Home

Skil 5860 Saw User Manual

image

Contents

1. Pu Inter E p 12 42 au A E Select this option If you are scanning 1D only 1D labels 1D and 2D Standard all other cases 1D and 2D Bright Environment in high ambient light like outdoors in sunshine 1D and 2D Reflective Surface glossy labels Select Custom to access all standard imager settings such as Lighting Goal or Lighting Mode More information about these settings commands and parameters are found in the Intermec Computer Command Reference Manual available from the Intermec web site at www intermec com Keep your hand as steady as possible while scanning a label Position the imager as close to the bar code as possible while still being able to capture the entire bar code Enable only the bar codes that you need to use every day 751G Color Mobile Computer User s Manual 41 Chapter 3 Configuring the Computer Reading Distances 42 Typical reading distances are done in an office environment using office lights 4 lux Minimum distances are measured in the dark 0 lux Both reading distances are provided in respective scan engine integration guides Contact your Intermec representative for more information The minimum standard reading distances for 751Gs built with integrated scan engines are shown below When correctly mounted an exit window reduces reading distances by about 4 2D Area Imager Reading Distances with 0 04 Setbacks Symbology MaxiCode Data Matrix PDF
2. Call this function to determine whether the security supplicant is running Syntax Parameters UINT isSupplicantRunning None Return Values TRUE if the security supplicant is running FALSE if it is not running Remarks Definitions None ifdef DYNAMIC LOADING typedef UINT PFN isSupplicantRunning else UINT isSupplicantRunning endif isZeroConfigEnabled Call this function to determine whether Zero Config is currently enabled Syntax Parameters Return Values Remarks Definitions UINT isZeroConfigEnabled None TRUE if ZeroConfig is enabled and FALSE if it is disabled None ifdef DYNAMIC LOADING typedef UINT PFN_isZeroConfigEnabled else UINT isZeroConfigEnabled endif 751G Color Mobile Computer User s Manual Chapter 3 Configuring the Computer RenewDHCP Call this to force a DHCP renewal on the current network adapter Syntax Parameters Return Values Remarks Definitions UINT RenewDHCP None ERROR SUCCESS when successful You should not have to call this function on Microsoft Windows CE 4 2 NET and later devices ifdef DYNAMIC LOADING typedef UINT PFN RenewDHCP else UINT RenewDHCP endif ResetRadioToSystemSave Call this function to force the radio to reset to the last desired active profile Syntax UINT ResetRadioToSystemSave Parameters None Return Values ERROR SUCCESS when successful
3. NDIS NET TYPE OFDM 5G 5 Gigahertz 54 Mbps NDIS NET TYPE OFDM 2 4G 802 11b g 2 4 Gigahertz ERROR SUCCESS when successful ERR QUERY FAILED when the query failed or ERR CONNECT FAILED ifa connection with the radio failed If ERROR SUCCESS is returned your ULONG reference is populated with one of the parameters listed above ifdef DYNAMIC LOADING typedef UINT PFN GetNetworkMode ULONG amp else UINT GetNetworkMode ULONG amp endif 751G Color Mobile Computer User s Manual Chapter 3 Configuring the Computer GetNetworkType Call this function to get the current network type of the radio Do not confuse this with GetNetworkMode Syntax UINT GetNetworkType ULONG amp Parameters NDIS NET TYPE FH Indicates this is a frequency hopping radio NDIS NET TYPE DS Indicates that this is a direct sequence radio NDIS NET TYPE UNDEFINED Indicates this radio type is unknown or undefined Return Values ERROR SUCCESS when successful ERR QUERY FAILED when the query failed or ERR CONNECT FAILED if a connection with the radio failed Remarks If ERROR SUCCESS is returned your ULONG reference is populated with one of the parameters listed above Definitions ifdef DYNAMIC LOADING typedef UINT PFN GetNetworkType ULONG amp else UINT GetNetworkType ULONG amp endif GetSSID Call this function to get the desired SSID of the 802 11b g radio Call RadioConnect befor
4. BOOL KernelloControl IOCTL HAL GET OAL VERINFO LPVOID lpInBuf DWORD nInBufSize LPVOID lpOutBuf DWORD nOutBufSize LPDWORD lpBytesReturned Parameters IpInBuf IpInBufSize IpOutBuf nOutBufSize IpBytesReturned 72 Should be set to NULL Should be set to zero Must point to a VERSIONINFO structure as defined by OEMIOCTL H The fields should have these values e cboemverinfo sizeof tagOemVerInfo verinfover 1 sig TTC VO id N e tgtcustomer P e tgtplat SeaRay e tgtplatversion Current build version number e tgtcputype 8 Tntel 0 e tgtcpu PXA255 0 e tgtcoreversion a e date Build time e time Build date The size of VERSIONINFO in bytes Returns sizeof PVERSIONINFO 751G Color Mobile Computer User s Manual Chapter 3 Configuring the Computer Return Values Returns TRUE if function succeeds Returns FALSE if the function fails GetLastError may be used to get the extended error value IOCTL HAL GET BOOTLOADER VERINFO Returns the HAL version information of the OS image Usage Zinclude oemioctl h Syntax BOOL KernelloControl IOCTL HAL GET OAL VERINFO LPVOID ipInBuf DWORD nInBufSize LPVOID lpOutBuf DWORD nOutBufSize LPDWORD lpBytesReturned Parameters IlpInBuf Should be set to NULL nInBufSize Should be set to zero IpOutBuf Must point to a VERSIONINFO structure as defined by OEMIOCTL H The fields should have these values e
5. Remarks None Definitions ifdef DYNAMIC LOADING typedef UINT PFN_ResetRadioToSystemSave else UINT ResetRadioToSystemSave endif StartScanList If a scan list is configured on the system this causes the API to begin the process of scanning for an available network This call can take quite a while to process depending upon the length of the scan list and how long it takes to find a valid network you may wish to call it from a separate thread Syntax Parameters Return Values Remarks Definitions UINT StartScanList None ERROR SUCCESS when successful Call this function to start the scan list functionality of the system ifdef DYNAMIC LOADING typedef UINT PFN StartScanList else UINT StartScanList endif 751G Color Mobile Computer User s Manual 95 Chapter 3 Configuring the Computer StartSupplicant Call this to start the supplicant service if it is installed on the system Syntax UINT StartSupplicant Parameters None Return Values ERROR SUCCESS when successful Remarks None Definitions ifdef DYNAMIC LOADING typedef UINT PFN StartSupplicant else UINT StartSupplicant endif StopSupplicant Call this function to stop the supplicant service Syntax UINT StopSupplicant Parameters None Return Values ERROR SUCCESS when successful Remarks None Definitions ifdef DYNAMIC LOADING typedef UINT PFN StopSupplicant else UINT StopSupplicant endif
6. Can be used with any of the other flags in this table FLG_ADDREG_TYPE_SZ 0x00000000 REG_SZ registry data type FLG ADDREG TYPE MULTI SZ 0x00010000 REG MULTI SZ registry data type Value field that follows can be a list of strings separated by commas FLG ADDREG TYPE BINARY 0x00000001 REG BINARY registry data type Value field that follows must be a list of numeric values separated by commas one byte per field and must not use the 0x hexadecimal prefix FLG ADDREG TYPE DWORD 0x00010001 REG DWORD data type The noncompatible format in the Win32 Setup INF documentation is supported Example AddReg RegSettings All RegSettings All HKLM Sreg_path 0x00000000 alpha default alpha HKLM Sreg_path test 0x00010001 3 Test 3 HKLM Sreg_path new another 0x00010001 6 New another 6 CEShortCuts This section a Windows CE specific section under the DefaultInstall section is optional and describes the shortcuts that the installation application creates on the device Within the DefaultInstall section a reference may have been made to this section such as ShortCuts All This section defines the options for that setting Required No shortcut list section shortcut_filename String that identifies the shortcut name It does not require the LNK extension shortcut list section sbortcut type flag Numeric value Zero or empty represents a shortcut to a file any nonzero numeric value represent
7. Files Intl 0 InstallDir Intl Files TelecomNcsCE 0 InstallDir Telecom NcsC Files Windows 0 InstallDir Windows Files Import 0 InstallDir Import Files Export 0 InstallDir Export Files Work 0 InstallDir Work Files WinCE 0 storage_card wince Gl 60 751G Color Mobile Computer User s Manual Chapter 3 Configuring the Computer CEStrings Required section AppName Rp32 InstallDir Nstorage cardN AppName Strings Optional section Shortcuts All Sample App 0 sample exe Uses the path in DestinationDirs Sample App 0 sample exe InstallDir The path is explicitly specified Files App rpm exe 0 rpm ini rpmce212 ini 0 mfcce212 d11 0 olece212 d11 0 olece211 d11 0 rdm45wce dll 0 picfmt dll 0 fmtctrl dl1 0 ugrid dll 0 simple dll 0 psink dll 0 pslpwce d11 0 npcpport dl1 0 dexcom d11 0 Files DataBase rpmdata dbd 0 Files Fonts tahoma ttf 0 Files BitMaps intermec bmp 0 rpmlogo bmp 0 rpmname bmp 0 import bmp 0 export bmp 0 clock bmp 0 printer bmp 0 filecopy bmp 0 Files Intl lang eng bin 0 LH i Files TelecomNcsCI ncsce exe 0 nrinet dl1 0 Files Windows readme txt 0 Files Import readme txt 0 Files Export readme txt 0 Files Work 751G Color Mobile Computer User s
8. MODEM or DOCK SERIAL as defined in oemioctl h the value specifies the position the switch is to be set The call appears as follows port DOCK MODEM or DOCK SERIAL as defined in oemioctl h BOOL SetDockSwitch BYTE port DWORD cmd ITC_DOCK_SWITCH DWORD cbRet return KernelloControl IOCTL HAL ITC WRITE SYSPARM amp cmd sizeof cmd amp port sizeof port amp cbRet ITC_WAKEUP_MASK This IOCTL sets a bit mask that represents the mask for the five programmable wakeup keys The I O key is not a programmable wakeup key By default it is always the system resume i and all other keys are set to disable key wakeup A zero in a bit position masks the wakeup for that key A one in a bit position enables wakeup for that key pOutBuf must point to a buffer that contains a byte value of a wakeup mask consisting of the OR ed constants as defined in oemioctl h Only the following keys are programmable as wakeup events define SCANNER_TRIGGER 1 define SCANNER_LEFT 2 define SCANNER_RIGHT 4 define GOLD A1 8 define GOLD_A2 0x10 ITC_AMBIENT_KEYBOARD This IOCTL sets the threshold for the keypad ambient sensor This can be a value from 0 always off to 255 always on pOutBuf must point to a buffer that contains a byte value of the desired setting ITC_AMBIENT_FRONTLIGHT This IOCTL sets the threshold for the frontlight ambient sensor This can be a value from 0 always off to 255 IpOutBuf must point to a buffer tha
9. SwitchPacketDriver Call this function to switch between available packet drivers on the system Syntax UINT SwitchPacketDriver USHORT Parameters INTERMEC_PACKET_DRIVER Intermec Packet Driver ZNICZIO NDISUIO PACKET DRIVER Microsoft Packet Driver NDISUIO Return Values ERROR SUCCESS when successful Remarks After switching to a new packet driver perform a warm boot for changes to take effect Definitions ifdef DYNAMIC LOADING typedef UINT PFN SwitchPacketDriver USHORT else UINT SwitchPacketDriver USHORT endif 96 751G Color Mobile Computer User s Manual Chapter 3 Configuring the Computer Deprecated Functions The following functions are deprecated While these are not removed from the API these are no longer supported Their parameters are no longer applicable and the return value for all of these functions is ERR FUNCTION DEPRECATED Function Syntax GetRTSThreshold Deprecated UINT GetRTSThreshold USHORT amp GetMedia Deprecated UINT GetMedia ULONG amp GetMedium Deprecated UINT GetMedium ULONG amp GetNicStats Deprecated UINT GetNicStats NDIS 802 11 STATISTICS amp SetRTSThreshold Deprecated UINT SetRTSThreshold USHORT amp SecLXRate Deprecated UINT SetTXRate UCHAR EncryptWepKeyForRegistry Deprecated UINT EncryptWepKeyForRegistry TCHAR szDest TCHAR szSource SetDiversity Deprecicated UINT SetDiversity USHORT Notificati
10. TCHAR lpname MAX PATH Gl if pname pname return FALSI _tcscpy lpname pname tcslwr lpname hProcList CreateToolhelp32Snapshot TH32CS SNAPPROCESS O0 if hProcList INVALID HANDLE VALUE return FALSE end if memset amp peProcess 0 sizeof peProcess peProcess dwSize sizeof peProcess if Process32First hProcList amp peProcess CloseToolhelp32Snapshot hProcList return FALSE end if thDeviceProcessID 0 do 1 tcslwr peProcess szExeFile if tcsstr peProcess szExeFile lpname thDeviceProcessID peProcess th32ProcessID break end if while Process32Next hProcList amp peProcess if GetLastError ERROR NO MORE FILES amp amp thDeviceProcessID 0 CloseToolhelp32Snapshot hProcList return FALSE end if CloseToolhelp32Snapshot hProcList return TRUE IsProcessRunning COdeINSTALL INIT Install Init HWND hwndParent BOOL fFirstCall 751G Color Mobile Computer User s Manual 63 Chapter 3 Configuring the Computer BOOL fPreviouslyInstalled LPCTSTR pszInstallDir return codeINSTALL INIT CONTINUE T p COdeINSTALL EXIT Instal HWND hwndParent LPCTSTR pszInstallDir WORD cFailedDirs WORD cFailedFiles R R R Exit WO cFai
