transfer between the host device and the Dolphin terminal Color Indicates that Red Data is being sent from
109. s setting programs certain keyboard buttons to launch applications or execute commands Enable HotKeys Default Buttons setting assignments inactive until you enable the HotKeys Power Tool Tap Start gt Power Tools and tap the HotKeys icon once hotkeys HotKeys is enabled and the button assignments in the Buttons setting are active For more information about the HotKeys Power Tool refer to the Dolphin Power Tools User s Guide which is available for download from the web at www honeywellaidc com Changing Buttons Assignments 1 After HotKeys is enabled tap Start gt Settings gt Personal tab gt Buttons guttons 1 Settings 1 E Te d lok Buttons 1 Select a button ActiveSync Calendar Contacts EfConfig Client Assign a program ActiveSync Program Buttons Up Down Control Note The buttons that appear on this window are the only buttons that can be programmed via the Buttons setting You cannot add buttons to this window 2 To change button assignment tap on the name of the application in the Assignment column and select a program or command in the Assign a program drop down list 3 Tap OK to save Press the button to verify that the program is launched or action performed Available Applications The Assign a program list contains the applications installed on the terminal If there is a program installed that you would like to see in this list paste a Shortcut to the program in
110. sing Radio Configuration Utilities eee rena 7 7 ActiveSyne Communicati sssi DRA O ERR RR 7 8 Installing Additional Software err eeererena renan erena a erenancree ana crenannena 7 10 Adding Programs to the Terminal Using ActiveSync 7 10 Adding Programs Directly from the Intemetl errar 7 11 9900 9950 9951 COM Port Assignment Table eee 7 12 Chapter 8 Working with GSM OVEIVICW cccccccccccccccececececccucucacecececececececenenenenenuacauaecuauacatacstatstetececeneneneneneauavavanseatersreteneners 8 1 Quad Band Antenna ccccccceccecececcccececcccecaccececeecccecseauausecauausecseausecaeausecsuauaueeravaesecass 8 1 SIM Card Installation rrenan 8 2 Enabling the GSM Radio cccccssesseeecceceeeeeeeeeeceaeseeeeeeesaeeeeeeeeesseuseeeeesseeeseeeseesaaneeeeeesnas 8 4 VOICE COMUNICADOR srcancaisiasanenabcos E ice aanias sons car E 8 5 Audio MO O rain aa Ea AUD RS nad Si a 8 5 VOlIME COMO carina A a 8 5 Accessing the Dialer Window cccccssccsssecessesccsserensesensnerssaesensnesecsesensutrenserensatessaegs 8 5 BDF ANNAN E see erate caste steam Sve E poe dae te SER RS DUO IDEA E PU E 8 5 Seela e kee E E DR RR E RR O RE END DS ND RR E 8 6 Enang COI asian tania E ed cai dc 8 6 Keyboard Combinations for Calls re errerena nan erraa nene rrenanaeranna 8 6 VEW COM ONS ARE RR URI DN QRO DER E ouadateasetaesaae 8 6 SC UO CPUS ses seasiar as
111. smobile products pocketpc When selecting programs verify that the program and version of the program are designed for the Windows Mobile and your processor You can verify your processor by tapping Start gt Settings gt System tab gt About gt Version tab Make a note of the information in the Processor field You can install additional software via e ActiveSync see page 7 10 e Infrared see page 7 2 e Network connection via wireless radio see page 7 11 e Connect to your ISP Adding Programs to the Terminal Using ActiveSync When selecting programs verify that the program and version of the program are designed for Windows Mobile and your processor You can verify your processor by tapping Start gt Settings gt System tab gt About gt Version tab Make a note of the information in the Processor field Depending on the application the software must be stored or installed on the host PC 1 Download the program to your desktop computer from either the Internet or the CD or disk that con tains the program You may see a single EXE or setup exe file a CAB file or DLL There may also be several versions of files for different device types and processors 2 Read any installation instructions Read Me files or documentation that comes with the program Many programs provide special installation instructions 3 Connect the terminal to the desktop computer via a Honeywell communication peripheral If the File is
112. tch back to automatic roaming select Automatic under Select networks and tap OK Working with the Bluetooth Radio Enabling the Bluetooth Radio You enable the Bluetooth radio in the Dolphin Wireless Manager see page 7 6 O 1 Tap Start gt Settings gt Connections tab gt Dolphin Wireless Manager qi DolphinWM ler Te d lok Bluetooth OFF Phone 4 OFF 2 Tap anywhere inside the Bluetooth rectangle and Bluetooth begins activating Bluetooth OFF 3 When the radio is activated i e transmitting a signal the OFF button changes to ON Bluetooth E ON Now the Bluetooth radio is transmitting a signal Additional text in the Bluetooth section tells information about the Bluetooth radio Visible and Not visible indicates whether the Bluetooth radio is discoverable or not discoverable by other Bluetooth devices Now you can connect to other transmitting and discoverable Bluetooth devices see page 9 2 To make the terminal discoverable for other Bluetooth devices to find you need to make the Bluetooth radio discoverable see page 9 8 Connecting to Other Bluetooth Devices You need to perform a device discovery and then select a discovered device and connect to it Pairing happens as part of the connection process 1 Inthe Dolphin Wireless Manager tap Menu gt Bluetooth Settings OR Tap Start gt Settings gt Connections tab gt Bluetooth Gjuetooth ra S
