Home
Initial IDM-835 8.5" PORTABLE DVD PLAYER
Contents
1. eld sieielese 34 BIPRECAUTIONS FOR DISC 34 BIIROUBLESHOOTING PERSWSVEACRPRERKPPINU E EUR KM Acai lars iors cee NU ERR RN ERPSERIN UFU Him SIGIA NE D RN Ene OPE T UR REPE 34 SPECIFICATIONS E 35 13 U SING THE BATTERY PACK O AX Y o 36 14 USING AN OPTIONAL TV TUNER EEN 37 ix Initial IDM 835 2 0054 2 11 19 AM 72 SAFETY PRECAUTIONS N CAUTION RISK OF ELECTRIC SHOCK DO NOT OPEN CAUTION e The lightning flash with arrowhead symbol within an equilateral triangle is intended to alert the user to the presence of uninsulated dangerous voltage within the product s enclosure that may be of sufficient magnitude to constitute risk of electric shock to persons e The exclamation point within an equilateral triangle is intended to alert the user to the presence of important operating and maintenance servicing instructions in the literature accompanying the product WARNING To reduce the risk of fire or electric shock do not expose this apparatus to CAUTION r
2. 2 Use the number buttons on the remote to enter the track number you entered appears in the box The screen shows Program Track 01 20 011 08 E n 08 09 T NEXT gt gt 3 The cursor jumps to the next spot in the program list section Make sure the box 1s highlighted and enter your next track 4 Continue adding tracks until your program is complete You can play you program by highlighting START and press PLAY Note If the tracks you want to program are more than 10 you can highlight NEXT and press PLAY to go to the next page 5 To remove program playback press the STOP button twice during the program play Initial IDM 835 20054 2 11 19 AM Ti 32 PLAY DISCS IN VARIOUS WAYS SHUFFLE OR RANDOM PLAY DIGEST PLAY C CD DVD CD This function can be used to look through the content of the track or disc The unit can play by random orders The order is different each time PLAYING DVD 1 Press DIGEST while a disc is playing 1 Press PLAY MODE to select shuffle or DIGEST random play mode while a disc is playing PLAY MODE The screen shows Select Digest Type The screen shows Title Digest Chapter Digest Title Interval Shuffle OR Random Chapter Interval Use the w or A buttons to select TITLE DIGEST and press PLAY to confirm 2 press gt PLAY to start shuffle or random play The unit begins to look through the
3. 1 2 4 2 Press gt PLAY to play normally Initial IDM 835 20054 2 11 19 AM 727 PLAY DISCS IN VARIOUS WAYS REPEAT PLAY DvD This function can be used to repeatedly play a title chapter track disc or some part on a disc PLAYING A DISC REPEATEDLY DVD You may repeat a title or chapter 1 Repeat a chapter Press the screen will show REPEAT 2 Repeat a title Press twice the screen will show REPEAT 3 Repeat all Press third time the screen shows ALL 4 Remove REPEAT function Press until ALL disappears CD e You may repeat a track a disc according to the following steps 1 Repeat a track Press the screen shows C 2 Track The unit plays the current track pO REPEAT 2 Repeat a disc Press REPEAT the screen shows C D ALL The unit plays all the tracks on the disc C 2 ALL REPEAT 3 Remove REPEAT function Press REPEAT till C 2 ALL disappears REPEAT SOME PARTS You may press to enjoy some parts repeatedly when playing a disc PLAY DVD or CD 1 Set a starting point A The screen shows A B 2 Set an end point B The screen shows A B Afterwards the unit plays from A to B 3 Press Jagain till 2 AB disappears Initial IDM 835 20054 2 11 19 AM 7 28 PLAY DISCS IN VARIOUS WAYS SELECT SUBTITLES C This operation works only with discs on which multiple subtitle
4. 7 Water and moisture Do not use this product near water for example near a bath tub wash bowl kitchen sink or laundry tub in a wet basement or near a swimming pool and the like 8 Accessories Do not place this product on an unstable cart stand tripod bracket or table The product may fall causing serious injury to a child or adult and serious damage to the product Use only with a cart stand tripod bracket or table recommended by the manufacturer or sold with the product Any mounting of the product should follow the manufacturer s instructions and should use a mounting accessory recommended by the manufacturer 9 A product and cart combination should be moved with care Quick stops excessive force and uneven surfaces may cause the product and cart combination to overturn 10 Power Sources This product should be operated only from the type of power source indicated on the rear panel If you are not sure of the type of power supply to your home consult your product dealer or local power company For products intended to operate from battery power or other sources refer to the operating instructions 11 Grounding or Polarization This product may be equipped with a polarized alternating current line plug a plug having one blade wider than the other This plug will fit into the power outlet only one way This 1s a safety feature If you are unable to insert the plug fully into the outle
5. 2 Yellow plug connect to the VIDEO IN jack of the TV 3 Red plug connect to the LINE IN R jack of the amplifier 4 White plug connect to the LINE IN L jack of the amplifier 5 If your amplifier has coaxial digital input terminal you can connect the DVD player to the amplifier with a coaxial cable through the coaxial terminal 10 Initial IDM 835 200542 11 19 AM PREPARATIONS BEFORE OPERATION USING REMOTE CONTROL Referring to the diagram open the battery compartment of the remote control insert the 3 volt lithium flat battery CR 2025 or equivalent with the Positive marking facing the rear of the remote 2 To use the remote control point it at the remote sensor of the unit operate in the range of 5 meters and 60 3 Generally batteries last for about one year replace the batteries if the remote control does not work 4 Remove the batteries 1f remote control is not used for a long time dd s Initial IDM 835 200542 11 19 AM 112 PREPARATIONS BEFORE OPERATION PLAYABLE DISCS TYPE DISC LOGO CONTENT SIZE PLAYING TIME about 2hrs single side disc audiot video about 4hrs double side disc motion pictures TEE POE about 80mins single side disc about 160mins double side disc 12cm about 74mins we about 20mins 2 cm e The marks shown in the following chart are used in the manual MARK INDICATION functions of DVD funct