11. away from the Soft position 3 Tap OK to exit this applet Volume amp Sounds Pro 2 ok Ix Volume sounds Loud Enable sounds for M Events warnings system events M Applications M Notifications alarms reminders Pu Jo votum Il qi 6 25 a pa E Adjusting the Beeper Volume eg Intermec Settings Z To select a beeper volume for the 751G tap Start gt Intermec Settings then tap the Device Settings option Tap to expand the Beeper option then tap to expand the Volume option Select an item then tap to close this option Data Collection Communications Date and Time Beeper Volume O off Low O Medium O High O very high Number of good read beeps Vibrate Display Keypad Power Management i C imer qi 6 34 aM y E El F F Note Information about the Intermec Settings applet is found in the Intermec Computer Command Reference Manual PIN 073529 See your Intermec representative for information 751G Color Mobile Computer User s Manual Chapter 1 Using the Computer Disabling the Beeper To disable the beeper 1 Tap Start gt Settings gt Control Panel Double tap the Volume amp JO Sounds icon then tap the Volume tab Volume amp inert 2 Tap the Soft button to drag the slider bar all the way to the left 3 Tap OK to exit this applet Volum
12. cboemverinfo Sizeof tagOemVerlInfo verinfover 1 sig TTC 0 id B e tgtcustomer E e tgtplat SeaRay e tgtplatversion Current build version of bootstrap loader e tgtcputype 8 Intel 0 e tgtcpu PXA255 0 e tgtcoreversion e date Build time e time Build date nOutBufSize The size of VERSIONINFO in bytes IpBytesReturned The number of bytes returned to pOutBuf Return Values Returns TRUE if function succeeds Returns FALSE if the function fails GetLastError may be used to get the extended error value IOCTL HAL WARMBOOT Causes the system to perform a warm boot The object store is retained Usage Zinclude oemioctl h Syntax BOOL KernelloControl IOCTL HAL WARMBOOT LPVOID lpInBuf DWORD nInBufSize LPVOID lpOutBuf DWORD nOutBufSize LPDWORD lpBytesReturned 751G Color Mobile Computer User s Manual 73 Chapter 3 Configuring the Computer Parameters IpInBuf Should be set to NULL IpInBufSize Should be set to zero IpOutBuf Should be NULL nOutBufSize Should be zero Return Values None IOCTL HAL COLDBOOT Causes the system to perform a cold boot The object store is cleared Usage Zinclude oemioctl h Syntax BOOL KernelloControl IOCTL HAL COLDBOOT LPVOID lpInBuf DWORD nInBufSize LPVOID lpOutBuf DWORD nOutBufSize LPDWORD lpBytesReturned Parameters IpInBuf Should be set to NULL IpInBufSize Should be set to zero IpOutBuf Should be N
13. ease cea e nineio masanii makiaa aapa Re OR fe ec d 98 Reboot Functions 15 3106 Us ves eta a eta Mid ae red ee eee ets 98 Reprogramming the 751G Keypad cosas acc aere me het Ra Se ones EAE 99 Key VANES ao Ue cde neca ues We dida cri Manet e eMe nde el te tdt d 99 How Key Values Are Stored in Registry 0 0 0 ccc e eee cee eee eee 100 Change Notification Sie wnat ling Bow wane New Reip ear eure near ade 100 Advanced Keypad Retiap ping ceste a bebe Eae etd pipe D 101 Scan Codes siu esae du au oats MAN tuia ce ventri ro eio pU Sar eut uta 101 Sample View of Registry Keys 5i sout s di eae ER RIA o nek mtn E ea IRR 102 4 Maintaining the Computer sssessss 103 Updating the System Soreware i sit d ase oe aedis deeds Sect oan he ose aed 104 Using a Storage Card to Upgrade the Computer 00 0000000 104 Using the SmartSystems Console to Upgrade the Computer 105 Troubleshooting Your Computer 11 1 i eee border aci ice A Dc Ak el RR RR a 106 C Ieinine Ae Some oS o cum eps ant edad aom da eta doe sos dO boe d wary eed 109 5 Network SUDDOF sa l eum EA bU EO SU E ades calde eoa ned e 111 802 11b g Communications io 23 rs cara eel Cee ale os A qu RM ET duca 112 Remote Access Modems 0 0 c cece ccc cece eee eee e 113 Connecting to an Internet Service Provider 0 0 cee eee eee 113 Connecting to Work eed code ten VELLE Dr eA Ed bet d e eol 116 Ending a
14. see the following paragraph My Work Network Connect to the network at your company or organization where you work Once connected you can send and receive e mail messages by using Messaging view web pages by using Internet Explorer Mobile and synchronize with your desktop If this is the method you want to use see Connecting to Work on page 116 Connecting to an Internet Service Provider Make New Connection You can connect to your ISP and use the connection to view web or WAP pages Get an ISP dial up access telephone number a user name and a password from your ISP Some ISPs require information in front of the user name such as MSN username To view additional information for any screen in the wizard or while changing settings tap the Help icon in the upper right corner 1 Tap Start Settings Network and Dial up Connections then double tap the Make New Connection icon BAR i SWLD26C1 LAN90001 9 co 4 E y 10 17 rw DA E 751G Color Mobile Computer User s Manual 113 Chapter 5 Network Support 2 Enter a name for the connection such as ISP Connection tap Next 3 4 114 Make New Connection Type a name for the connection isP Connection Select the connection type n Direct Connection CO Virtual Private Network PPTP Virtual Private Network L2TP PPP over Ethernet PPPoE You should not need to change any
15. 0 CEDevice ARM Inherits all CEDevice settings This will create a CAB file specific to ARM devices ProcessorType 2577 ARM cab file is valid for ARM microprocessors UnsupportedPlatforms pltfrml is still unsupported The following overrides the version settings so that no version checking is performed VersionMin VersionMax CEDevice MIPS Inherits all CEDevice settings This will create a CAB file specific to MIPS devices ProcessorType 4000 MIPS CAB file is valid for MIPS microprocessor UnsupportedPlatforms pltfrm2 pltfrml pltfrm2 unsupported for MIPs CAB file previous example run the CAB Wizard with the cpu arm mips parameter Z Note To create the two CPU specific cab files for the Setup inf file in the 751G Color Mobile Computer User s Manual 55 Chapter 3 Configuring the Computer Required Copyfiles AddReg CEShortcuts CESetupDLL CESelfRegister 56 Defaultinstall This describes the default installation of your application Note that under this section you will list items expanded upon later in this description Yes copyfile_list_section Maps to files defined later in the inf file such as Files App Files Font and Files Bitmaps add_registry_section Example RegSettings All shortcut_list_section String that identifies one more section that defines shortcuts to a file as defined in the CEShortcuts section setup_
16. 18 Use these specifications to locate technical information about the 751G and its available features and options Display 1 4 VGA Transflective software controlled backlight Pixels 240x320 Diagonal 97 mm 3 8 in Colors 256 K Environmental Operating Temperature 10 to 50 C 14 to 122 F Storage Temperature 20 to 60 C 4 to 140 F Relative Humidity 5 to 95 noncondensing Rain and Dust Resistance IP64 compliant Drop Specifications 1 2 m 4 ft drop Secure Digital Expansion Slots The 751G supports the Delkin Devices Secure Digital storage card Integrated Scanner Options EA11 Linear Imager Integrated Wireless 802 11b g Wi Fi certified WLAN 802 11b g Bluetooth compatible module 751G Color Mobile Computer User s Manual Chapter 1 Using the Computer Keypad Option 22 key layout with one touch numerics and shifted alpha with 4 way navigation buttons Memory and Storage RAM Memory 64 MB Flash ROM 64 MB includes ROM folder for application storage Microprocessor Intel XScale PXA255 Application Processor 400 MHz Operating System Microsoft Windows CE NET 4 2 Physical Dimensions Length 191 mm 7 53 in Width 50 mm 1 97 in Height 90 mm 3 50 in Weight 460 g 16 0 oz Power Battery Type Lithium Ion Lilon 7 2V 1x2000 mAh cells customer replaceable Battery Capacity 14 4 Watt hours Battery Life 8 hours application dependent Recharging Time 4
17. CORRECTION COPY CUT PASTE Dont show this To enable the Transcriber feature tap the Transcriber icon on the task bar then write anywhere on the screen Note the gray box behind the icon The input then appears in the active window To disable the Transcriber tap the Transcriber icon again This removes the gray box in the background e nen rm A Transcriber icon Selecting Typed Text If you want to edit or format typed text you must select it first Drag the stylus across the text you want to select You can cut copy and paste text by tapping and holding the selected words and then tapping an editing command on the pop up menu or by tapping the command on the Edit menu 751G Color Mobile Computer User s Manual 25 Chapter 2 Windows CE NET Finding and Organizing Information Use Windows Explorer to find and organize files into folders on the 751G 26 To open Windows Explorer 1 2 3 Jela xls acres vv Computer v o u Application CABFiles Flash File Data Store e My Network Program Files Documents SmartSyst Temp Windows P e DN Ju co SY 6 47 am A E Tap Start gt Programs gt Windows Explorer Double tap any folder to open it Move files by tapping and holding the items you want to move then tap either Cut or Copy and Paste on the pop up menu Double tap a folder to open it You can also use the System applet to pull up a list of ac
18. Connections aou whoo Vo d enas a du feos da abs oe 117 751G Color Mobile Computer User s Manual ix Contents Configuring Security ie ue oder Lap wns ed DATA o DP UA E E ac ROBAR aig ng A 118 Loading Certificates uricut ette ou paie E ibi A CIR beads SUE hes 118 Wireless Networks TT 118 Choosing Between Microsoft and Funk Security 00000005 120 Configuring Funk Security 522v ees Oe Ru ER acea Ra 120 Configuring Microsoft Security sisse sax duca Rid eka pes ea 126 SmartSystems Foundations ip er ous e Vd Y P Ege es cae E res Rok De SPUR 127 j Ide occorre ime peeled suu e cota at cota 129 x 751G Color Mobile Computer User s Manual Before You Begin Before You Begin Safety Information A Warning gt Caution ES This section provides you with safety information technical support information and sources for additional product information Your safety is extremely important Read and follow all warnings and cautions in this document before handling and operating Intermec equipment You can be seriously injured and equipment and data can be damaged if you do not follow the safety warnings and cautions This section explains how to identify and understand dangers warnings cautions and notes that are in this document A warning alerts you of an operating procedure practice condition or statement that must be strictly observed to avoid death or serious injury to the persons worki
19. Directlytoa Toti Posset oett ac tx LN Rune Mate er 39 Directly to a Generic Serial Portes yas ct Ye cee Loe DO ETUR 39 Configuring the Scanner 5222 eroe en yas EDU RA DEA RA TK eee Seid acil 40 Scanner Control and Data Ltsnsfetu sies d eate d oa Ped pd Pec dos o Ra ERG 40 Data Collection Contiontarion 5 Fan eos dace ao a EAQUE SR ae toa P RE Acad 40 Changing Comm Settings ote ist geo Pesce v aceite mv t 41 Improving the Performance of the Area Imager 00 00 eee eee 41 Reading Distances i corine bee iib Hon Beatty ns Bae tau iot adve eaa Edd 42 Installing Applications on the Computers 5224 hea Renta wees aoe d 43 Using Microsoft ActiveSync a ii esos ect unner 43 Using a Storage Card 50 5 de pacis eMe PR ath iol heen Sd a So d EARS 44 Using the SmartSystems Console 1 52 22 dxss lee aer le ES Ee a IER 45 Using Wavelink Avalanche iste scs wreck ea eoe d E epos EA 45 Tastallitis Cabinet Des iieiaei ninn wet kuin eet PEE x EP EB MN Ce 46 Developing Applications for the Computer 1 0 0 0 cee eee eee eee ees 46 Packaging Applications for the Coniputer c i uote avv hea Ra lee a 47 Launching Your Application Automatically llle 47 In uro oo EM ooo Le LEM bra M E BA DM hi ae oie UR Mn 48 Auto Frea S Me SR EE EAM UE RKO PRED vba air CAME AS 49 PERT RANI ierit teigia i ien ieni ae a tE cde inte ANCOR ode de n edet 50 Auto ODy core ede ede ae to RE eek SR ERR Ee EROS 50 AUtoRep Abts soU ipae adio Ops ique poste AMI co
20. ITC_NVPARM_SERIAL_NUM 68 ITC_NVPARM_SERIAL2_INSTALLED 70 ITC_NVPARM_SERVICE_DATE 68 ITC_NVPARM_SIM_PROTECT_HW_INSTA LLED 70 ITC_NVPARM_SIM_PROTECT_SW_INSTAL LED 70 ITC_NVPARM_VERSION_NUMBER 69 ITC_NVPARM_VIBRATE_INSTALLED 70 ITC_NVPARM_WAN_FREQUENCY 69 ITC_NVPARM_WAN_INSTALLED 69 ITC_NVPARM_WAN_RADIOTYPE 69 ITC_NVPARM_WAN_RI 69 ITC_REGISTRY_SAVE_ENABLE 71 K KernelloControl IOCTL GET CPU ID 77 IOCTL HAL COLDBOOT 74 99 IOCTL HAL GET BOOT DEVICE 75 IOCTL HAL GET BOOTLOADER VERI NFO 73 IOCTL HAL GET DEVICE INFO 67 IOCTL HAL GET DEVICEID 71 IOCTL HAL GET OAL VERINFO 72 IOCTL HAL GET RESET INFO 74 IOCTL HAL ITC READ PARM 68 IOCTL HAL ITC WRITE SYSPARM 70 IOCTL HAL REBOOT 76 98 IOCTL HAL WARMBOOT 73 99 IOCTL PROCESSOR INFORMATION 76 KernelloControl 67 Key sequences alpha green keys 11 orange keys 10 Keyboard Windows CE NET input panel 24 Keyboard See Keypad Keypad advanced remapping 101 alpha green key sequences 11 backlight control panel applet 10 change notification 100 driver registry settings 100 orange key sequences 10 planes 99 134 registry settings alpha plane 100 gold plane 100 unshifted plane 100 sample registry keys 102 scan codes 101 specifications 19 L LED status 11 Line printing 39 Loading certificates 118 IpBytesReturned IOCTL GET CPU ID 77 IOCTL HAL GET BOOT DEVICE 75 IOCTL HAL GET BOOTLOADER VERI NFO 73 IOCTL HAL GET DEVICE