113. te the turnscrew to secure or loosen the ball joint slots Mounting Bracket The mounting bracket is what you attach to the mounting surface It is comprised of a ball joint and flat disk The disk contains drill holes you use to secure the base to the mounting surface Power Note Honeywell recommends that you leave the base connected to its power source at all times The base is powered via the power connector on the bottom panel see Bottom Panel on page 12 3 Both the power and serial connectors are straight out not at an angle The base must be powered by a 12 to 48 volt DC source 12 6 Establishing Communication The RS 232 interface allows the terminal to communicate to a workstation modem or any standard RS 232 device using a standard serial cable and communications software Requirements You need the following equipment e A Mobile Base device powered by a power cable and power adapter cable e The RS 232 communications cable e ActiveSync v4 5 or above on the host workstation e Windows 98 Second Edition Windows Me Windows 2000 or Windows XP on the host workstation Connecting the Communication Cables Note You must be using ActiveSync 4 5 or higher 1 Plug in the power supply and connect it to the back of the base Plug the RS 232 communication cable into the back of the base Connect the communication cable into the back of the workstation gt 2 N At this point the hardware is installed and
114. the full speed USB port the data transmission rate goes up to 12 Mbps These bases cannot be physically connected to each other sometimes referred to as daisy chained but can be networked together via a serial or USB hub Convenient Storage The intelligent battery charging system makes this base a safe and convenient storage receptacle for your Dolphin terminal Capacity The base holds one terminal and features an auxiliary battery well behind the terminal well that can charge a battery pack independently of the terminal well This means that one base can charge two battery packs the one installed in the terminal and a spare We recommend use of Honeywell Li lon battery packs Use of any non Honeywell battery may result in damage not covered by the warranty We recommend use of Honeywell peripherals power cables and power adapters Use of any non Honeywell N peripherals cables or power adapters may cause damage not covered by the warranty 11 1 Parts and Functions Front Panel Terminal Well Auxiliary Battery Well DOCK LED AUX Battery LED COMM LED Terminal Well Place the terminal in this well to communicate with a host device power the terminal and charge its battery pack If the host device is a workstation that uses ActiveSync synchronization begins immediately While seated in the terminal well the main battery installed in the terminal charges The base completely charges a battery pac
115. the host device to the base Green Data is being sent from the base to the host device Orange Data is being sent at high data rates Note There is a separate version of this base that accommodates the integrated pistol grip handle of the 9950 and 9951 12 2 Bottom Panel The power supply and RS 232 connectors are located on the bottom of the unit RS 232 Communications Power Supply Pon Connector Power Supply Connector Attach the power cable that came with the base to this connector The base can be powered by an external DC power source of between 11 VDC to 48 VDC To run on vehicle power you can use the 12 VDC cable or 24 VDC cable option The appropriate cable comes with the kit you ordered The 12 VDC cable can be used with a cigarette lighter outlet The 24 VDC pigtail cable can be used to hard wire into the vehicle power bus N Verify that the power source is always within the specified range and observe correct input voltage polarity An improper input voltage range above the 48 VDC maximum or reverse polarity could damage the power conversion circuitry RS 232 Communications Port Use a standard serial cable to connect the unit to a host device via RS 232 see Serial Connector on page 12 8 12 3 Powering the Dolphin Terminal When seated in a base that is connected to the appropriate power source the Dolphin terminal receives the power to charge its main battery and run its internal circuit