6. Initial IDM 835 200542 11 19 AM Wl TABLE OF CONTENTS 1 SAFETY PRECAUTIONS E PA E T A T E DA RDNDEDA ADMIN E A E A T ETE MIA E I 2 2 IMPORTANT SAFETY INSTRUCTIONS 4 3 FEATURES 6 4 DEFINITION OF TERMS 6 5 NAME OF PARTS T UNIT T CONTROL M 8 6 CONNECTIONS o m v 9 T PREPARATIONS BEFORE OPERATION P 11 BIUSING REMOTE CONTROL 11 DIS O eaa E E E E E 12 8 BASIC OPERATIONS 13 BBBEFORE OPERATION M M
7. Parental 08 1G 2 3 PG 4 PG 13 5 PGR 6R 7 NCIT7 8 ADULT Default Reset Main Page i DA LANGUAGE SELECTION The IDM 835 is capable of outputting any spoken language that is in the Audio section of the preference page as long as it is a recorded audio track on the media being played The IDM 835 is also capable of displaying any written subitles that is in the Subtitle section of the preference page as long as it is a recorded subtitle track on the media being played PARENTAL LOCK The Parental Lock function 15 used to customize playback by not allowing particular rating media to be played on the IDM 835 To set a particular rating of media to be played follow the following steps Navigate to the Parental section on the Preferences Page Select the rating that is desired and press the play button The player will prompt your security password Enter the security password then press the play button Note Media that is rated higher than the set rating in the parental lock menu will require the security password 99999 in order to be played DEFAULT gt gt RESET Each function setting returns to the initial status in the factory if you select this option Note e PREFERENCES only can be selected after the unit goes into stop mode Initial IDM 835 20054 2 11 19 AM 725 PLAY DISCS IN VARIOUS WAYS AUDIO MODE DVD WHEN PLAYING CD Co AUDIO MODE
8. 1 Press on the remote to bring up the Display 2 Highlight the L R icon on the Display Initial IDM 835 20054 2 11 19 AM MH18 BASIC OPERATIONS 3 The audio channel choices appear in the text box Press the A or V buttons to scroll through the choices LEFT MONO RIGHT MONO MIXED MONO or STEREO Whater choice is displayed becomes the active choice Using the Repeat Feature The default mode for the Repeat feature is off There are two Repeat options for CDs All repeats the disc that is playing Track repeats the track that is playing To Use Repeat 1 While a disc is playing press OSD on the remote to bring up the Display 2 Highlight the Repeat icon 3 Press the A or V buttons to scroll through the Repeat options until the Repeat option you want is displayed in the text box 4 The selected repeat option will loop repeatedly until you turn Repeat off DVD MENU PLAY C5 some DVDs have title menus and chapter menus Press PLAY the screen shows the menu Press gt gt or 44 to skip the next or previous page select with number buttons or direction buttons Example select track 13 1 Press gt gt to enter the next menu 2 Press number buttons to select directly You can also do as follows 1 Press V to select track 13 2 Press gt PLAY to start playing track 13 Press TOP MENU once to return to the title menu Press once to return to the root me
9. MR 13 DISC 13 WFT PICTURE ADJUSTMENT A ROO 14 DISC H P 15 BIPAUSE mener 15 X p M 15 lBIDVD MENU PLAY eene 18 551 WITH NUMBER BUTTONS eene 18 9 FUNCTIOKL SETTING eee eee eee 19 SETTING 19 24 TO PLAY DISCS 22 DUAE 25 MAUDIO MODE WRSWPEANWRARARSRSERFSREERTEERERFEREKETQRSERSERERRRERCERTOREERTORCERFRECXRTUASERNGREKRFENE RRERSERSSRSFKAFRAEERTUNSKRSERERARRACFAETCOREEKTER E Rees 25 MTS 26 26 27 Se 28 5 ANGLES 28 WR Ime m rien COLO OD 29 rem 30 PLAY v H U 30 BPROGRAM PLAY EET 31 BE OR RANDON PLAN go BIDIGESTIPEAY rec DUNEDIN EMEN 32 AP OPEP AT N 33 EEEE EEEE EEEE dietum tme 34 WACCESSORIES
10. PAUSE 13 FF FR SEARCH 14 PREV NEXT SKIP 15 STOP 16 RETURN 17 ZOOM 18 A B REPEAT 19 REPEAT 20 MENU 21 CLEAR 22 TIME SEARCH 23 NUMBER BUTTONS 24 LANGUAGE 25 ANGLE 26 REMOTE TRANSMITTER Initial IDM 835 200542 11 19 779 CONNECTIONS USING AC ADAPTOR The unit can use special applied AC adaptor 1 Insert the AC adaptor into DC IN jack of the unit 2 Insert the adaptors plug into any 110 volt household power socket wall plug At this time the unit will work normally Note Turn off the unit before unplugging the AC adaptor from the unit so as to avoid the unit being damaged USE HEADPHONES gt e Insert headphones into the phones jack of the unit e Turn off the power when inserting or removing headphones Initial IDM 835 20054 2 11 19 AM 7 810 CONNECTIONS CONNECT TO TV The AV cords are connected according to diagram C 1 Mini plug connect to the AV OUT jack of the unit 2 Yellow plug connect to the VIDEO IN jack of the TV 3 Red plug connect to the AUDIO IN R jack of the TV 4 White plug connect to the AUDIO IN L jack of the TV CONNECT TO AND AMPLIFIER gt D The AV cords are connected according to diagram D 1 Mini plug connect to the AV OUT jack of the unit
11. language are recorded PLAY DVD 1 Press SUBTITLE repeatedly until the desired language 15 selected The screen shows SUBTITLE Subtitle 01 03 ENGLISH 2 Remove the subtitle Press SUBTITLE until the screen shows subtitle Off Notes For some discs subtitles can not be removed Different discs differ in the language of subtitles f the subtitles of discs can not be selected press SUBTITLE the screen shows gt o 228 ANGLES SELECT Some discs have images with different viewing angles you may select among them For example when you watch a running train you may watch it from the front the left window or the right window without stopping it Example A DVD has four viewing angles at your option Press to select ANGLE1 SCREEN 1 4 2 Press to select other angles the screen shows respectively 2 4 select ANGLE2 3 4 select ANGLE3 EH 4 4 select ANGLEA 3 resume normal playback press to select original angle Initial IDM 835 20054 2 11 19 729 PLAY DISCS IN VARIOUS WAYS TIME SEARCH D lt PLAY CD TIME SEARCH To jump to a specific time use You may directly enter a time title or chapter i a 2 2207 ocation number to ae fast on a disc the unit plays Example Play from 00 01 38 of track 6 from