21. Naval Observatory USNO The 751G uses Simple Network Time Protocol SNTP to synchronize with a network time server The default reference time server is the USNO tock usno navy mil To synchronize the time on your 751G with this time server you must have a valid connection to the Internet You can also synchronize the 751G system time with a corporate network server within your firewall that is SNTP capable To use an internal corporate network server you need to set the command name in the registry 751G Color Mobile Computer User s Manual Chapter 3 Configuring the Computer Configuring the Computer through the Network a a You can change the configuration parameters of the 751G by sending commands through a host computer or through the network If you are using a network you can configure one or more 751Gs at a time You can remotely configure the wireless 751G by sending a command from an application on the host computer Note that you cannot set all parameters through the network You can only set those commands that have a syntax in the Intermec Computer Command Reference Manual Note You can continue running an application on the 751G while configuring it from the host computer Configuring the Computer in a TCP IP Direct Connect Network Use the host computer to configure a wireless 751G in a TCP IP network To send and receive configuration data write a host application that can communicate with the 751G direc
22. OK Battery Schemes Device Status Power Charging Backup battery Good Good Very Low Very Low Main batteries Total time used 2Y s rower E Ei 9 18 am DA If your computer shuts down because of low battery conditions your computer does not operate This is done to ensure that data is protected Although the battery does protect the data against loss for several hours you should connect your computer to a power source when you first detect a low battery condition Note Your computer has an internal backup super capacitor a temporary power storage device that protects data for up to ten minutes It also shuts down the 751G if the main battery suddenly goes away removed from the computer Depending on the processes running it may not have adequate power for a graceful shutdown If so the 751G performs a cold boot the next time power is applied In short put the 751G into a suspend sleep mode before you remove the main battery 751G Color Mobile Computer User s Manual Chapter 1 Using the Computer If you have at least one device in your 751G radio scanner or imager the battery power fail level is set so that after the system shuts down in a low battery condition there is still sufficient charge to allow the unit to remain configured keep proper time and maintain DRAM Dynamic Random Access Memory for at least 72 hours at room temperatur
23. PFN EnableZeroConfig USHORT else UINT EnableZeroConfig USHORT endif GetCurrentDriverName Call this function to populate the TCHAR array with the driver name Syntax UINT GetCurrentDriverName TCHAR Parameters Pointer to a TCHAR array which contains the name of the driver when successful Return Values ERROR SUCCESS when successful Remarks This function is called with a pointer to a TCHAR array that is large enough to hold the name of the driver PLUS the null terminator Definitions ifdef DYNAMIC LOADING typedef UINT PFN GetCurrentDriverName TCHAR else UINT GetCurrentDriverName TCHAR endif isDHCPEnabled Call this to determine whether DHCP is enabled on the current adapter Syntax UINT isDHCPEnabled Parameters None Return Values TRUE if DHCP is enabled FALSE if it is not Remarks None Definitions ifdef DYNAMIC_LOADING typedef UINT PFN_isDHCPEnabled else UINT isDHCPEnabled endif 751G Color Mobile Computer User s Manual 93 94 Chapter 3 Configuring the Computer isOrinoco Call this function to determine whether the current radio is an ORiNOCO Lucent or WaveLAN radio Syntax Parameters UINT isOrinoco None Return Values TRUE if this is an ORiNOCO radio and FALSE if it is not Remarks Definitions None ifdef DYNAMIC_LOADING typedef UINT PFN_isOrinoco else UINT isOrinoco endif isSupplicantRunning
24. Settings gt Control Panel then double tap the Backlight icon Tap Key Sequences 10 the right arrow to move to and tap the Keyboard tab Make your selection then tap OK to exit this applet Both Power Keyboard Backlight Keyboard Backlight Q onn Low Light On In Medium Light Always On BY Cy Contro gt Ei 7 00 am A f Use the following key sequences to enter characters into your 751G using the numeric keypad Orange Plane Keys The orange plane key provides you access to display controls special characters and CE NET options Press the orange key for each orange plane key stroke you wish to make For example to turn on the front light press and hold the orange key plus the 3 key To turn the front light off press these keys again The following table lists sequences that use the orange plane key See Chapter 2 Windows CE NET for information about Windows CE NET applications Orange Plane Keys Press the Keys To Do This orange 3 Toggle backlight on off goes through backlight power levels orange orange 4 orange 5 751G Color Mobile Computer User s Manual Chapter 1 Using the Computer Orange Plane Keys continued Press the Keys To Do This orange 6 orange 7 Move up one page orange 8 Enter an asterisk orange 9 Move down one page orange 0 Access the CE NET Start menu orange Enter Ente
25. Static WEP Security The 751G uses the Wired Equivalent Privacy WEP protocol to add security to your wireless network based on the 802 11b g standard To use WEP security you need an access point with an 802 11b g radio Configuring Static WEP Security With Funk Security Use this procedure to set Static WEP security with Funk security Profile Label Profile 1 Network Type Infrastre 9 Cha SSID INTERMEC Power Mode Enabled 8021x None Association Open Encryption WEP 9 Key ski El Transmit key O Key1 key2 Okey3 fe O Kev4 m Sa E mter B4 11 19 om A 1 Make sure you have configured the communications and radio parameters on your 751G and that Funk is your security choice 2 Open Intermec Settings Tap to expand Communications gt 802 11 Radio gt Funk Security gt Profile X with X being 1 through 4 For Association select Open and press Enter For Encryption select WEP and press Enter For 8021x select None and press Enter nN wu A WwW For Transmit key select which WEP key to use for encryption of transmitted data 8 Define a value for each key up to four Enter an ASCII key or a hex key either 5 or 13 bytes long based on the radio capability Set a 5 byte value for 64 bit WEP or a 13 byte value for 128 bit WEP Precede hex keys with Ox and make sure the keys use 5 or 13 hex pairs 751G Color Mobile Compu
26. SwitchPacketDriver 96 nInBufSize IOCTL HAL GET BOOTLOADER VERI NFO 73 IOCTL HAL ITC READ PARM 68 136 IOCTL HAL ITC WRITE SYSPARM 70 IOCTL PROCESSOR INFORMATION 77 nInfold NLEDGetDevicelnfo 98 NLED driver vibrator 97 NLED H 98 NLEDGetDevicelnfo 98 NLEDSetDevice 98 NLED_COUNT_INFO NLEDGetDevicelnfo 98 NLED_SETTINGS_INFO_ID NLEDGetDevicelnfo 98 NLEDSetDevice 98 NLED_SUPPORTS_INFO_ID NLEDGetDevicelnfo 98 NLEDGetDevicelnfo 98 NLEDSetDevice 98 nOutBufSize IOCTL_GET_CPU_ID 77 IOCTL HAL COLDBOOT 74 IOCTL HAL GET BOOT DEVICE 75 IOCTL HAL GET BOOTLOADER VERI NFO 73 IOCTL HAL GET DEVICE INFO 67 IOCIL HAL GET DEVICEID 72 IOCTL HAL GET OAL VERINFO 72 IOCTL HAL GET RESET INFO 74 IOCTL HAL ITC READ PARM 68 IOCTL HAL ITC WRITE SYSPARM 70 IOCTL HAL REBOOT 76 IOCTL HAL WARMBOOT 74 IOCTL PROCESSOR INFORMATION 77 o Object Store packaging an application 47 Object store IOCTL HAL COLDBOOT 74 IOCTL HAL WARMBOOT 73 OEMIOCTL H JOCTL GEI CPU ID 77 IOCTL HAL COLDBOOT 74 IOCTL HAL GET BOOT DEVICE 75 IOCTL HAL GET BOOTLOADER VERI NFO 73 IOCTL HAL GET OAL VERINFO 72 IOCTL HAL GET RESET INFO 74 IOCTL HAL ITC READ PARM 68 IOCTL HAL ITC WRITE SYSPARM 70 IOCTL HAL REBOOT 76 IOCTL HAL WARMBOOT 73 Oldstyle device ID 71 751G Color Mobile Computer User s Manual Operating system specifications 19 Operating temperature 18 Operating the Computer troubleshooting 106 Orange pla
27. Usage Zinclude oemioctl h Syntax BOOL KernelloControl IOCTL HAL ITC WRITE SYSPARM LPVOID lpInBuf DWORD nInBufSize LPVOID lpOutBuf DWORD nOutBufSize LPDWORD lpBytesReturned Parameters IpInBuf A single byte that may be one of the id values See ID Field Values on the next page nInBufSize Must be set to the size of the pInBufin bytes IpOutBuf Must point to a buffer large enough to hold the data to be written to the non volatile data store nOutBufSize The size of pOutBuf in bytes IpBytesReturned The number of bytes returned by the function 70 751G Color Mobile Computer User s Manual Chapter 3 Configuring the Computer Return Values Returns TRUE if the function is successful returns FALSE if not GetLastError may be used to get the error value When this function is used to get the error either ERROR INVALID PARAMETER or ERROR INSUFFICIENT BUFFER is returned ID Field Values The id field of pInBuf may be one of the following values ITC REGISTRY SAVE ENABLE Enables or disables the save registry to non volatile media feature of the RegFlushKey function pOutBuf must be set to zero FALSE if the feature is to be disabled or one TRUE if the feature is to be enabled ITC DOCK SWITCH This IOCTL sets a position of the dock switch The dock switch may be set to either modem or serial positions IpOutBuf must point to a buffer that contains a byte value of either DOCK
28. boot The object store is retained Usage include oemioctl h Syntax BOOL KernelIoControl IOCTL_HAL_REBOOT LPVOID lpInBuf DWORD nInBufSize LPVOID lpOutBuf DWORD nOutBufSize LPDWORD lpBytesReturned Parameters IpInBuf Should be set to NULL IpOutBuf Should be NULL IpInBufSize Should be set to zero nOutBufSize Should be zero Return Values None IOCTL PROCESSOR INFORMATION Returns processor information Usage include pkfuncs h Syntax BOOL KernelloControl IOCTL PROCESSOR INFORMATION LPVOID lpInBuf DWORD nInBufSize LPVOID lpOutBuf DWORD nOutBufSize LPDWORD lpBytesReturned 76 751G Color Mobile Computer User s Manual lOCTL_GET_CPU_ID Chapter 3 Configuring the Computer Parameters IpInBuf Should be set to NULL nInBufSize Should be set to zero IpOutBuf Should be a pointer to the PROCESSOR INFO structure Its structure stores information describing the CPU more descriptively typedef PROCESSOR INFO WORD wVersion Set to value 1 WCHAR szProcessorCore 40 ARM 0 WORD wCoreRevision 4 WCHAR szProcessorName 40 PXA255 0 WORD wProcessorRevision 0 WCHAR szCatalogNumber 100 0 WCHAR szVendor 100 Intel Corporation 0 DWORD dwInstructionSet 0 DWORD dwClockSpeed 400 nOutBufSize Should be set to sizeof PROCESSOR_INFO in bytes IpBytesReturned Returns sizeof PROCESSOR INFO Return Values Returns TRUE if function s
29. directory Copy the source file to the destination directory only if the file is already in the destination directory Do not copy files if the target file is newer Ignore date while overwriting the target file Create a reference when a shared dll is counted DefaultInstall SH3 CopyFiles Files Common Files SH3 DefaultInstall MIPS CopyFiles Files Common Files MIPS AddReg This section under the DefaultInstall section is optional and describes the keys and values the cab file adds to the device registry Within the DefaultInstall section a reference may be made to this section such as AddReg RegSettings All This section defines options for that setting Required No add_registry_section registry_root_string String that specifies the registry root location The following list shows the values supported by Windows CE HKCR Same as HKEY CLASSES ROOT HKCU Same as HKEY CURRENT USER HKLM Same as HKEY LOCAL MACHINE add registry section value name add registry section flags Registry value name If empty the default registry value name is used Numeric value that specifies information about the registry key The following table shows the values that are supported by Window CE 58 751G Color Mobile Computer User s Manual Chapter 3 Configuring the Computer Flag Value Description FLG_ADDREG_NOCLOBBER 0x00000002 If the registry key exists do not overwrite it
30. eoe Hn aye beth e oed oi aed ted d 10d 8 Disabling the B per 95 2o o ote o ba se cam aou iced Medo dais 9 Intermec Sertings Applet in ni ba seca D secede kee e ae elie E ROGER E TERI REA Eme 9 Keypad 6 sibs end eps ac abbr Do bal ruts eco en AE airs Donde babeat Dre peu utei 10 Backlight for Keypad riro ite scr eee aoe eio b eae uta 10 Key Sequences ius eoi geo entre egeret AGO IHR obse eSI Reni a 10 Orange Plane Keys vata esse cae de REC e EUR EC Un Ep E d 10 Alpha Green Plane Keys oai tage bee aes DEO ERAS a 11 lEDs dies ihe oso ton dte odds TUE Ead 12 Resetting Your Computer eeren aa E ccc hs 13 Scanning Bar Codes ef rose uy Oa rti a er Pa ope eid cnc RID a aded Oca wea 13 Scanning with the Area Imager v3 5 fas ip do D PER UE ERR ATE ERE alee 13 Improving the Performance of the Area Imager 0 000 ee eee eee 14 Software Build Version x1 boues Veo ws We ee BAG eed Baton do Pecan Wadia ae 14 Sofware T GOls n a ded at endpoint t Dac Pci oda hed anche dot An el wien ela dod 15 SmartSystems Foundation Console www intermec com SmartSystems 15 SmartSystems Platform Bundles SSPB 4 6er iue ae RR OS EE ESO 15 Intermec Resource Kits www intermec com IDL 0 000000 eee 15 751G Color Mobile Computer User s Manual v Contents Storage DCCA s heii 6 Seats pon deba tur i a le SP Td beUo ad at RASS 15 Accessing the Secure Digital Card Slot oed RE Ree 16 Internal Card Slots and Connector i e Cu