116. the network icon changes to Ef 10 You can now send data over GSM Ending the Data Connection You need to end the data connection to use the phone By default the data connection will disconnect after a certain amount of time passes without use This period of time is determined by ISP To end the data connection manually tap the network icon in the navigation bar Ei and select Disconnect on the popup bubble Roaming You can select automatic or manual roaming The Phone defaults to automatic roaming 1 When an active SIM card is inserted in the terminal tap Start gt Settings gt Personal tab gt Phone Phone The Phone Settings window appears 2 Select the Network tab sa Settings Ale Ty lok Phone Current network Cingular Network selection select Preferred networks Phone services Network 3 Under Network selection select Automatic the default selection or Manual a lf you select Manual the Phone searches for available networks Network Selection Searching For all available networks Please wait Cancel b The found networks appear Select an available network and then tap OF SUNCOM AT amp T c Select a new network and tap OK The Phone registers on the new network and the Network tabs appears LC Network Selection M Registering on the network Fr d To switch to another network tap the now active Select button and the process repeats 4 To swi
117. this storage slot to hold the stylus when not in use The stylus features a special tip for added accuracy and ease of use Side Panels 9900 9950 and 9951 The left and the right side panels contain different features Left Side Audio Jack 2 5mm Memory Card Door 0000000 Ch Memory Card Door This door provides user access to the industry standard SD memory interface You can open this door to insert SD memory cards to expand the terminal s memory capacity SD When this door is fastened securely and properly the memory interface is sealed against moisture and particle intrusion read write data is stored securely and the terminal s environmental rating is preserved see Installing a Memory Card on page 3 11 Audio Jack The 2 5mm audio jack supports both speaker stereo and microphone mono headsets Right Side IrDA Port IrDA Port The IrDA port enables infrared communication The maximum data transfer speed is 115kbps Note The infrared LED aperture is located behind the window For more information about using this port see Using the IrDA Port on page 7 2 Installing a Memory Card 1 Press Blue Backlight key to put the terminal in suspend mode see Suspend Mode on page 2 11 2 Remove the battery 3 Place the terminal on a flat secure surface with the keyboard face down 4 Unscrew both screws and remove the door je gt
118. thod Word Completion Menus You can add existing programs you use often such as File Explorer to the Start menu for faster access You are not installing the program just allowing access to it from the Start menu To add programs to the Start menu you can use e The Menus setting on the Personal tab See page 6 5 e File Explorer See page 6 5 or e ActiveSync see page 6 6 Note The Start menu can hold only seven applications at a time Using System Settings 1 Tap Start gt Settings gt Personal tab gt Menus vies se Settings lal en Ty 5 lok Menus Checked items appear in the Start menu Others appear in Programs LIE Image Profiler 7 Internet Explorer Internet Sharing C Marketplace Messaging notes ekOffice Mobile Phone ie Pictures amp videos 4 Power Tools Lle Remote Desktop Mobile 2 Tap the check box for the program you want to add and tap OK to save Note Ifyou try to go over seven applications a warning message appears and you will have to delete applications as necessary 3 Tap the Start menu to verify that the program appears on it Using File Explorer If you do not see the program listed you can either use File Explorer to move the program or ActiveSync on the workstation to create a shortcut to the program and place the shortcut in the Start Menu folder Note We recommend that you Copy and Paste Shortcut so that you do not alter you
119. three radio configuration utilities For 802 11b g Tap WLAN Settings and the Honeywell WLAN Security Supplicant opens The Honeywell WLAN Security Supplicant User s Guide is available for download from the Dolphin 9900 product page at www honeywellaidc com For Bluetooth Tap Bluetooth Settings and the Bluetooth Settings open For details see Working with the Bluetooth Radio on page 9 1 For GSM Tap Phone Settings and the Phone opens For details see Working with GSM on page 8 1 ActiveSync Communication To synchronize data between the terminal and the workstation ActiveSync 4 5 or higher must be installed and configured for the appropriate communication type on the host workstation and the Dolphin terminal Dolphin terminals ship with ActiveSync already installed Therefore if ActiveSync is already installed on the host workstation you just need to connect the Dolphin terminal to the host workstation via Dolphin peripheral to initiate communication If ActiveSync 4 5 or higher is not installed on the host workstation install it from the Microsoft Companion CD that came with the Dolphin terminal Insert the CD into the CD ROM drive of the host workstation and follow the directions on your screen Note You can also download the most current version of ActiveSync from www microsoft com and install When communicating via ActiveSync your terminal is designed to be connected to the host workstation with a communication periphe