12. or near heat sources Never connect the positive and negative poles with metal Do not open the battery refer servicing only to qualified service personnel 36 P Initial IDM 835 200542 11 19 AM 1737 USING AN OPTIONAL TV TUNER VOLUME AV OUT COAXIAL DC OUT 5V AVIN DC IN 9V TV TUNER pa Optional R AUDIO L VIDEO 1 Connect the DVD player DC OUT to the TV tuner DC IN with a power connecting cable 2 Connect the DVD player AV IN to the TV tuner AV OUT with an AV connecting cable 3 Connect the antenna terminal from an antenna or cable satellite receiver to the antenna input terminal on the TV tuner 37
13. AVER Start the screen saver the screen saver image appears when the unit stops or the image is frozen for a few minutes This saver can keep the screen from being damaged ON Start the screen saver OFF Remove the screen saver AUDIO SETUP The setting structure is Audio Setup Page Speaker Setup Dolby Digital Setup Channel Equalizer 3D Processing Main Page Initial IDM 835 20054 2 11 19 AM MH22 FUNCTION SETTING SPEAKER SETUP EQUALIZER The setting structure is This will help you to select graphic equalizer patterns according to the genre of the music Speaker Setup Page Downmix STR Lt Rt Stereo Audio Setup EQ Type None A disc recorded multi channel soundtrack the output signal will be incorported to left and right channel e STEREO A disc recorded multi channel soundtrack the output signal will be incorported to stereo DOLBY DIGITAL SETUP The setting structure is Audio Setup Dolby Digital Setup Dual Mono STR Stereo e Left Mono PEE The setting structure is You can select music being played and adjust the equalizer Channel Equalizer None Rock Pop Live Dance Techno Classic Soft category by pressing the Right Mono direction buttons and confirm by pressing the Mixed Mono PLAY button D R C Audio Setup DUAL MONO This is the output mode of the L and R signals of the set
14. EN PLAYING DVD 1 Press PLAY MODE until the screen shows Program TT 20 CH 01 TT CH 06 TT __ 02 TT CH 07 TT 03 TT 04 TT _ 05 TT _ CH _ CH _ CH CH CH NEXT 08 CH 9 CH 10 TT TI TT 2 Use the number buttons on the remote to enter the title and chapter you want to play first The title and chapter number you entered appears in the box The screen shows Program TT 20 CH 01 TT 0 8 CH 01 06 02 T 07 TT _ 3 TT CH __ 08 TT __ TT CH 09 TT TT CH 10 TT Exit CH _ CH _ CH _ CH _ CH NEXT gt gt Start 3 The cursor jumps to the next spot in the program list section Make sure the box is highlighted and enter your next track 4 Continue adding titles and chapters until your program is complete You can play your program by highlighting START and press Note If the titles and chapters you want SIE to program are more than 10 you can highlight NEXT and press PLAY to go to the next page 5 To remove program playback press the button twice during the program play WHEN PLAYING CD 1 Press PLAY MODE until the screen shows Program Track 01 20 O1 _ 02 03 04 05 NEXT
15. Main Page Go To Speaker Setup Page e Press direction buttons Y or A to highlight Dolby Digital Setup and press PLAY to enter Dolby Digital Setup Page The screen shows the submenu for your selection The screen shows O i3 Dolby Digital Setup Dual Mono STR Stereo Left Mono Right Mono Mixed Mono D R C Audio Setup Press direction buttons V to select Left Mono The screen shows 0 93 Dolby Digital Setup Dual Mono STR Stereo Left Mono Right Mono Mixed Mono D R C Audio Setup 10 Initial IDM 835 20054 2 11 19 AM 7720 FUNCTION SETTING e Press gt PLAY to confirm your selection Set GENERAL SETUP Dual Mono in Dolby Digital Setup to Left Mono The setting structure is as follows The screen shows General Setup Page 360688 Dolby Digital Setup Dual Mono L Stereo TV Display Wide Normal PS Normal LB Wide SPDIF RAW Off SPDIF RAW SPDIF PCM Left Mono Right Mono Mixed Mono D R C Audio Setup 3 Exit setup menu Captions Press the direction button lt to exit from Dual Mono e Press the direction button lt to exit from Screen Saver On Dolby Digital Setup Press the direction button V to highlight Main Main Page Page and press PLAY The screen shows LU 0 aag Setup Page Main Page i TV DISPLAY General Setup 1 NORMAL PS Audio Setup This is selected when the u
16. You may select a needed language from a a multi language DVD You may select the right channel or left channel or stereo from a multi channel CD AUDIO MODE WHEN PLAYING DVD Press LANGUAGE the screen shows orderly AUDIO MODE Audio 1 2 AC3 5 1CH AUDIO MODE Audio 2 2 AC 3 5 1CH You may select one mode Different discs differ in languages Press AUDIO the screen shows Notes orderly Different discs differ in languages Mono Left Mono Right Mix Mono Stereo 25 Initial IDM 835 20054 2 11 19 726 PLAY DISCS IN VARIOUS WAYS FAST PLAY CDVD CD When playing a disc you may play it forward fast or reverse it fast to find what you want WHEN PLAYING DVD OR CD 1 Press gt to play forward fast Each time you press the button the screen shows orderly pr 2X 4X 8X gt gt 16X gt gt 32X op 2 Press lt lt to reverse the disc fast Each time you press the button the screen shows orderly Qs 2 Q lt lt 4x Ge 8x 2 lt lt 16X e 32x gt 3 Press gt PLAY to switch to normal play while FF or FR playing 26 SLOW PLAY Cc Enjoy slow motions by the following steps WHEN PLAYING DVD 1 Press SLOW to play slowly SLOW The screen shows orderly non I 1 4 1 8 1 16 lt 41 1 16 lt a 1 8 lt a 1 4
17. ain or moisture Apparatus shall not be exposed to dripping or splashing WARNING and no objects filled with liquids such as vases shall be placed on the apparatus blade plug to wide slot fully insert To prevent electric shock match wide The unit employs a laser system To ensure the proper use of the unit read this manual carefully and keep it for future reference If the unit requires servicing contact the seller or our service center see troubleshooting To prevent direct exposure to the laser radiation do not open the cabinet Invisible laser radiation when the cabinet is opened or the interlocks are defeated Do not stare into the laser beams Use of any controls adjustments or procedures other than those specified herein may result in hazardous radiation exposure Any change or modification to the unit not expressly approved by Initial Technology Inc or its authorized parties could void user s authority to operate the unit Initial IDM 835 20054 2 11 19 AM 5 SAFETY PRECAUTIONS POWER SOURCES This unit operates on a supplied AC adaptor car adaptor and chargeable batteries e Make sure that the input voltage of the AC adaptor 1s in line with the local voltage Otherwise the AC adaptor and unit may be damaged e Do not touch the AC adaptor with wet hand so as to avoid electric shocks e When connecting with car power cigaratte lighter adaptor be sure the input voltage of the ada