31. exe gt where your directory is the directory on the Secure Digital storage card where the application was installed and yourapp exe is the name of your application Finish the RUN statement with a CR LF combination There may be multiple run statements in the file 751G Color Mobile Computer User s Manual Chapter 3 Configuring the Computer 5 Add the AuotRun exe file to the SDMMC Disk 2577 folder 6 Remove the Secure Digital storage card from your PC and reinstall it into the 751G then warm boot the 751G to add these files to the Secure Digital storage card If the AutoUser dat file is found and the RUNS statement is correct the task manager launches and executes your program on startup Using the SmartSystems Console 9 You can use the SmartSystems Console to drag and drop Intermec applications onto your 751Gs The 751G ships with the SmartSystems client loaded on it The console is part of SmartSystems Foundation and is available from the Intermec web site 1 Download the file from the Intermec web site unzip it on your desktop 2 From the SmartSystems Console drag and drop the application onto each 751G discovered in your network To download SmartSystems Foundation go to www intermec com idl and open the Device Management page For information on using the SmartSystems Console see its online help Using Wavelink Avalanche E You can use the Wavelink Avalanche device management system to ins
32. hours Charging Range 0 to 40 C 32 to 104 F Regulator Approvals UL and cUL Listed UL 60950 and UL 1604 and CSA 22 2 157 FCC Part 15 TUV CE mark Standard Communications RS232 USB 751G Color Mobile Computer User s Manual 19 Chapter 1 Using the Computer 20 751G Color Mobile Computer User s Manual 4 Windows CE NET This chapter introduces Microsoft Windows CE NET While using your 751G Mobile Computer keep this key point in mind Tap Start on the task bar located at the bottom left corner of the screen to quickly move to programs files and settings Use the task bar at the bottom of the screen to perform tasks in programs The task bar includes menus buttons and the onscreen keyboard Note Desktop icons and applet icons are shown to the left Any place that Z Start is mentioned tap the following Windows icon in the bottom left corner of your desktop 751G Color Mobile Computer User s Manual 21 Chapter 2 Windows CE NET Software Builds Go to Software Build Version on page 14 to determine which Intermec build is on your unit Where to Find Information This chapter describes your 751G CE NET applications and explains how to connect your 751G to a PC a network or the Internet Below is a guide to assist you in using your 751G For information on See this source Programs on your mobile computer This chapter and mobile computer Help To view Help tap Start gt
33. is contained within the 80211API DLL file that should be present in any load with the 802 11b g networking installed This file is an Intermec authored file that provides the programmer with a set of API calls to configure or monitor status of the 802 11b g network This handles profile management for radio configurable values This handles radio configuration and security authentication based on a selected profile There is a user interface to this service that provides status of the supplicant as well as status of the 80211b g authentication process A replacement for NDISUIO DLL that supports the Funk Supplicant The Profile Manager supports up to four radio configuration profiles These profiles are the same as those set by the Wireless Network control panel applet that runs on the Windows CE unit You can configure different 802 11b g profiles and switch between them using the 802 11 API See ConfigureProfile on page 92 for more information Basic Connect Disconnect Functions 78 Below are functions available for the 751G when enabled with the 802 11b g radio module RadioConnect Connects to the available radio Use this function if you plan on using a lot of API calls that talk directly to the radio Note that the 802 11b g radio must be enabled via NDISTRAY before you can connect to it Syntax UINT RadioConnect Parameters None Return Values ERROR SUCCESS when successful otherwise ERR CONNECT FAILED Rem
34. is populated with one of parameters listed above ifdef DYNAMIC LOADING typedef UINT PFN GetCCXStatus ULONG amp else UINT GetCCXStatus ULONG amp endif 751G Color Mobile Computer User s Manual Chapter 3 Configuring the Computer Set Information Functions AddWep Call this function to add a WEP key to the radio Call this function multiple times when adding more than one WEP key Save the default key for last For example when adding four keys and the second key is the default transmit key add keys 1 3 and 4 before you add key 2 Note Add the default transmit key last Syntax UINT AddWep ULONG BOOL TCHAR Parameters ULONG Specifies the key index to be set Valid values are 0 3 BOOL When set to TRUE specifies that this key is the default transmit key TCHAR Pointer to a character array that specifies the key data in either HEX length of 10 or 26 or ASCII length of 5 or 13 This string must be null terminated Return Values ERROR SUCCESS when successful ERR QUERY FAILED when the query failed or ERR CONNECT FAILED if a connection with the radio failed Remarks When adding WEP keys to the radio turn off encryption before you add the keys then turn encryption back on afterwards Also be sure to add the TRANSMIT KEY last Definitions ifdef DYNAMIC_LOADING typedef UINT PFN_AddWep ULONG BOOL TCHAR else UINT AddWep ULONG BOOL TCHAR endif EnableWep Ena
35. location IOCTL_HAL_ITC_WRITE_SYSPARM 70 Registry settings keypad driver 100 keypad planes alpha 100 gold 100 unshifted 100 Registry storage enabling 7 RegOpenKeyEx 99 RegQueryValueEx 99 RegSetValueEx 99 Regulatory approvals specifications 19 RemoveWep 88 Removing programs Windows CE NET 27 29 RenewDHCP 95 Reset button 13 ResetRadioToSystemSave 95 Resource kits data collection 9 device 67 98 smartsystems foundation 105 URL 15 RPM EXE 56 RPMCE212 INI 56 S Samsung radio 802 11b g information 112 SanDisk SD cards 15 137 Index Scan codes keypad 101 Scanner beeper volume turning it on 8 specifications 18 Scanning bar codes troubleshooting 108 Secure Digital card slot 16 Secure Digital cards accessing files 17 installing applications 44 packaging an application 47 pull tabs 16 removing 17 specifications 18 upgrading computer 104 Security choosing between Funk and Microsoft 120 configuring 118 loading certificates 118 wireless network 118 Set information functions 87 SetAuthenticationMode 89 SetCCXStatus 91 SetChannel 89 SetDiversity Deprecated 97 SetMixedCellMode 91 SetNetworkMode 90 SetPowerMode 90 SetRTSThreshold Deprecated 97 SetSSID Q 91 Settings applets intermec settings funk security 120 SetTXRate Deprecated 97 Setup dll 56 62 DlIMain 62 installation functions 62 SHFullScreen 66 67 SI
36. management allows your radio to switch between awake and sleep modes based on network traffic Verify that each setting under Power Management has a value of 1 minute for a combined automatic shutoff time of 3 minutes Beeper are restored unless registry storage is enabled Z Note Fach time a cold boot is performed on the 751G all default settings To learn how to set volume levels for screen taps ActiveSync alert noises etc tap Start gt Help gt Windows CE Basics Enabling the Registry Storage For Windows CE NET the Flash File System PSM is the only medium a available for saving the registry data Tap Start gt Settings gt Control Panel Utilities Double tap the Utilities icon then tap the Registry Save tab Check Enable Registry Storage to enable this function then tap OK Registry Save wakeu Mask App Utilities Registry settings can be saved between cold boots The registry is saved during device resets or when applications use the RegFlushKey Function If enabled the real time clock can be restored on a cold boot Enable RTC Restore Pd J Contro E y 1 31 rm E 751G Color Mobile Computer User s Manual 7 Chapter 1 Using the Computer Enabling the Beeper To enable the beeper 3e Volume amp Sounds 1 Tap Start Settings Control Panel Double tap the Volume amp Sounds icon then tap the Volume tab 2 Drag the slider bar to the right
37. of 32 to 122 F 0 to 50 C When back in range charging resumes and the LED changes to red or green Alternating Red Yellow Replace the battery pack Scanning Keypad Shift and Notification LED LED Color Action Description Momentary Green Indicates the scanner has initialized and had a good scan Blinking Green Indicates the scanner is initializing Steady Red Indicates the keypad is shifted to the Alpha plane and the 751G is turned on Blinking Red Indicates the radio is on when in suspend mode and when the radio is initialized Yellow When the keypad is in Alpha mode the LED temporarily switches from red to yellow to indicate a good scan 12 751G Color Mobile Computer User s Manual Chapter 1 Using the Computer Resetting Your Computer In some cases where the 751G completely stops responding it may be necessary to perform a cold reset Because cold resetting may result in data loss only use this method if all other recovery methods have failed Note Cold resetting deletes all programs and data stored in RAM Z including the Object Store Make sure data is backed up to your host computer or a storage card before performing a cold reset To reset your computer release the lower clip of the hand strap remove the battery pack press the Reset button then reinstall the battery pack Reset button This illustration shows the back of the 751G inside the battery compartment Scanning Bar Codes Use the ar
38. pass through a wireless network access point until it successfully authenticates itself Performs secure authentication against Windows domains and directory services It is comparable to EAP TTLS both in its method of operation and its security though not as flexible This does not support the range of inside the tunnel authentication methods supported by EAP TTLS Microsoft and Cisco both support this protocol 119 Chapter 5 Network Support Authentication continued EAP TLS Based on the TLS Transport Layer Security protocol widely used to secure web sites This requires Transport Layer both the user and authentication server have certificates for mutual authentication While cryptically Security strong this requires corporations that deploy this to maintain a certificate infrastructure for all users EAP TTLS This protocol provides authentication like EAP TLS see page 120 but does not require certificates Tunneled for every user Instead authentication servers are issued certificates User authentication is done using Transport Layer a password or other credentials that are transported in a securely encrypted tunnel established using Security server certificates EAP TTLS works by creating a secure encrypted tunnel through which you present your credentials to the authentication server Thus inside EAP TTLS there is another inner authentication protocol that you must configure via Additional TTLS Settings The 751G
39. provides three types of security for your wireless network Wi Fi Protected Access 2 WPA2 802 11i WPA and WEP 802 1x should be referred to as an authentication method used for WPA and WPA2 Another authentication method for WPA and WPA2 would be the Pre Shared Key PSK Choosing Between Microsoft and Funk Security Before you can implement a security solution on the 751G you need to choose between Microsoft and Funk security By default Funk security is enabled It provides everything you get with Microsoft security plus the addition of Cisco Compatible Extensions features It also provides additional authentication types like EAP TTLS LEAP and EAP FAST Microsoft security with its Microsoft Zero Config feature is also available To switch to Microsoft security go to Configuring Microsoft Security on page 126 to start Note Your security choice does not depend on your authentication server For example you can choose Funk security if you use Microsoft Active Directory to issue certificates Configuring Funk Security You can define up to four profiles for your Funk Odyssey security Different profiles let your 751G communicate in different networks without having to change all of your security settings For example you can set up one profile for the manufacturing floor and one for the warehouse 1 Select Start gt Settings gt Control Panel then double tap the Intermec e Settings icon Intermec Settings