120. ting to a desk or a wall Screw 3 16 in dia x 5 8 in long pan head screw Washer 1 2 in OD x 7 82 in ID x 3 64 in thick Nut 3 16 in dia Desk Mounting Slide the DIN rail slot into the bottom panel Then using the appropriate nuts and bolts listed above secure the DIN rail to the desk or wall 14 6 Wall Mounting Use the appropriate nuts and bolts listed above to secure the DIN rail to a wall 14 7 Troubleshooting If you encounter problems with your refer to chart below for possible solutions If problems persist please contact Honeywell Technical Support The Status LED does not come on when Check the power connections make sure the POWER switch is insert a battery pac ON and the battery pack is properly seated The Status LED lights red during charging Try to charge the battery in one of the other charging slots If the red Status LED comes on again then the problem is associated with the battery pack If the red status stays with the charging slot the problem is associated with the charging circuitry The Status LED lights red and stays on An error occurred during the self diagnostic test for that without a battery in the charging slot particular charging pocket Call Honeywell Product Service and request an RMA For additional warranty and return information see Customer Support on page 15 1 14 8 15 Customer Support Product Service and Repair Honeywell International Inc
121. tion for mobile applications Each cable kit powers the terminal charges its main battery and communicates with host or peripheral devices without the need for a cradle Cable kits can support RS 232 or USB communications and are available with U K or European power cords Protective Holster Holsters provide convenient storage for terminals and protect them from damage in mobile environments Both holsters feature a front pocket that holds an extra battery a side pocket to hold an extra stylus and a belt loop to secure the holster to a belt Protective Enclosure Protective enclosures help seal and protect terminals from damage while providing full access to all terminal parts and features These enclosures feature a swivel clip on the back that enables you to secure the enclosure to a belt Enclosures also come with an adjustable shoulder strap for added convenience Stylus Kits There are two stylus kits one contains three styli and the other includes additional coiled tethers to secure the stylus to the terminal which helps prevent loss Li ion Battery Pack The 7 4v 18 5 watt hour Li ion rechargeable battery pack provides the main power for the terminal Front Panel 9900 9950 and 9951 Indicator LED TE L al Front Speaker Touch Panel Display SCAN Key A opo S Q00 Navigation Keys Recessed ERR O Keyboar id 0000 OOOO OQOQO00 00000 00000 0
122. ts green to indicate that the terminal is powered and charging 13 4 Mounting This base should be mounted to a dry stable surface When choosing a location always bear in mind that e The mounting location must allow users easy access to the power connector e The base should be oriented so that users can easily read the labels Bottom Panel The bottom panel offers two mounting options insert a DIN Rail for desk mounting or use mounting brackets with the available screw slots for wall mounting Screw Slots Rubber Feet DIN Rail Slot 13 5 Desk Mounting The DIN Rail 7 5 X 35 mm slot on the bottom panel enables secure mounting Installation Hardware Screw 3 16 in dia x 5 8 in long pan head screw Washer 1 2 in OD x 7 82 in ID x 3 64 in thick Nut 3 16 in dia 1 Slide the DIN Rail into the DIN Rail slot on the bottom panel 2 Turn the base and DIN Rail right side up 3 Secure the DIN Rail to a stable flat horizontal surface 13 6 Wall Mounting You need to purchase two wall mount kits that each contain e amounting bracket e three screws and e six washer nut sets You need two kits so that you have two mounting brackets one for each end of the device and enough screws 4 and washer nut sets 8 The mounting bracket contains an open slot between the back and bottom wedges to accommodate the connector cables To Mount Using the Wall Mount Kit 1
123. ttings from the network on the SIM and display the available options from the carrier Settings Phone To access settings For a service select it From the Following list and bap Get Settings Network 4 Reading settings From the network Cancel Get Settings Phone Services Meturork Network Tab Ale 4E okl o Settings Phone Cingular Select Current network Network selection Preferred networks Phone services Network You can set networks on the Network tab SA er Yy ME ok Settings Phone Preferred networks Select your preferred networks and order them to your preference New Network w AT amp T w USAFC AT amp T 44 AT amp T Cel One of NE Colorado Centennial Communications USA Commnet 7 Cellular One DCS Data Communication You set up data communication via the connections manager The carrier on the SIM card is the ISP System Requirements e The GSM radio must be enabled see Enabling the GSM Radio on page 8 4 e You must have an active SIM card installed see SIM Card Installation on page 8 2 e The Phone must not be in use The kf in the navigation bar indicates that the GSM phone is active but the phone is not in use Information Requirements You must have from the SIM card carrier e The APN access point name number e The username and password of the account Establishing Data Communication