18. an store up to l or motionless picture 12 bookmarks per disc When you turn the player off or remove the disc bookmarks are cleared Storing a Bookmark 1 Press ZOOM during playback 1 While a disc is playing press on the the screen shows remote 2 The Bookmark Menu appears A OX 3 When you reach the scene you want to mark press 4 If you want to mark another point press the button to move the cursor to next spot When you reach another scene you want to mark press The picture is enlarged twice the size PLAY 2 Press ZOOM again the screen shows 5 Press RESUME to make the Bookmark Menu disappear from the screen and resume to normal Q 3X playback Using a Bookmark 1 While a disc is playing press RESUME on the remote The picture is enlarged three times the size Note The unit has six zoom steps 2X 3X 4X 1 2 1 3 and 1 4 3 Push 4 V to move the enlarged 2 The Bookmark Menu appears 3 Use the direction buttons to highlight the bookmarked scene you want to activate Press to go to the place you marked picture 4 resume the picture push ZOOM until the picture is in normal size 30 Initial IDM 835 20054 2 11 19 MH31 PLAY DISCS IN VARIOUS WAYS PROGRAM PLAY CP P ct To use the program playback feature you must enter the order in which you want the titles and chapters on the DVD or the tracks on the CD to play by creating a program WH
19. audio output If it is set to MIXED MONO the function only works when the DVD being played is 5 1 channel e D R C This 1s selected to adjust linear compression rate to obtain the different compression results of the signals 2054 Initial IDM 835 20054 2 11 19 AM 23 FUNCTION SETTING 3D PROCESSING The setting structure 1s 3D Processing Page V SURR Off On Off Off Concert Reverb Mode Off Living Room Hall Bathroom Cave Arena Church Audio Setup e VSURR Use to turn Virtual Surround on and off e REVERB MODE Use to select a Reverb Mode that you want to use PASSWORD SETUP The setting structure is Password Setup Page PW Mode Off On Password Change Main Page PASSWORD MODE e The password works PARENTAL is dim and can not be selected e OFF The password is locked PARENTAL can be selected PASSWORD CHANGE Select this to adapt the code the screen shows Old Password New Password Confirm PWD Enter a password according to the screen Note The password is automatically factory set to 99999 2 Initial IDM 835 20054 2 11 19 7 24 FUNCTION SETTING PREFERENCES The setting structure 15 Preference Page Audio ENG English French Spanish Chinese Japanese Subtitle ENG English French Spanish Chinese Japanese Off Disc Menu English French Spanish Chinese Japanese
20. ch paper or tape to the disc e Make sure the audio output mode is set correctly e Make sure the audio connection between the unit and amplifier is right Disc can not be played e There is no disc in the unit e Put the disc on the disc tray properly with e Keep the disc away from direct sunlight or the label side up heat sources Clean the disc e Store the disc in a disc case after playback e Moisture has condensed in the unit CLEANING DISC Remove the disc and leave the unit on for e Before playback wipe the disc outwards from about one hour the center with clean cloth Remote control does not work e Remove barriers between the remote control and the unit e Point the remote control at the remote control sensor of the unit e Replace the batteries with new ones Image rolls and no color The color system of the unit doesn t match with that of TV Please select the correct TV TYPE until TV shows normal color OA Initial IDM 835 20054 2 11 19 AM 755 OTHERS TECHNICAL SPECIFICATIONS Output level 2V 10 analog audio Load impedance 10 Audio out Output Rs ani Output level 0 5Vp p Output level 1Vp p 20 Load impedance 75 imbalane negative polarity Power supply DC 9V 2A Allowable motion Power Consumption lt 20W This manual is only for your reference any change to the design and specifications will not be advised This product incorporates copyri
21. determine that the product is in proper operating condition 21 Heat The product should be situated away from heat sources such as radiators heat registers stoves or other products including amplifiers that produce heat 22 During playback few bright or dark flecks may appear on the TFT LCD which is a normal phenomenon in active matrix display technology but not a malfunction FEATURES 1 HIGH DEFINITION The unit adopts MPEG2 coding format and brings the horizontal resolution over 500 lines 2 UNIQUE FUNCTIONS Multi angle and multi language brings unique trick functions Parental lock makes it easy to control the content of discs 3 ZOOM The IDM 835 has a unique feature that can zoom multi media playback 2X 3X or 4X the original size It can also shrink multi media playback by 1 2 1 3 or 1 4 the original size 4 MULTI FUNCTIONS Fast forward fast reverse slow play frame play repeat play and program play 5 TIME SEARCH It can search a specific part on a disc especially good for watching action movies 6 CONTENT DISPLAY 8 TFT LCD and English OSD makes the disc content clearer 7 AUDIO OUTPUT Analog audio output coaxial digital audio output can be connected with any amplifier to enjoy high quality sound effects 8 TFT color LCD chargeable batteries headphone output convenient for enjoying great pictures and beautiful music on the way DEFINITION OF TERMS e TITLE The