40. screen use the following links These give full instructions on how to display full screen Instructions on how to create a full screen application for eVC applications using an SHFullScreen API support microsoft com support kb articles Q266 2 44 ASP Instructions on how to create a full screen application for eVB applications also using the SHFullScreen API support microsoft com support kb articles Q265 4 51 ASP Kernel 1 0 Controls This describes the KernelloControl functions available to application programmers Most C applications will need to prototype the function as the following to avoid link and compile errors extern C BOOL KernelloControl DWORD dwloControlCode LPVOID lpInBuf DWORD nlInBufSize LPVOID lpOutBuf DWORD nOutBufSize LPDWORD lpBytesReturned You can also see the Device Resource Kit in the Intermec Developer Library IDL for information about these functions The IDL is available as a download from the Intermec web site at www intermec com idl Contact your Intermec representative for more information IOCTL HAL GET DEVICE INFO This IOCTL returns either the platform type or the OEMPLATFORM name based on an input value Syntax BOOL KernelloControl IOCTL HAL GET DEVICE INFO LPVOID ipInBuf DWORD nInBufSize LPVOID lpOutBuf DWORD nOutBufSize LPDWORD lpBytesReturned Parameters IlpInBuf Points to a DWORD containing either the SPI GETPLATFORMTYPE or SPI GETOEMINTFO valu
41. set EXECWAIT Changes the default EXEC wait time from 60 seconds to the number of seconds specified There is a maximum 10 minute limit imposed WAIT Forces a sleep for the specified number of seconds to occur WAITFOR Forces a sleep until the named event is signaled Examples of keyword usage are as follows Allow message pop up if an error occurs QUIET 0 Log any debug output to a trace file LOGGING 1 751G Color Mobile Computer User s Manual 49 Chapter 3 Configuring the Computer Perform a SetEvent on th vent name autoexec started SIGNAL autoexec started Include this child data file childexec dat CALL childexec dat Use autocopy to copy the audio control panel from flash file store to the windows directory Wait for up to 60 seconds for it to exit EXEC Flash File Store SYSTEM autocopy exe S Flash File Store System CPLAudio cpl D NWindowsNCPLAudio cpl Change the default EXEC wait time to 90 seconds EXECWAIT 90 Suspend processing any commands for 10 seconds WAIT 10 Suspend processing any commands until event called MyEventName is signaled WAITFOR MyEventName AutoRun AutoRun AutoRun exe automates operations such as launching other processes and is configured through the AutoRun data file AutoRun dat This file must be in the same directory as the program itself AutoRun supports the following script com
42. set WPA security with Funk security Profile Label Profile 1 Network Type Infrast 9 Channel 3 SSID INTERMEC Power Mode Enable 8021x EAP FAS E inter T gt 11 09 mu DA E 751G Color Mobile Computer User s Manual 121 Chapter 5 Network Support 1 122 Make sure you have configured the communications and radio parameters on your 751G and that Funk is your security choice Open Intermec Settings Tap to expand Communications gt 802 11 Radio gt Funk Security gt Profile X with X being 1 through 4 For Association select WPA and press Enter For 8021x select PEAP TLS TTLS LEAP or EAP FAST and press Enter If you select TTLS or PEAP a Select User Name type your user name then press Enter b Select User Password type a user password then press Enter For Validate Server Certificate select Yes then press Enter Note that you must have the date on the 751G set correctly when you enable Validate Server Certificate d You must enter a User Name and Subject Name You can also enter a Server 1 Common name or Server 2 Common name if you want to increase your level of security If you select TLS a Load a user and root certificate on your 751G For help see Loading Certificates on page 118 b For Validate Server Certificate select Yes then press Enter Note
43. tab can make its removal easier Do the following to attach the tab to your storage card Note that the pull tab has divots cut into either side towards the shorter end Use these divots as a guide 1 Completely peel the paper off the short end of the tab Partially pull the paper off the long end of the tab away from the divots Fold the short end under at the divots to stick to itself Long end of pull tab Fold line at divots Short end of pull tab 4 P4 751G Color Mobile Computer User s Manual Chapter 1 Using the Computer 2 Align the folded edge of the pull tab where there is no adhesive with the bottom end of the storage card Peel away the rest of the paper from the long end then firmly press down the remaining adhesive area of the tab onto the storage card Align the folded end with this edge of the storage card 3 Insert the storage card with the contacts facing the keypad into your 751G to ensure that no adhesive is exposed once the tab is placed Keypad facing down 4 Press on the storage card until you hear a click If needed close the storage media access door Accessing Files Stored on the Secure Digital Card When inserted in the 751G the Secure Digital card inserted in your 751G it appears as the SDMMC Disk folder To access this folder select My Computer then tap the SDMMC Disk folder Removing the Secure Digital Card 1 Press the Power key for seconds and th
44. that you must have the date on the 751G set correctly when you enable Validate Server Certificate You must enter a User Name and Subject Name You can also enter a Server 1 Common name or Server 2 Common name if you want to increase your level of security If you select LEAP or EAP FAST a Select User Name type your user name then press Enter b Select User Password type a user password then press Enter 751G Color Mobile Computer User s Manual Chapter 5 Network Support Configuring WPA PSK Security With Funk Security Use this procedure to set WPA PSK security on your 751G with Funk security Profile Label Profile Network Type Infras 9 Channe SSID INTERMEC Power Mode Enable 8021x None ion WPA BY Inter By 11 13 PM GA 1 Make sure you have configured the communications and radio parameters on your 751G and that Funk is your security choice 2 Open Intermec Settings Tap to expand Communications gt 802 11 Radio gt Funk Security gt Profile X with X being 1 through 4 3 For Association select WPA and press Enter 4 For 8021x select None and press Enter 5 For Pre Shared Key enter the pre shared key or the passphrase The pre shared key must be a value of 32 hex pairs preceded by Ox for a total of 66 characters The value must match the key value on the access point The passphrase must be from 8 to 63 ch
45. 0 00 07 05 01 05 03 05 02 05 0 0 0 0 VkeyGold hex 00 00 0B 05 02 03 C1 07 04 03 BE 00 34 00 00 00 09 01 00 00 BF 00 03 02 00 00 BD 00 75 00 72 00 21 00 01 02 00 00 76 00 09 00 73 00 38 01 5B 00 35 00 00 00 BB 01 09 05 22 00 32 01 36 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 07 05 01 05 03 05 02 05 VkeyAlpha hex 00 00 0B 05 02 03 C1 07 04 03 BE 00 47 00 00 00 25 00 00 00 08 00 03 02 00 00 1B 00 28 00 02 02 50 00 01 02 00 00 26 00 27 00 41 00 54 00 20 00 N 4A 00 00 00 01 03 44 00 57 00 0D 00 4D 00 00 00 N 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 07 05 01 05 03 05 02 05 102 751G Color Mobile Computer User s Manual d Maintaining the Computer Use this chapter to update your system software solve problems you may encounter and perform routine maintenance 751G Color Mobile Computer User s Manual 103 Chapter 4 Maintaining the Computer Updating the System Software When you upgrade your 751G you are updating the operating system OS and the Persistent Storage Manager PSM files The PSM files are stored in the F
46. 2 Tap to expand Communications gt 802 11 Radio gt Funk Security 120 751G Color Mobile Computer User s Manual Chapter 5 Network Support 3 Select an active profile then configure its security settings Hs cat view nen Joe Device Name WindowsCE 802 11 Radio Security Choice Funk Secu Allow Security Changes Profile 1 Profile 2 BF 3 Pl E Inter dy D gt 11 04 mu d E Using WPA Security Wi Fi Protected Access WPA is a strongly enhanced interoperable Wi Fi security that addresses many of the vulnerabilities of Wired Equivalent Privacy WEP Instead of WEP WPA uses Temporal Key Integrity Protocol TKIP for its data encryption method Currently WPA satisfies IEEE 802 11i standards WPA runs in Enterprise 802 1x mode or PSK mode In Enterprise mode WPA provides user authentication using 802 1x and the Extensible Authentication Protocol EAP That is an authentication server such as a RADIUS server must authenticate each device before the device can communicate with the wireless network n PSK mode WPA provides user authentication using a shared key between the authenticator and the 751G WPA PSK is a good solution for small offices or home offices that do not want to use an authentication server To use WPA security you need an access point with an 802 11b g radio that supports WPA Configuring WPA Security With Funk Security Use this procedure to
47. 3 Configuring the Computer end if return codeINSTALL EXIT DONE codeUNINSTALL_INIT Uninstall_Init HWND hwndParent LPCTSTR pszInstallDir TODO Perform the reverse of INSTALL INIT here return CodeUNINSTALL INIT CONTINUE COdeUNINSTALL EXIT Uninstall Exit HWND hwndParent TODO Perform the reverse of INSTALL EXIT here return codeUNINSTALL EXIT DONE The system software looks for this directory structure and its files on the installed media card storage card or embedded flash file system No other folders need exist 2577 autorun exe 2577 autorun dat 2577 autocab exe 2577 autocab dat cabfiles cab Creating Cab Files with CAB Wizard After you create the inf file and the optional Setup dll file use the CAB Wizard to create the cab file Below is the command line syntax cabwiz exe inf file dest dest directory err error file cpu cpu type cpu typel A batch file in program directory with these commands works well cabwiz exe c appsoft lt program gt lt inf_file_name gt cd appsoft lt program gt inf file The Setup inf file path dest directory The destination directory for the cab files If no directory is specified the cab files are created in the inf file directory error file File name for a log file that contains all warnings and errors that are encountered when the cab files are compiled If no f
48. 417 Code 39 UPC EA11 Standard Minimum Reading Distances with 0 04 Setbacks Symbology Code 39 UPC EAN Datamatrix PDF417 Density 35 mil 15 mil 10 mil 8 mil 6 6 mil 15 mil 10 mil 8 mil 13 mil Density 0 125 mm 5 mil 0 20 mm 8 mil 0 25 mm 10 mil 0 50 mm 20 mil 0 33 mm 13 mil 0 191 mm 7 5mil 0 254 mm 10 mil 0 381 mm 15 mil Near Distance 4 98 cm 1 96 9 30 cm 3 66 7 77 cm 3 06 8 28 cm 3 26 11 33 cm 4 46 5 23 cm 2 06 8 03 cm 3 16 8 79 cm 3 46 6 25 cm 2 46 Minimum Distance Maximum Distance 7 26 cm 2 86 3 96 cm 1 56 3 45 cm 1 36 4 98 cm 1 96 4 98 cm 1 96 3 71 cm 2 46 5 98 cm 1 96 0 168 mm 6 6 mil 6 25 cm 2 46 0 254 mm 10 mil 0 381 mm 15 mil 4 47 cm 1 76 4 98 cm 1 96 Far Distance 33 92 cm 12 96 16 41 cm 6 46 22 76 cm 8 96 20 22 cm 7 96 15 77 cm 6 21 29 87 cm 11 76 23 27 cm 9 16 19 20 cm 7 56 31 65 cm 12 46 12 09 cm 4 76 20 98 cm 8 26 25 04 cm 9 86 40 28 cm 15 86 29 92 cm 11 66 16 41 cm 6 46 20 73 cm 8 16 27 58 cm 10 86 13 87 cm 5 46 21 74 cm 8 56 33 43 cm 13 16 Minimum distance depends on symbology length and scan angle 751G Color Mobile Computer User s Manual Chapter 3 Configuring the Computer in I E d 4 d dg d qp Pd LeU dq od p gp Data Matrix 7 5 mils IPDFA17 66 mils e 0 125mm 5mils i i a5 0 2
49. 45 5 572 007 5 576 529 5 592 512 5 594 230 5 598 007 5 608 578 5 616 909 5 619 027 5 627 360 5 640 001 5 657 317 5 659 431 5 671 436 5 672 860 5 684 290 5 719 678 5 729 003 5 793 604 5 742 041 5 761 219 5 764 798 5 777 308 5 777 309 5 777 310 5 786 583 5 798 509 5 798 513 5 804 805 5 805 807 5 811 776 5 811 777 5 818 027 5 821 523 5 828 052 5 831 819 5 834 749 5 834 753 5 837 987 5 841 121 5 842 070 5 844 222 5 854 478 5 862 267 5 869 840 5 873 070 5 877 486 5 878 395 5 883 492 5 883 493 5 886 338 5 889 386 5 895 906 5 898 162 5 902 987 5 902 988 5 912 452 5 923 022 5 936 224 5 949 056 5 969 321 5 969 326 5 969 328 5 979 768 5 986 435 5 987 192 5 992 750 6 003 775 6 012 640 6 016 960 6 018 597 6 024 289 6 034 379 6 036 093 6 039 252 6 064 763 6 075 340 6 095 422 6 097 839 6 102 289 6 102 295 6 109 528 6 119 941 6 128 414 6 138 915 6 149 061 6 149 063 6 152 370 6 155 490 6 158 661 6 164 542 6 164 545 6 173 893 6 195 053 6 234 393 6 234 395 6 244 512 6 249 008 6 328 214 6 330 975 6 345 765 6 356 949 6 367 699 6 375 075 6 375 076 6 431 451 6 435 411 6 484 944 6 488 209 6 497 368 6 532 152 6 538 413 6 539 422 6 621 942 6 641 046 6 681 994 6 687 403 6 688 523 6 732 930 Des 417445 Docking Station Device 5 052 943 5 195 183 5 317 691 5 331 580 5 544 010 5 644 471 There may be other U S and foreign patents pending 751G Color Mob