124. ut sets on each of the three screws to secure the base to the mounting bracket Recommended Hardware lf a metal or wood stud is present drill a 3 32 in pilot hole into the stud and use a 6 X 1 1 2 screw and washer to attach the bracket to the wall For any of the screws positioned so that they are going directly into dry wall use a sheet rock anchor screw set such as the one listed below For any of the screws attaching directly into concrete drill the appropriately sized pilot hole into the concrete and secure the bracket to the wall using concrete anchor screws such as those listed below Wal Recommended Anchors Sheet Rock Buildex E Z Anchor Stud Solver Medium Duty Drywall Anchor Model 25216 supports 50 Ibs screws included Buildex TAPCON concrete anchors 3 16 in X at least 1 in 11 11 11 12 12 Dolphin Mobile Base Device Overview This charging and communication cradle is designed specifically for in premise and in transit data collection applications It features a flexible mounting bracket a cigarette lighter adapter and a power cable to adapt it to your environment The serial connector supports RS 232 communication and power out to peripheral devices such as handheld scanners As the hub of your Dolphin mobile data collection system the base performs three important functions charging communications and storage Charging The base completes a full charge of the main battery pack in 4 5 hour
125. ve a positive read when reading linear 1D and PDF417 bar codes the green aiming beam should be centered horizontally across the bar code When ALD is enabled the reader does not read matrix or postal codes To Decode a Bar Code The imager faces straight out the top panel The aiming beam should be oriented in line with the bar code to achieve optimal decoding A range of 4 10 inches 10 25 cm from the bar code is recommended 1 Pointthe Dolphin terminal directly at the bar code Project the aiming beam or pattern by pressing and holding the SCAN key The scan LED lights red Center the aiming beam over the bar code see Aiming Options on page 4 5 When the bar code is successfully decoded the decode LED lights green and the terminal beeps gt O w PY The bar code information is entered into the application in use Aiming Options The aiming beams are smaller when the terminal is held closer to the code and larger when it is farther from the code Symbologies with smaller bars or elements mil size should be read closer to the unit whereas symbologies with larger bars or elements mil size should be read farther from the unit 5100 Green Aiming Beam Linear Bar Code 2D Matrix Symbol Ea 5300 Red High Vis Aiming Pattern If your Dolphin terminal is configured with a 5300 imager high vis aimers frame the bar code for more intuitive aiming e coneses S won DGS ee assessors Capturing
126. y ok Clock amp Alarms O GMT B Pacific LS 7 12 06 33 PM 1 14 2002 O Visiting 20533m aly The time zone defaults to GMT 5 Eastern US tap the arrow to the right of GMT 5 Eastern US to select another time zone Set the correct time and date in the remaining fields and tap OK to save Today Screen After the Dolphin terminal initializes the first time you see the Today screen Start Al ot Yy AE a Wednesday 5 57 AM January 16 2008 gt Ow Phone off On Tap here to set owner information No unread messages Mo tasks Mo upcoming appointments x ES Device unlocked Notification Contacts You can also display the Today screen anytime by tapping Start and then Today Navigation Bar The Navigation bar is located at the top of the screen that displays the active program and current time It also provides access to the Start menu which allows you to open programs and access the system settings Start menu Grants Se Start mg Icons here indicate access to system ii the status of various functions system functioning Command Bar The Command bar is located at the bottom of application windows The Task tray er a displays icons for Notification Contacts programs running in the background Menus change according to the open application Icons in the Navigation Bar Indicator Meaning m pome a pee ooo pee e p e peee oo e po o dps ooo a mem
127. ys ALPHA Key D The ALPHA key enables you to toggle between the alpha and numeric modes e Single tap ALPHA to switch only the next key pressed to alpha mode e Double tap ALPHA to switch the keyboard to alpha mode Alpha mode is when you type letters with the letter keys Numeric mode is when you type numbers with the letter keys On the 35 key keyboard numeric mode is the default 35 Key Keyboard Combinations ee C qe e II IT esc Eme Emp Eme Em Toggles Keyboard Backlight On Off w mo Jum o To sar m foe O en enten ener Ener ner ier eoe dm Que que ur que o w o o Ju o omeo e Dom Dom oom Dom Bown ake Bown noe rot fao am fa fam O 1 A JIN Toro Ja E Jrons To CR CO O e e O Soo o quam e O a Period pero gt pero gt a CE CR E ET l e Je leme lala ES E CS eo O o NM Ms po oO e e e E Co SO A E TA ERC LA TI os js ju ee Ee 5 6 BK Bostpace Bucapeco Becepaco Becispecs paee pee pee CC r me fe o pe po o po aro um o Qu Do o po 43 Key Alpha Numeric Keyboard Power key SCAN key Navigation keys Escape key rs Backlight key lt NUM Lock key __ Tab key Tas ae key ax TTO O MIONO CHOTOTON D 7 a Secco te O D Ri pais CTRL Blue Red SFT Modifier keys Number Lock NUM Key um The Number Lock key enables you to toggle between the alpha and numeric modes Alp

Honeywell DOLPHIN 9900

Contents

Download Pdf Manuals

Related Search

Related Contents