22. e moisture will condense on the pickup lens and result in malfunction or playback difficulties In this case unload the disc and leave the unit on for about one hour to evaporate the moisture Keep dust from the pickup lens Keep the disc tray closed after use If there 1s dust on the pickup lens use a cleaning disc to clean them Please refer to the operation instructions of the cleaning disc you bought WHEN USING HEADPHONES e To avoid hearing damages caused by sudden big volume keep the volume at the lowest level before play back Then adjust it to needed level e Keep the volume lower to protect your ears e Never wear headphones when driving or riding bicycle so as to avoid traffic accidents Initial IDM 835 20054 2 11 19 AM 74 IMPORTANT SAFETY INSTRUCTIONS 1 Read instructions AII the safety and operating instructions should be read before the product is operated 2 Retain instructions The safety and operating instructions should be retained for future reference 3 Warnings All warning on the product and in the operating instructions should be adhered to 4 Follow instructions All operating and use instructions should be followed 5 Cleaning Unplug this product from the wall outlet before cleaning Do not use liquid cleaners or aerosol cleaners Use a damp cloth for cleaning 6 Attachments Do not use attachments not recommended by the product manufacturer as they may cause hazards
23. es orange When the charging is completed the indicator turns off Notes 1 While the charge is in progress do not disconnect the AC adaptor and the power cord until the CHG indicator turns off The charging time of a battery pack 15 approximately 4 5 hours depends on environmental conditions 2 The attached battery pack may get warm when you are charging it or operating the player This is not a defect 3 The battery indicator is shown on the screen when the power in the battery pack is running low r a X TS 5 g DETACHING THE BATTERY 1 Turn the player off 2 Disconnect the AC adaptor and the power cord from the player 3 Turn the player upside down 4 Slide the battery pack s lock switch in the open direction then slide the player in the correct direction to remove it g PLAYBACK TIME Generally after the battery pack is recharged its continuously working time is as follows For example Model Operating status Continuous playing time IDM 835 Play DVD TFT on about 2 5 hours Play DVD TFT off about 4 hours g CONDITIONS AND ATTENTION While using the battery pack the environmental temperature should be 5 C 41 F to 35 C 95 F A newly purchased battery pack can only be used after being charged To undertake the longest service life of the battery pack charge it under or close to indoor temperature Never dispose of in fire water or heat up Do not use in high temperature
24. eys at this point will toggle between Normal and Full Wide Note During playback few bright or dark flecks may appear on the TFT LCD which is a normal phenomenon in active matrix display technology but not a malfunction s fd Initial IDM 835 20054 2 11 19 AM 7815 BASIC OPERATIONS PLAYING DISCS c 5 lt gt 1 Load a disc and press PLAY to play the disc 2 Stop playback Press Bl 3 Remove the disc and switch off the unit e You have to press this button twice to stop the playback of DVD discs PAUSE D cD Press WHEN PLAYING PICTURES If the pictures of DVD are played press IT to make playback pause The unit enters step play status Each time you press the picture advances one frame e WHEN PLAYING MUSIC CD Press T to make playback pause Press PLAY to resume playback T did DD co The On Screen Display OSD contains many playback features To see the Display press the button on the remote while a disc is playing The Display appears across the top of the screen Each feature is illustrated with an icon Use the 4 or gt buttons on the remote to move through the different icons in the Display When an icon is highlighted use the A or Y buttons on the remote to scroll through the choices displayed in the text box under the icons Remember you can only access the Display when you re playing a disc Also the Display features are only available if
25. ght protection technology that is protected by method claims of certain U S patents and other intellectual property rights owned by Macrovision Corporation and other rights owners Use of this copyright protection technology must be authorized by Macrovision Corporation and is intended for home and other limited viewing uses only unless otherwise authorized by Macrovision Corporation Reverse engineering or disassembly 15 prohibited Y T Initial IDM 835 200542 11 19 AM 136 USING THE BATTERY Attach the battery pack properly following the explanation below Make sure that the battery pack is attached firmly to the player when using it Otherwise the battery may become detached and cause person injury Charge it before using ATTACHING THE BATTERY PACK First disconnect the AC adaptor and the power cord from the player then attach the battery pack 1 Turn the player off 2 Turn the player upside down 3 Insert the battery pack s catches into the player s corresponding holes Then slide the battery pack until it is attached firmly Note Remove the battery pack from the player after being used mm ki 1 g CHARGING THE BATTERY PACK 1 Turn the player off The battery pack will charge only when the POWER to the player is turned OFF 2 Attach the battery pack to the player 3 Connect the supplied AC adaptor and the power cord to the player Charging starts and the CHG indicator illuminat
26. images or music of a DVD are divided into some units among which title is the biggest one To an image in video software title is movie to a piece of music audio software it is music CHAPTER It is smaller than title among the units of a DVD A title is made up of several chapters and each chapter has a number for search But some discs may not have numbered chapters e TRACK The music in a CD Each track has a number for search STRUCTURE OF DVD STRUCTURE OF CD Initial IDM 835 20054 2 11 19 AM 777 OF PARTS 17 18 19 20 21 22 23 24 E MAIN UNIT 1 TFT LCD 14 MONITOR 2 OPEN 15 SOURCE AND 44 3 SPEAKER 16 VOLUME 4 PREV NEXT 17 AV OUT 5 POWER CHG INDICATOR 18 COAXIAL OUT 6 PLAY 19 DC OUT 7 PAUSE 20 AV IN 8 STOP 21 DC IN 9 REMOTE SENSOR 22 PHONE 1 10 TOP MENU 23 PHONE 2 11 MENU 24 POWER ON OFF 12 DIRECTION BUTTONS 13 ENTER Press the SOURCE button to shift the signal source between DVD AV OUT and AV IN Initial IDM 835 20054 2 11 19 AM 78 NAME OF PARTS f 1 2 3 4 050 PLAY MODE AUDIO MODE RESUME DIGEST SUBTITLE LANGUAGE ANGLE 8 25 CONTROL 1 OSD On Screen Display 2 SUBTITLE 3 PLAY MODE 4 AUDIO MODE 5 RESUME 6 DIGEST 7 TITLE 8 PLAY 9 DIRECTION BUTTONS 10 SETUP 11 SLOW 12