50. 5 mm 10 mils 0 10 20 30 40 50 EA11 Standard Minimum Reading Distances Installing Applications on the Computer Consider one of the following options to get the package to the preferred location on your 751G Microsoft ActiveSync Secure Digital storage cards page 44 SmartSystems Console page 45 e Wavelink Avalanche page 45 Using Microsoft ActiveSync Note These instructions assume the 751G Management Tools were Z installed on your desktop The Microsoft ActiveSync tool is located on the 751G Companion CD See Chapter 2 Windows CE NET for information about this tool as provided by Microsoft Corporation This can be a serial USB or 802 11i Microsoft ActiveSync connection Files can be copied using Windows Explorer on a PC or a laptop computer This is usually good when updating a few 751Gs These instructions assume that Microsoft ActiveSync was installed onto your PC and is up and running If not go to Chapter 2 Windows CE NET for an URL from which to download the latest application 751G Color Mobile Computer User s Manual 43 Chapter 3 Configuring the Computer a Explore Using a Storage Card 44 To use Microsoft ActiveSync 1 Use an ActiveSync cable to connect the 751G to your PC 2 Wait for a Connected message to appear in the Microsoft ActiveSync 3 application to signal a connection to the 751G If necessary select File gt Get Connected to initiat
51. 751G then press the power switch again to and you cannot enter data turn on the 751G Press and hold the power switch ten seconds to warm boot the 751G Try reloading the firmware See Updating the System Software on page 104 If the 751G does not boot or reset contact your Intermec representative for help 106 751G Color Mobile Computer User s Manual Chapter 4 Maintaining the Computer Problems While Configuring the Computer Problem You scan a configuration command such as Beeper Volume and you hear three low beeps You scan or enter an option for the Scanner Model configuration command and you hear three low beeps You cannot type a character on the keypad or you can only type uppercase or lowercase letters Solution If you are working in the Intermec Settings applet you cannot scan configuration commands Exit the applet to scan configuration commands You may have scanned or entered a Scanner Model command that does not apply to the type of scanner that you have installed Try scanning or entering the Scanner Model command again and select an option for the type of device you are using You may have locked a modifier key on the keypad Check the 751G toolbar to see if it contains an icon with a locked symbol Press the necessary key sequence to unlock the key See Keypad on page 10 Problems with Wireless Connectivity Problem When you turn on the 751G after it was suspended for a while 10 15 minut
52. A Wi Fi Protected Access 119 WPA security Funk 121 WPA2 Wi Fi Protected Access 119 Writing mode Pocket Word 32 Writing on the screen Pocket Word 32 X Xscale processor ID IOCTL GET CPU ID 77 Z Zebra PT403 portable printer 39 ZNICZIO DLL 78 139 Index 140 751G Color Mobile Computer User s Manual fatermec Corporate Headquarters 6001 36th Avenue West Everett Washington 98203 U S A tel 425 348 2600 fax 425 355 9551 www intermec com 751G Color Mobile Computer User s Manual P N 961 054 036C
53. CT STORE STATE CLEAR IOCTL HAL GET BOOT DEVICE This IOCTL code allows software to check which device CE booted from Usage Zinclude oemioctl h Syntax BOOL KernelloControl IOCTL HAL GET BOOT DEVICE LPVOID lpInBuf DWORD nInBufSize LPVOID lpOutBuf DWORD nOutBufSize LPDWORD lpBytesReturned Parameters IpInBuf Should be set to NULL IpInBufSize Should be set to zero IpOutBuf Must point to a buffer large enough to hold a DWORD 4 bytes with the boot device The following boot devices are supported define HAL BOOT DEVICE UNKNOWNO define HAL BOOT DEVICE ROM XIP 1 Zdefine HAL BOOT DEVICE ROM 2 define HAL BOOT DEVICE PCMCIA ATA 3 define HAL BOOT DEVICE PCMCIA LINEAR 4 define HAL BOOT DEVICE IDE ATA 5 define HAL BOOT DEVICE IDE ATAPI 6 nOutBufSize The size of pOutBuf in bytes 4 IpBytesReturned The number of bytes returned by the function Return Values Returns TRUE if function succeeds Returns FALSE if the function fails GetLastError may be used to get the extended error value 751G Color Mobile Computer User s Manual 75 Chapter 3 Configuring the Computer IOCTL HAL REBOOT Note Using this is no longer recommended use Z IOCTL_HAL_WARMBOOT page 73 or IOCTL_HAL_COLDBOOT page 74 This is supported for backward compatibility but its use can lead to difficulties Causes the system to perform a warm
54. Connection switch to the Internet Explorer and browse to a web or WAP page Ending a Connection To disconnect do one of the following When connected via cable or cradle detach your 751G When connected via a wireless network switch off the connection 751G Color Mobile Computer User s Manual 117 Chapter 5 Network Support Configuring Security Loading Certificates P T Certificates Wireless Networks 118 Use the next sections to understand how to configure each type of security on your wireless 751G If you choose to use Transport Layer Security TLS with WPA or 802 1x security you need to have a unique client certificate on the 751G and a trusted root certificate authority CA certificate If you choose to use PEAP you need to load a root CA certificate You can use a third party CA to issue unique client certificates and a root certificate If your CA is on your WLAN select Start gt Settings gt Control Panel double tap the Certificates icon then tap View to see certificate details To remove a certificate press and hold a certificate then select Delete Lists the certificates trusted by you Import View Equifax Secure Ce GlobalSign Root cv Remove Your wireless adapter network interface card connects to wireless networks of two types infrastructure networks and ad hoc networks Infrastructure networks get you in your corporate network and Int
55. DLL Optimal string that specifies a SETUP DLL file It is written by the Independent Software Vendor ISV and contains customized functions for operations during installation and removal of the application The file must be specified in the SourceDisksFiles section self reg DLL filename String that identifies files that self register by exporting the DllRegisterServer and DllUnregisterServer Component Object Model COM functions Specify these files in the SourceDiskFiles section During installation if installation on the device fails to call the file s exported DlIRegisterServer function the file s exported DllUnregisterServer function will not be called during removal Example DefaultInstall AddReg RegSettings All CEShortcuts Shortcuts All SourceDiskNames This section describes the name and path of the disk on which your application resides Required Yes disk ordinal disk_label path 1 App files C Appsoft RP32 2 Font files C Rp Tools 3 CE Tools C windows ce tools CESignature Windows CE Example SourceDisksNames Required section 1 Common files C app common Using an absolute path SourceDisksNames SH3 2 SH3 files sh3 Using a relative path SourceDisksNames MIPS 2 MIPS files mips Using a relative path SourceDiskFiles This describes the name and path of files in which your application resides Required Yes filename
56. EP NOT SUPPORTED NDIS ENCRYPTION 1 KEY ABSENT Indicates that AES TKIP and WEP are disabled and a transmit key is not available Same as NDIS RADIO WEP ABSENT NDIS ENCRYPTION 2 ENABLED Indicates that TKIP and WEP are enabled AES is not enabled and a transmit key is available NDIS ENCRYPTION 2 KEY ABSENT Indicates that there are no transmit keys available for use by TKIP or WEP TKIP and WEP are enabled and AES is not enabled NDIS ENCRYPTION 3 ENABLED Indicates that AES TKIP and WEP are enabled and a transmit key is available NDIS ENCRYPTION 3 KEY ABSENT Indicates that there are no transmit keys available for use by AES TKIP or WEP and AES TKIP and WEP are enabled Return Values ERROR SUCCESS when successful ERR QUERY FAILED when the query failed or Remarks Definitions 88 ERR CONNECT FAILED ifa connection with the radio failed None ifdef DYNAMIC LOADING typedef UINT PFN EncryptionStatus UINT mode else UINT EncryptionStatus UINT mode endif RemoveWep Call this with a key index of 0 3 to remove the WEP key at that index Syntax UINT RemoveWep ULONG Parameters ULONG value that specifies the key index to set Valid values are 0 3 Return Values ERROR_SUCCESS when successful ERR_QUERY_FAILED when the query failed or ERR CONNECT FAILED if a connection with the radio failed Remarks On disassociation with all BSSIDs of the current service set WE
57. ETOOTH INSTALLED Reads state of Bluetooth radio installed flag BOOLEAN DWORD returned in buffer pointed to by pOutBuffer TRUE indicates Bluetooth radio installed FALSE is no Bluetooth radio installed ITC NVPARM SERIAL2 INSTALLED Reads state of serial 2 COM2 device installed flag BOOLEAN DWORD returned in buffer pointed to by IpOutBuffer TRUE indicates serial 2 device is installed FALSE is no serial 2 device is installed ITC NVPARM VIBRATE INSTALLED Reads state of vibrate device installed flag BOOLEAN DWORD is returned in buffer pointed to by pOutBuffer TRUE indicates vibrate device is installed FALSE is no vibrate device is installed ITC NVPARM LAN9000 INSTALLED Reads state of Ethernet device installed flag BOOLEAN DWORD is returned in buffer pointed to by pOutBuffer TRUE indicates Ethernet device is installed FALSE is no Ethernet device is installed ITC NVPARM SIM PROTECT HW INSTALLED Reads state of SIM card protection hardware installed flag BOOLEAN DWORD returned in buffer pointed to by IpOutBuffer TRUE indicates SIM card protection hardware installed FALSE is no such hardware installed ITC NVPARM SIM PROTECT SW INSTALLED Reads state of SIM card protection software installed flag BOOLEAN DWORD returned in buffer pointed to by IpOutBuffer TRUE indicates SIM card protection software is installed FALSE is no such software installed IOCTL HAL ITC WRITE SYSPARM Describes and enables the registry save location
58. GetAssociationStatus Call this to obtain the radio s current association status with a service set Syntax UINT GetAssociationStatus ULONG amp Parameters NDIS RADIO ASSOCIATED Indicates the radio is associated with an access point NDIS RADIO SCANNING Indicates radio is looking for an access point with which to associate Return Values ERROR SUCCESS when successful ERR QUERY FAILED when the query failed or ERR CONNECT FAILED if a connection with the radio failed Remarks Data is only valid if the function returns ERROR SUCCESS Also if ERROR SUCCESS is returned your ULONG reference is populated by one of the parameters listed above Definitions ifdef DYNAMIC LOADING typedef UINT PFN GetAssociationStatus ULONG amp else UINT GetAssociationStatus ULONG amp endif 751G Color Mobile Computer User s Manual 79 Chapter 3 Configuring the Computer Syntax Parameters Return Values Remarks Definitions 80 GetAuthenticationMode Call this function to obtain the radio s current authentication mode UINT GetAuthenticationMode ULONG amp NDIS RADIO AUTH MODE OPEN 802 11b g Open Authentication Indicates that the radio is using an open system NDIS RADIO AUTH MODE SHARED 802 11b g Shared Authentication Indicates that the radio is using a shared key NDIS RADIO AUTH MODE AUTO Auto switch between Open Shared Indicates automatic detection is used when available ND
59. HAL verion of Pocket PC IOCTL HAL GET BOOTLOADER VE RINFO 73 IOCTL HAL GET OAL VERINFO 72 Headset jack 4 Helper functions 92 Hirose docking connector headset jack 4 microphone 3 l ID field values IOCTL_HAL_ITC_READ_PARM ITC_NVPARM_80211_INSTALLED 70 ITC_NVPARM_80211_RADIOTYPE 70 ITC_NVPARM_ANTENNA_DIVERSITY 09 ITC NVPARM BLUETOOTH INSTAL LED 70 ITC NVPARM CONTRAST 69 ITC NVPARM DISPLAY TYPE 68 ITC_NVPARM_ECN 69 ITC_NVPARM_EDBG_SUBNET 69 ITC NVPARM EDG ID 68 ITC NVPARM ETHERNET ID 68 ITC NVPARM INTERMEC DATACOL 132 LECTION HW 69 ITC NVPARM INTERMEC DATACOL LECTION SW 69 ITC NVPARM INTERMEC SOFTWAR E CONTENT 69 ITC NVPARM LAN9000 INSTALLED 70 ITC NVPARM MANF DATE 68 ITC NVPARM MCODE 69 ITC NVPARM RTC RESTORE 69 ITC NVPARM SERIAL NUM 68 ITC NVPARM SERIAL2 INSTALLED 70 ITC NVPARM SERVICE DATE 68 ITC NVPARM SIM PROTECT HW I NSTALLED 70 ITC NVPARM SIM PROTECT SW IN STALLED 70 ITC NVPARM VERSION NUMBER 69 ITC NVPARM VIBRATE INSTALLED 70 ITC NVPARM WAN FREQUENCY 69 ITC NVPARM WAN INSTALLED 69 ITC NVPARM WAN RADIOTYPE 69 ITC NVPARM WAN RI 69 IOCTL HAL ITC WRITE SYSPARM ITC DOCK SWITCH 71 ITC_ WAKEUP MASK 71 ITC AMBIENT FRONTLIGHT 71 ITC AMBIENT KEYBOARD 71 ITC REGISTRY SAVE ENABLE 71 IDLs data collection 9 device 67 98 smartsystems foundation 105 URL 15 Imager beeper volume turning it off 9 turning it on 8 configuration parameter
60. Help Additional programs that can be installed on the The Windows CE NET Companion CD mobile computer Connecting to and synchronizing with a PC The Quick Start Guide or ActiveSync Help on your PC Last minute updates and detailed technical The Read Me files located in the Microsoft ActiveSync folder on information the PC and on the Windows CE NET Companion CD Up to date information on your Windows CE NET msdn microsoft com embedded downloads ce default aspx device Use these URLs for additional information about Microsoft Windows CE NET msdn microsoft com support support microsoft com www microsoft com technet community newsgroups security default mspx a free support option Basic Skills Learning to use your 751G is easy This section describes the basic concepts of using and customizing your 751G 22 751G Color Mobile Computer User s Manual Chapter 2 Windows CE NET Desktop Screen When you turn on your 751G for the first time each day you see the Desktop screen Tap to use the Start menu i F p 11 46 c Tap to open an associated program Tap to scroll to other program Tap to list open windows Tap to activate the input panel Double tap to change time format To customize what is displayed on the Desktop screen including the EN background image tap Start gt Settings gt Control Panel then double tap Display the Display icon Status icons display information such a