27. ions of CD Initial IDM 835 200542 11 19 AM 713 BASIC OPERATIONS Q POWER ON OFF OPEN BEFORE OPERATION gt A 1 Turn on the power 2 Open the cabinet cover 3 Set POWER ON 4 Turn VOLUME to adjust volume including when using headphones 5 When the unit is connected to a TV or an amplifier adjust the volume according to owner s manual and set TV to AV mode LOADING DISC gt 1 Press OPEN to open the disc tray 2 Hold the edge of the disc to put it in the center with the printed side up 3 Close the disc tray wait until it clicks 18 2 Initial IDM 835 20054 2 11 19 AM 7714 BASIC OPERATIONS MONITOR The IDM 835 display can be adjusted for Brightness Color intensity and Display mode Full amp Normal using the following technique 1 Brightness Use the Monitor button located on the main control panel of the IDM 835 Pressing it once will take you to the brightness level control screen By using the arrow keys 4 gt you can raise or lower the brightness level 2 Color level Use the Monitor button again Pressing it twice will take you to the color level control screen By using the arrow keys 4 gt you can raise or lower the color level 3 Monitor Mode The IDM 835 s monitor may be changed to display in either Normal 4 3 or Full Wide 16 9 To set this option push the Monitor button 3 times until the Monitor Mode display is on screen Pushing the arrow k
28. lect a song Press gt PLAY button to start playback 4 Press A or V button to select other tracks and press PLAY button to play 5 In stop mode select the folder icon on the left side then press PLAY button to return to the main menu Ca wave 11 wave 12 wave 13 wave 14 wave 15 6 Press ori to play previous or next songs OTHER FUNCTIONS During playback MP3 discs the unit features volume control repeat play and etc Operations are the same as CD Initial IDM 835 20054 2 11 19 AM 34 OTHERS ACCESSORIES TROUBLE SHOOTING Check if you have all the accessories after the If you experience the following problems while carton 1s opened using the unit this troubleshooting guide can help e AV cable 1 YOM e Remote control 1 sound Check if the unit is connected securely e Owner s manual 1 SAC pwe adai 1 e Check 1 the vou of headphone 15 set to MIN when using headphone e Rechargeable battery pack 1 e Make sure you operate the or amplifier e Warranty card 1 l correctly e Car cigarette adaptor 1 e Make sure you have selected DVD player position on the amplifier No image PRECAUTIONS FOR DISC HANDLING DISC To keep the disc clean do not touch the Check if the unit 1s connected securely e Make sure you operate the TV correctly e Make sure you set the color system correctly play sides of the disc Bad sound quality e Do not atta
29. nit is connected Preferences to a normal TV Password Setup Wide screen images are shown on the screen Exit Setup but with some parts cut automatically Go To Audio Setup Page Press the direction button V to highlight Exit Setup and press gt PLAY to exit setup menu completely NOTE You can also keep pressing the direction button lt until the cursor is moved to the last icon illustrating Exit then press the PLAY button to exit setup menu completely 220 Initial IDM 835 20054 2 11 19 AM 721 FUNCTION SETTING 2 NORMAL LB This is selected when the unit is connected to a normal TV Wide screen images are shown on the screen with black belt on the top and bottom 3 WIDE This is selected when the unit is connected to a wide screen TV SPDIF OUTPUT e SPDIF OFF No signal is output from the digital port e SPDIF RAW Select this when the DVD player is connected with a digital amplifier through digital port When a Dolby Digital disc or MPEG disc are played the digital output will be optional The power amplifier to be connected must have Dolby Digital and MPEG decoding e SPDIF PCM Select this when the DVD player is connected with a 2 channel digital stereo amplifier When a Dolby Digital or MPEG disc is played the digital port will output in PCM 2 channel format CAPTIONS e ON The hidden subtitle is shown OFF The hidden subtitle is turned off SCREEN S
30. nu SELECT WITH NUMBER BUTTONS Sages Load a disc Press number buttons to select tracks after the unit finishes reading the disc 1 If the track number isn t over 10 just push buttons 1 10 Example push 8 to select track 8 The screen shows Track08 20 00 00 2 If the track number is over 10 press 10 once and a button among 1 10 Example if you select track 12 press 10 once and button 2 The screen shows Track12 20 00 00 194 Initial IDM 835 20054 2 11 19 AM 19 FUNCTION SETTING MENU SETTING Don es According to the recorded information and external equipment set the following functions for the player to obtain the best playing status 1 SETUP to set the main menu SETUP The main menu appears on the screen with icons across the top of the screen illustrating General Setup Audio Setup Preference Password Setup and Exit The screen shows e rms Setup Menu Main page General Setup Audio Setup Preferences Password Setup Exit Setup Go To General Setup Page 2 Press direction buttons V or A to select and press gt PLAY to confirm Example Select Audio Setup and do some setup Press direction button V to highlight Audio Setup press PLAY to enter Audio Setup Page The screen shows 9 EJ amp 3 Audio Setup Page Speaker Setup Dolby Digital Setup Channel Equalizer 3D Processing
31. ptor is identical with car voltage e Unplug the AC adaptor from the outlet or remove the chargeable batteries when the unit is not used for a long time e Hold the plug to disconnect the AC adaptor Do not pull the power cord ON PLACEMENT Avoid placing the unit in the following places e Under direct sunlight or near a source of heat such as a heater Never leave the unit in a closed automobile on a dashboard or a parcel shelf Excess heat may deform the cabin or cause malfunction Where it is very dusty or sandy Wet or humid places such as bathroom Near sources of strong magnetism such as television speaker or magnet Where there is a lot of movement or vibration such as on a car dashboard or an unstable shelf Where it is extremely hot or cold Where the unit is exposed to rain or water FOR SAFETY e Do not disassemble the unit for laser rays are dangerous to eyes e Any service should be done by qualified service personnel e Unplug the AC adaptor to cut the power if liquid or objects get inside the unit e Take care not to drop the unit or subject it to strong shocks which may cause malfunction Note When unit is in use for a long period of time the surface of the unit will be heated This should not effect the unit ability to playback MAINTENANCE FOR PICKUP e If the unit is suddenly moved from a cold place to a warm one to experience a rapid temperature change or the unit is put in a humid plac
32. rently being played 3 Press the or v buttons to scroll through the angle choices The angle number displayed in the text window is automatically shown 4 To make the Display disappear press thelOSD button on the remote Using the Repeat Feature The default mode for the Repeat feature 1s off There are three Repeat options 17 All repeats the disc that is playing Title repeats the title that is playing Chapter repeats the chapter that is playing To Use Repeat 1 While a disc is playing press on the remote to bring up the Display 2 Highlight the Repeat icon 3 Press the A or V buttons to scroll through the Repeat options until the Repeat option you want is displayed in the text box 4 The selected repeat option will loop repeatedly until you turn Repeat off How to Cancel Repeat There are three ways to cancel Repeat Press STOP twice Go to Repeat icon in the Display and select Off Eject the disc WHEN PLAYING CD CD discs have the following playback features Track L R Audio not available and Repeat CD Track L R Audio Repeat m amp Select a Specific Track 1 While the disc is playing press on the remote to bring up the Display 2 Highlight the Track icon 3 Press the A or V buttons to scroll through the track numbers Changing the Audio Channel Output If you are playing a Stereo CD you can change the channel output from the player
33. rough the DVD player menu Selecting the Subtitle Language If the disc was created with subtitles you can use the Display to change the Subtitle language Initial IDM 835 20054 2 11 19 AM 7817 BASIC OPERATIONS m When the disc is playing press on the remote to bring up the Display 2 Press the or buttons to highlight the Subtitle icon 3 Press the A or V buttons to scroll through the subtitle languages that are available on the disc until the subtitle language you want to use appears in the text box The subtitles will be shown in that language 4 To make the Display disappear press the button on the remote Notes Changing the subtitle language with the Display will only affect the disc currently being played When the disc 1s removed or the player is turned off the subtitle language will revert to the language setting specified through the DVD player main menu The subtitle language can also be changed through the DVD player menu Changing the Camera Angle Some discs contain multiple angles of a particular scene or sequence If the disc only has one angle this feature won t work When multiple angles are available to change the camera angle 1 When a disc is playing press 5 the remote to bring up the Display 2 The Angle icon will display the number of angles available For example if there are 3different angles the icon will read 1 of 3 This means angle 1 is cur
34. t try reversing the plug If the plug should still fail to fit contact your electrician to replace your obsolete outlet Do not defeat the safety purpose of the polarized plug 12 Power Cord Protection Power supply cords should be routed so that they art not likely to be walked on or pinched by items placed upon or against them paying particular attention to cords at plugs convenience receptacles and the point where they exit from the product 13 Lightning For added protection for this product during a lightning storm or when it is left unattended and unused for long periods of time unplug it from the wall outlet and disconnect the antenna or cable system This will prevent damage to the product due to lightning and power line surges Initial IDM 835 20054 2 11 19 AM 785 IMPORTANT SAFETY INSTRUCTIONS 14 Power Lines An outside antenna system should not be located in the vicinity of overhead power lines or other electric light or power circuits or where it can fall into such power lines or circuits When installing an outside antenna system extreme care should be taken to keep from touching such power lines or circuits as contact with them might be fatal 15 Overloading Do not overload wall outlets extension cords or integral convenience receptacles as this can result in a risk of fire or electric shock 16 Object and Liquid Entry Never push objects of any kind into this product through res
35. that point 1 Press button 6 to select track 6 The screen shows PLAY DVD 1 Search a title or a chapter Track 06 20 00 01 Example Search chapter 2 in title 6 Press TIME SEARCH the screen shows 2 Press TIME SEARCH SEARCH until the screen shows Title 03 30 Chapter 01 04 Track Go To Press the direction button and move A bres buton 0111 8 810 the cursor to illuminate the title number The sctecn chow The screen shows Title 03 30 Chapter 01 04 Track 06 20 01 38 The unit plays from 00 01 38 of track 6 after Press button 6 to select title 6 the screen setting shows Press to enter 0 Title 06 30 Chapter 01 04 Note CD discs have three options in time search function You can enter the elasped time of a disc to play Repeat the steps above select chapter 2 You can enter the elasped time of a track to in title 6 play Youcan go to a track you want play by entering 2 TIME SEARCH the track number Press TIME SEARCH until the screen shows e Press number buttons to enter hour minute and second Example Enter 1102 3 8 After setting the unit will play the disc from 1 02 38 2209 Initial IDM 835 20054 2 11 19 AM Diffj30 PLAY DISCS IN VARIOUS WAYS BOOKMARK D ZOOM PLAY Cs The bookmark feature lets you make a point on the This function can be used to watch a motion disc that you can go to quickly You c