61. INFO 67 IOCTL HAL GET DEVICEID 72 IOCTL HAL GET OAL VERINFO 72 IOCTL HAL GET RESET INFO 74 IOCTL HAL ITC READ PARM 68 IOCTL HAL ITC WRITE SYSPARM 70 IOCTL PROCESSOR INFORMATION 77 IpInBuf IOCTL_GET_CPU_ID 77 IOCTL HAL COLDBOOT 74 IOCTL HAL GET BOOT DEVICE 75 IOCTL HAL GET BOOTLOADER VERI NFO 73 IOCTL HAL GET DEVICE INFO 67 IOCTL HAL GET DEVICEID 72 IOCTL HAL GET OAL VERINFO 72 IOCTL HAL GET RESET INFO 74 IOCTL HAL ITC READ PARM 68 IOCTL HAL ITC WRITE SYSPARM 70 IOCTL HAL REBOOT 76 IOCTL HAL WARMBOOT 74 IOCTL PROCESSOR INFORMATION 77 IpInBufSize IOCTL_GET_CPU_ID 77 IOCTL HAL COLDBOOT 74 IOCTL HAL GET BOOT DEVICE 75 IOCTL HAL GET DEVICE INFO 67 IOCTL HAL GET DEVICEID 72 IOCTL HAL GET OAL VERINFO 72 IOCTL HAL GET RESET INFO 74 IOCTL HAL REBOOT 76 IOCTL HAL WARMBOOT 74 751G Color Mobile Computer User s Manual IpOutBuf IOCTL GET CDU ID 77 IOCTL HAL COLDBOOT 74 IOCTL HAL GET BOOT DEVICE 75 IOCTL HAL GET BOOTLOADER VERI NFO 73 IOCTL HAL GET DEVICE INFO 67 IOCTL HAL GET DEVICEID 72 IOCTL HAL GET OAL VERINFO 72 IOCTL HAL GET RESET INFO 74 IOCTL HAL ITC READ PARM 68 IOCTL HAL ITC WRITE SYSPARM 70 IOCTL HAL REBOOT 76 IOCTL HAL WARMBOOT 74 IOCTL PROCESSOR INFORMATION 77 M MakeCab exe 66 Memory and storage specifications 19 Messaging getting connected 113 Microphone 3 Microprocessor specifications 19 Microsoft ActiveSync adding programs 28 adding programs to Start men
62. IS RADIO AUTH MODE ERROR Defined as error value Indicates the authentication mode was not determined at this time or is unknown NDIS RADIO AUTH MODE WPA WPA Authentication NDIS RADIO AUTH MODE WLDPA PSK WPA Preshared Key Authentication NDIS_RADIO_AUTH_MODE_WPA_NONE WPA None ERROR_SUCCESS when successful ERR_QUERY_FAILED when the query failed or ERR CONNECT FAILED ifa connection with the radio failed Data is only valid if ERROR SUCCESS is returned Also if ERROR SUCCESS is returned your USHORT reference is populated with one of the parameters listed above ifdef DYNAMIC LOADING typedef UINT PFN GetAuthenticationMode ULONG amp else UINT GetAuthenticationMode ULONG amp endif GetBSSID Call this function to get the current MAC address BSSID of the service set In ESS mode this is the MAC address of the access point the radio is associated with In IBSS mode this is a randomly generated MAC address and serves as the ID for the IBSS Syntax UINT GetBSSID TCHAR Parameters Pointer to a character array which is populated with the current BSSID after a successful call Return Values ERROR_SUCCESS when successful ERR_QUERY_FAILED when the query failed or ERR CONNECT FAILED if a connection with the radio failed Remarks If ERROR SUCCESS is returned your TCHAR array is populated with the BSSID of the current service set xx xx xx xx xx xx Definitions ifdef DYNAMIC LOADING typed
63. J Alpha 1 5 751G Color Mobile Computer User s Manual 11 Chapter 1 Using the Computer Alpha Green Plane Keys continued To Enter Press the Keys To Enter Press the Keys k Alpha 5 5 K Alpha 1 5 5 l Alpha 5 5 5 L Alpha 1 5 5 5 m Alpha 6 M Alpha 1 6 n Alpha 6 6 N Alpha 1 6 6 o Alpha 6 6 6 O Alpha 1 6 6 6 p Alpha 7 P Alpha 1 7 q Alpha 7 7 Q Alpha 1 7 7 r Alpha 7 7 7 R Alpha 1 7 7 7 s Alpha 7 7 7 7 S Alpha 1 7 7 7 7 t Alpha 8 T Alpha 1 8 u Alpha 8 8 U Alpha 1 8 8 Y Alpha 8 8 8 V Alpha 1 8 8 8 w Alpha 9 Ww Alpha 1 9 x Alpha 9 9 X Alpha 1 9 9 y Alpha 9 9 9 Y Alpha 1 9 9 9 z Alpha 9 9 9 9 Z Alpha 1 9 9 9 9 LEDs The battery status LED and the scanning keypad shift and notification LED turn red green or yellow Battery Status LED LED Color and Action Description Steady Green Battery is more than 95 charged and the 751G is on charger Blinking Red Battery is low The blinking speed increases as the battery s power gets increasingly lower Red Main battery is low or if charging remains red until the 95 charge status is reached Yellow The 751G is on a charging source and there is no battery pack installed The mobile computer may also be out of the charging range
64. LEAN DWORD returned in buffer pointed to by pOutBuffer indicating whether diversity antenna is installed TRUE indicates installed FALSE is not installed ITC NVPARM WAN RI Reads state of WAN ring indicator flag BOOLEAN DWORD returned in buffer pointed to by pOutBuffer indicating polarity of WAN RI signal TRUE indicates active high FALSE is active low ITC NVPARM RTC RESTORE Reads state of real time clock restore flag BOOLEAN DWORD returned in buffer pointed to by pOutBuffer TRUE indicates RTC is restored on cold boot FALSE is RTC is not restored ITC NVPARM INTERMEC DATACOLLECTION SW Reads state of data collection software enabled flag BOOLEAN DWORD returned in buffer pointed to by pOutBuffer indicating data collection software installs at boot time FALSE is do not install data collection software ITC NVPARM INTERMEC DATACOLLECTION HW Reads data collection hardware flags BYTE returned in buffer pointer to by pOutBuffer indicating type of data collection hardware installed Maximum value returned is ITC DEVID SCANHW MAX ITC DEVID SCANHW NONE No scanner hardware installed ITC DEVID OEM2D IMAGER OEM 2D imager installed ITC DEVID INTERMEC2D IMAGER Intermec 2D imager installed ITC DEVID SE900 LASER SE900 laser installed ITC DEVID SE900HS LASER SE900HS laser installed ITC DEVID INTERMEC EVIO EVIO linear imager installed High bit non zero value indicates S6 scanning engine is installed Bit mask is ITC DEVID SGENGINE MA
65. M card slot 16 SIM cards protection hardware 70 software installed 70 SmartSystems 9 41 45 127 upgrading computer 105 Software versions CE NET build 14 PSM builds 14 SourceDisksNames MIPS 56 SourceDisksNames SH3 56 Speaker 3 138 Specifications 18 battery 19 display 18 environmental 18 expansion slots 18 integrated scanner options 18 integrated wireless 18 keypad options 19 memory and storage 19 microprocessor 19 operating system 19 physical dimensions 19 regulatory approvals 19 standard communications 19 Standard communications specifications 19 Start Menu adding programs 29 via Microsoft ActiveSync 29 via Windows Explorer 29 StartScanList 95 StartSupplicant 96 Static WEP security Funk 125 Status icons Windows CE NET 23 StopSupplicant 96 Storage media 15 specifications 18 Storage temperature 18 SwitchPacketDriver 96 Synchronize system time 36 Synchronizing Pocket Word 32 System Properties applet active programs 26 System time 36 SYSTEMINFO dwProcessorType 54 T Tahoma ttf 56 Temperatures battery 19 specifications 18 Temporal Key Integrity Protocol 119 Tethered scanner settings 41 Time server 36 TKIP Temporal Key Integrity Protocol 119 Tools CD CAB files 44 751G Color Mobile Computer User s Manual Troubleshooting 106 802 1x security 108 bar code scanning 108 CAB Wizard 66 configuration 107 operation 106 wireless connectivit
66. MODE ON GetCCxXStatus 86 SetCCXStatus 91 NDIS POWER LEVEL 1 GetTXPower 85 NDIS POWER LEVEL 15 GetTXPower 85 NDIS POWER LEVEL 30 GetTXPower 85 NDIS POWER LEVEL 5 GetTXPower 85 NDIS POWER LEVEL 63 GetTXPower 85 H 135 Index NDIS_POWER_LEVEL_UNKNOWN GetTXPower 85 NDIS_RADIO_ASSOCIATED GetAssocationStatus 79 NDIS_RADIO_AUTH_MODE_AUTO GetAuthenticationMode 80 SetAuthenticationMode 89 NDIS_RADIO_AUTH_MODE_ERROR GetAuthenticationMode 80 SetAuthenticationMode 89 NDIS_RADIO_AUTH_MODE_OPEN GetAuthenticationMode 80 SetAuthenticationMode 89 NDIS_RADIO_AUTH_MODE_SHARED GetAuthenticationMode 80 SetAuthenticationMode 89 NDIS RADIO AUTH MODE WPA GetAuthenticationMode 80 SetAuthenticationMode 89 NDIS RADIO AUTH MODE WPA NONE GetAuthenticationMode 80 SetAuthenticationMode 89 NDIS RADIO AUTH MODE WDPA PSK GetAuthenticationMode 80 SetAuthenticationMode 89 NDIS RADIO POWER AUTO GetPowerMode 84 SetPowerMode 90 NDIS_RADIO_POWER_MODE_CAM GetPowerMode 84 SetPowerMode 90 NDIS_RADIO_POWER_MODE_FAST_PSP GetPowerMode 84 SetPowerMode 90 NDIS_RADIO_POWER_MODE_PSP GetPowerMode 84 SetPowerMode 90 NDIS_RADIO_POWER_UNKNOWN GetPowerMode 84 SetPowerMode 90 NDIS_RADIO_SCANNING GetAssociationStatus 79 NDIS_SUPP_LOGGING_OFF EnableSuppLogging 92 NDIS_SUPP_LOGGING_ON EnableSuppLogging 92 NDISUIO DLL 78 NDISUIO_PACKET_DRIVER
67. Manual 61 Chapter 3 Configuring the Computer readme txt 0 Files WinCE wcestart ini 0 RegSettings All HKLM SOFTWAREMMicrosoftNShellNAutoHide 0x00010001 1 Autohide the taskbar HKLM SOFTWAREMMicrosoftNShellNOnTop 0x00010001 0 Shell is not on top HKLM SOFTWAREMMicrosoftNClock SHOW CLOCK 0x00010001 0 Clock is not on taskbar Using Installation Functions in Setup dll Setup dll is an optional file that enables you to perform custom operations during installation and removal of your application The following list shows the functions that are exported by Setup dll Install Init Called before installation begins Use this function to check the application version when reinstalling an application and to determine if a dependent application is present Install Exit Called after installation is complete Use this function to handle errors that occur during application installation Uninstall Init Called before the removal process begins Use this function to close the application if the application is running Uninstall Exit Called after the removal process is complete Use this function to save database information to a file and delete the database and to tell the user where the user data files are stored and how to reinstall the application Note Use DefaultInstall gt CESelfRegister page 56 in the inf file to Z point to Setup dll After the CAB File Extraction Cab files that ne
68. O_ID p Output buffer has information about LED current settings pOutput Pointer to the buffer to which the information is returned The buffer points to various structure types defined in nled h depending on the value of nld as detailed in the following table Value of nID Structure in pOutput LED COUNT INFO NLED COUNT INFO NLED SUPPORTS INFO NLED SUPPORTS INFO NLED SETTINGS INFO NLED SETTINGS INFO NLEDSetDevice Usage include nled h Syntax BOOL NLEDSetDevice UINT nDeviceId void pInput Parameters nDeviceld Integer specifying the device identification The following is defined NLED SETTINGS INFO ID Contains information about the desired LED settings pinput Pointer to the buffer that contains the NLED SETTINGS INFO structure Reboot Functions 98 There are several methods via Kernel I O Control functions that an application program can use to force the 751G to reboot You can also see the Device Resource Kit in the IDL for information about these functions The IDL is available as a download from the Intermec web site at www intermec com idl Contact your Intermec representative for information e IOCIL HAL REBOOT This performs a warm boot page 76 See note on the next page 751G Color Mobile Computer User s Manual Chapter 3 Configuring the Computer e IOCTL_HAL_COLDBOOT Forces a cold reboot This resets the 751G reloads Windows CE as if a power up was performed and discards the conte
69. P Extensible Authentication Protocol 119 EAP FAST 119 120 EasySet scan bar code labels 39 EnableSuppLogging 92 EnableWep 87 EnableZeroConfig 93 EncryptionStatus 88 EncryptWepKeyForRegistry Deprecated 97 Ending a connection 117 Environmental specifications 18 Epson Escape Sequences 39 ERROR INSUFFICIENT BUFFER IOCTL HAL ITC READ PARM 68 IOCTL HAL ITC WRITE SYSPARM 71 ERROR INVALID PARAMETER IOCTL HAL ITC READ PARM 68 IOCTL HAL ITC WRITE SYSPARM 71 Expansion slot specifications 18 Extensible Authentication Protocol 119 F FAST Flexible Authentication via Secure Tunneling 119 120 Files accessing on the Secure Digital card 17 Flash File Store packaging an application 47 Flexible Authentication via Secure Tunneling FAST 119 120 Funk security 120 802 1x 123 selecting a profile 120 static WEP 125 WPA 121 G GDI approach 39 GetAssociationStatus 79 GetAuthenticationMode 80 GetBSSID 80 131 Index GetCCxStatus 86 GetCurrentDriverName 93 GetDiversity 81 GetLinkSpeed 81 GetMac 82 GetMedia Deprecated 97 GetMedium Deprecated 97 GetNetworkMode 82 GetNetworkType 83 GetNicStats Deprecated 97 GetPowerMode 84 GetRadioIpAddress 86 GetRSSI 84 GetRTSThreshold Deprecated 97 GetSSID 83 Getting connected ISP 113 to an ISP 113 creating a modem connection 113 to work 116 Windows Mobile 113 GetTXPower 85 GetWepStatus 85 H