36. the disc was created with that particular feature 1 e if you select the Subtitle icon you won t be able to change the subtitle language unless the author of the disc created the disc with subtitles The invalid symbol S appears on the screen when you press a button that doesn t have any function If one of the icons is grayed out that Display feature isn t available for the disc you re playing To make the Display disappear from the Screen press on the remote WHEN PLAYING DVD DVD discs have the following playback features Title Chapter Audio Subtitle Angle and Repeat DVD VIDEO 0 01 24 Title Chapter Audio Subtitle Angle Repeat 59 B0 Initial IDM 835 20054 2 11 19 AM 7816 BASIC OPERATIONS Bg Select a Title Some discs contain more than one title For example there might be four movies on one disc each movie might be considered a title Each title 15 divided into chapters To select a title 1 While the disc is playing press on the remote to bring up the Display 2 If the Title icon on the Display isn t highlighted use the or buttons to highlight it 3 Press the A or V buttons to go to the next or previous title Note Some discs only have one title B Select a Chapter Because DVD discs use digital technology a title can be divided into individual chapters similar to tracks on a CD You can skip to a specific chapter by using the Chapter feat
37. titles and shows the starting picture of each title on the The unit selects a track to play 3 Remove shuffle or random play screen When playing a DVD disc press Bl twice e When playing a CD disc press lI twice 6 Type Title Select 01 20 Exit Menu NEXT Each page has six pictures their location may be different 2 Use the direction buttons to select NEXT on the screen and press PLAY to go to the next page ye Initial IDM 835 20054 2 11 19 AM 7535 PLAY DISCS IN VARIOUS WAYS 3 To remove the digest feature use the direction buttons to select EXIT on the screen and press to confirm Note If you have stored bookmarks on a DVD disc there will be one more digest option BOOKMARK DIGEST PLAYING CD 1 Press DIGEST after the unit stops DIGEST The screen shows Scan The unit plays the first ten seconds of each track one after another 2 Remove digest play Press STOP digest play is removed and the unit stops Note A CD disc only has SCAN function 433 MP3 OPERATION SELECT TRACKS WITH MENU 1 Insert a disc the unit will search disc information The TV screen displays main menu 00 00 00 00 001 012 FOLDER Ca 2 Press direction key v to select song folder Press PLAY to confirm selection Example Select CD02 the TV screen displays 00 00 00 00 001 016 FOLDER L XCD02N u 3 Press direction buttons to se
38. ult in a fire or electric shock Never spill liquid of any kind on the product 17 Servicing Do not attempt to service this product yourself as it must be opened by qualified service personnel 18 Damages Requiring Service Unplug this product from the wall outlet and refer servicing to qualified service personnel under the following conditions a When the power supply cord or plug is damaged b If liquid has been spilled or objects have fallen into the product c If the product has been exposed to rain or water d If the product does not operate normally by following the operating instructions Adjust only those controls that are covered by the operating instructions as an improper adjustment of other controls may result in damage and will often require extensive work by a qualified technician to restore the product to its normal operation e If the product has been dropped or damaged in any way f When the product exhibits a distinct change in performance this indicates a need for service 19 Replacement parts When replacement parts are required be sure the service technician has used replacement parts specified by the manufacturer or have the same characteristics as the original part Unauthorized substitutions may result in fire electric shock or other hazards 20 Safety Check Upon completion of any service or repair to this product ask the service technician to perform safety checks to
39. ure in the Display 1 While the disc is playing press on the remote to bring up the Display 2 Press the buttons to highlight the Chapter icon 3 Press the A or V buttons to go to the next or previous chapter Notes The chapter feature won t work if the disc isn t formatted with separate chapters You can also advance to the next chapter by pressing on the remote and go to the preceding chapter by pressing 44 the remote 16 Changing the Audio Language If the disc was created with different language tracks recorded in different languages you can use the Display to temporarily change the DVD player s Audio Language setting 1 While the disc is playing press on the remote to bring up the Display 2 Press the or buttons to highlight the Audio icon The current audio language appears in the text box below the row of icons 3 Press the A or V buttons to scroll through the audio languages that are available on the disc until the audio language you want to use appears in the text box Audio will be played in that language 4 To make the Display disappear press the OSD button on the remote Note The language feature only works if the disc was created with multiple audio tracks When you choose an audio language from the Display you only override the audio language setting in the DVD player s main menu temporarily The audio language can also be changed th
Download Pdf Manuals
Related Search
Related Contents
Suppléments - Cameron Balloons France Fisher-Price 77768 Motorized Toy Car User Manual Mode d'emploi Maxtor DiamondMax Plus D740X (6L020J1) 20 GB Hard Drive Istruzioni per l`uso - Linea di bilance Classic Light MTD35S-45S MP - MOTOR PERSIANA Copyright © All rights reserved.
Failed to retrieve file