70. P key is removed by the adapter Definitions ifdef DYNAMIC LOADING typedef UINT PFN RemoveWEP ULONG else UINT RemoveWEP ULONG endif 751G Color Mobile Computer User s Manual Chapter 3 Configuring the Computer SetAuthenticationMode Call this function to set the desired authentication mode Syntax UINT SetAuthenticationMode ULONG Parameters NDIS RADIO AUTH MODE OPEN 802 11b g Open Authentication Indicates that the radio is using an open system NDIS RADIO AUTH MODE SHARED 802 11b g Shared Authentication Indicates that the radio is using a shared key NDIS RADIO AUTH MODE AUTO Auto switch between Open Shared Indicates automatic detection is used when available NDIS RADIO AUTH MODE ERROR Defined as error value Indicates the authentication mode was not determined at this time or is unknown NDIS RADIO AUTH MODE WPA WPA Authentication NDIS RADIO AUTH MODE WLDPA PSK WPA Preshared Key Authentication NDIS_RADIO_AUTH_MODE_WPA_NONE WPA None Return Values ERROR SUCCESS when successful ERR QUERY FAILED when the query failed or ERR CONNECT FAILED if a connection with the radio failed Remarks None Definitions ifdef DYNAMIC_LOADING typedef UINT PFN_SetAuthenticationMode ULONG else UINT SetAuthenticationMode ULONG endif SetChannel This function is currently not implemented Ad hoc networks automatically select a channel or use the a
71. S RADIO POWER UNKNOWN Unknown power mode NDIS RADIO POWER AUTO Auto NDIS RADIO POWER MODE FAST PSP Fast PSP good savings fast ERROR SUCCESS when successful ERR QUERY FAILED when the query failed or ERR CONNECT FAILED ifa connection with the radio failed None ifdef DYNAMIC LOADING typedef UINT PFN SetPowerMode ULONG mode else UINT SetPowerMode ULONG mode endif 751G Color Mobile Computer User s Manual Chapter 3 Configuring the Computer SetSSID Call this function with a pointer to a null terminated TCHAR array containing the desired SSID to set the desired SSID of the adapter Syntax UINT SetSSID TCHAR Parameters Pointer to a character array that contains the desired SSID This should be null terminated Return Values ERROR SUCCESS when successful ERR QUERY FAILED when the query failed or ERR CONNECT FAILED ifa connection with the radio failed Remarks If an ANY network is desired pass in __T ANY Definitions ifdef DYNAMIC LOADING typedef UINT PFN SetSSID ICHAR else UINT SetSSID TCHAR endif SetCCXStatus Call this function to set the desired CCX Network EAP status Syntax UINT SetCCXStatus ULONG Parameters NDIS NETWORK EAP MODE OFF Disable Network EAP CCX NDIS NETWORK EAP MODE ON Enable Network EAP CCX Return Values ERROR SUCCESS when successful ERR QUERY FAILED when the query failed or ERR CONNECT FAILED ifa connection wit
72. SDMMC_Disk AppName Example CEStrings AppName Game Pack InstallDir CE1 AppName Strings This section is optional and defines one or more string keys A string key represents a string of printable characters Required No string key value String consisting of letters digits other printable characters Enclose value in double quotation marks if corresponding string key is used in an item requiring double quotation marks No string_keys is okay Example Strings reg_path Software Intermec My Test App CEDevice Describes the platform for the targeted application All keys are optional If a key is nonexistent or has no data Windows CE does not perform any checking except the UnsupportedPlatforms If the UnsupportedPlatforms key exists but no data the previous value is not overridden Yes processor_type The value that is returned by SYSTEMINFO dwProcessorType For example the value for the ARM CPU is 2577 platform_family_name Lists known unsupported platform family names If name specified in CEDevice xxx section is different from in CEDevice section both platform_family_name values are unsupported for microprocessor specified by xxx The list of unsupported platform family names is appended to the previous list of unsupported names Application Manager will not display the application a an unsupported platform User will be warned during the setup process if the cab file is copie
73. SK ITC NVPARM WAN INSTALLED Reads state of WAN radio installed flag BOOLEAN DWORD is returned in buffer TRUE WAN radio installed ITC_NVPARM_WAN_FREQUENCY Reads state of WAN radio frequency flag BOOLEAN DWORD is returned in buffer TRUE indicates WAN radio frequency is United States FALSE is a European WAN radio frequency ITC_NVPARM_WAN_RADIOTYPE Reads WAN radio ID installed by manufacturing BYTE returned in buffer pointer to by e eid indicating type of WAN radio hardware installed Maximum value returned is ITC DEVID WANRADIO MAX ITC DEVID WANRADIO NONE No WAN radio installed ITC DEVID WANRADIO SIERRA SB555 CDMA Sierra Wireless radio ITC DEVID WANRADIO XIRCOM GEM3503 GSM GPRS Intel Xircom radio ITC DEVID WANRADIO SIEMENS MC45 GSM GPRS Siemens radio ITC DEVID WANRADIO SIEMENS MC46 GSM GPRS Siemens radio 751G Color Mobile Computer User s Manual 69 Chapter 3 Configuring the Computer ID Field Values ITC NVPARM 80211 INSTALLED Reads state of 802 11b or b g radio installed flag BOOLEAN DWORD returned in buffer TRUE radio installed ITC_NVPARM_80211_RADIOTYPE Reads 802 11b or b g radio ID installed by manufacturing BYTE returned in buffer pointer to by pOurBuffer indicates type of radio hardware installed ITC DEVID 8021 IRADIO MAX is maximum value returned ITC_DEVID_80211RADIO_NONE No 802 11b or 802 11b g radio installed ITC DEVID 80211RADIO INTEL 2011B Intel 2011B radio installed ITC NVPARM BLU
74. ULL nOutBufSize Should be zero Return Values None IOCTL HAL GET RESET INFO 74 This code allows software to check the type of the most recent reset Usage Zinclude oemioctl h Syntax BOOL KernelloControl IOCTL HAL GET RESET INFO LPVOID lpInBuf DWORD nInBufSize LPVOID lpOutBuf DWORD nOutBufSize LPDWORD lpBytesReturned Parameters IlpInBuf Should be set to NULL IpInBufSize Should be set to zero IpOutBuf Must point toa HAL RESET INFO structure See sample below nOutBufSize The size of HAL_RESET_INFO in bytes IpBytesReturned The number of bytes returned by the function 751G Color Mobile Computer User s Manual Chapter 3 Configuring the Computer Return Values Returns TRUE if function succeeds Returns FALSE if the function fails GetLastError may be used to get the extended error value Sample typedef struct DWORD ResetReason most recent reset typ DWORD ObjectStoreState state of object store HAL RESET INFO PHAL RESET INFO Reset reason types define HAL RESE TYPE UNKNOWNO define HAL RESET REASON HARDWARE1 cold define HAL RESET REASON SOFTWARE2 suspend define HAL RESET REASON WATCHDOGA define HAL RESET BATT FAULT8 power fail define HAL RESET VDD FAULT16 warm boot Object store state flags define HAL OBJECT STORE STATE UNKNOWNO define HAL OBJE
75. a Aad i ae e te ers ZZ Networking APIS iv au pie Rt b cH Ip CR E E R arp EO EE E a 78 Basic Connect Disconnect Functions 000 cece ee eens 78 RadioGonn ect e week epe Minis how Mana Aenea eae 78 RadioDisconnect oc ei kts eats o Reo BR eto deed 79 RadioDisassociate lees RR 79 Query Information Functions disks tes e MEO eR ME RE ed tary 79 GetAssociationStatus cece cee eee e 79 GetAuthenticationMode ee eee 80 GetBSSID nra uuu Ia fuge ee carr orti C E estos 80 GetDivetsity v eshc ETE eriam d PEN E pi HR e ER Ed 81 Ger iikSpeedU a vas ren ques ena eb eee Slay dbi RUP e Gee ud 81 Get acl e ooo ne ree eese bres tne x exei eed 82 GetNetworkModeQ ccc ce cc ce cee has 82 GetNebwotk ly pel cites woth the E EE E ep 83 GetSSID zx d ue esee etie sesenta den 83 GetPowerMode eir ee ccc ee eee s 84 GetRSSIQU S 2er EDU Sonat aioe ants oes A RU aS oe 84 GetLXPower sus tented ne ohare red t ded alee ne v e I ei d Ue e eee e 85 Get ep EAEUSU ns e secte unos Ea b soe Kb inpar Vos E Rd Eo I te D 85 GetRadiolpAddress ius s exa x Eb ERE HD read aita 86 Get C CXS tatus victos erreurs DA Sepe mou quesos mE 86 Set Information Functions 0 0 0 ccc cc es 87 PGC CBOs Eq cM qu RA sats an ere rd tee WN 87 Enable Web ooo e cedat bm bobus ed base TE i 87 EncfyptionStat s ov oae Now s dui ent er dtr d Pape otal e 88 REMOVE Webs so eio MA Mr ua e rA and RAs es M AAA 88 SetAuthenticationMod
76. abled AutoCab uses WaitForSingleObject on this name Default is disabled If lt PathName gt references a single cab file that file is processed If lt PathName gt references a directory all the cab files in that directory is processed If lt PathName gt is a wild card pattern all files matching that pattern is processed If PathName is omitted InstallCab processes all the cab files in directory CabFiles Example Install all cab files in the Flash File Store XYZ directory regardless AutoCab FILE Flash File Store XYZ cab FORCE Install only one cab file use Intermec cab installation display AutoCab FILE myCab app cab show 2 52 751G Color Mobile Computer User s Manual Chapter 3 Configuring the Computer Creating Cab Files The Windows CE operating system uses a cab file to install an application on a Windows CE based device A cab file is composed of multiple files that are compressed into one file Compressing multiple files into one file provides the following benefits All application files are present A partial installation is prevented The application can be installed from several sources such as a desktop computer or a web site Use the CAB Wizard application CabWiz exe to generate a cab file for your application Creating Device Specific Cab Files Do the following to create a device specific cab file for an applicatio
77. access point or to a different location to reestablish communications until the Network Connection icon appears Any data you collected while out of range is transmitted over the network There may be a problem with the host computer with the connection between the Intermec Application Server and the host computer or with the connection between the access point and the host computer Check with network administrator to make sure the host is running and allowing users to login to the system In a UDP Plus network there may be a problem with the connection between the Intermec Application Server and the host computer Check with network administrator or see the user s manual for the Intermec Application Server In a TCP IP network there may be a problem with the connection between the access point and the host computer Che with network administrator or use your access point user s manual 107 Chapter 4 Maintaining the Computer Problems While Configuring 802 1x Security If you have trouble configuring the computer for 802 1x security check these problems and possible solutions Problem The 751G indicates that it is authenticated but it does not communicate with the host The 751G does not appear to be authenticating and a network connection icon does not appear on the toolbar A network connection icon appears in the toolbar but then disappears The 751G indicates it is not authenticated You are setting up mult
78. ader command BV is the Beeper Volume configuration command 751G Color Mobile Computer User s Manual 37 Chapter 3 Configuring the Computer 38 The computer returns the cgS BV4 transaction to the host application Cg is a TMF Configuration Get response is the Change Configuration reader command BV4 means the Beeper Volume configuration command is set to a value of 4 which is a very high beeper volume Configuring the Computer in a UDP Plus Network Use the host computer to configure a 751G in your wireless network To send and receive configuration data or files write a host application that can communicate with an Intermec Application Server IAS formerly Gateway or DCS 30X For help see the appropriate Gateway or DCS 30X User s Manual Use the Terminal Message Format TMF protocol to send and receive transactions between the host application and the 751G To set up the IAS configure a peer to peer destination name for the host application Create a NGCFGRSP transaction ID that routes to this destination name The IAS uses the transaction ID to route responses from the 751G back to the host application NGCFGRSP is a special transaction ID that the server uses to forward configuration response data from a 751G All configuration responses are routed with the NGCFGRSP transaction ID The IAS cannot track multiple applications sending reader or configuration commands If you have two host applications sen
79. advanced settings Most ISPs now use a dynamically assigned address If the ISP you are connecting to does not use a dynamically assigend address tap TCP IP Settings clear uncheck User server assigned IP address then enter the IP address Tap OK to return to the Modem page TCP IP Settings General Name Servers zd My Connection C Use Slip Use software compression M Use IP header compression Select Hayes Compatible on COMI from the Select a modem drop down then tap Next to continue Modem zd ISP Connection Select a modem H Compatible on COM1 TCP IP Settings Security Settings Back Next 751G Color Mobile Computer User s Manual Chapter 5 Network Support 5 Enter the access phone number then tap Finish to return to the Connection page Phone Number zu ISP Connection Country region code 1 Area cade 425 Phone number Force long distance Force local J 6 Double tap the new connection then enter the user name password Lh and domain if provided by an ISP or your network administrator ISP Dial Up Connection x Connection T EA ISP Connection User Name J Password Domain Save password Phone 9 342451618 Dial from Work 7 Tap Dial Properties then specify your current location from the drop down list Specify your current phone type If your phone type is pulse dial
80. and copy files between your 751G and PC Install Microsoft ActiveSync on the desktop of your PC from the following URL For more information on installing Microsoft ActiveSync see your Quick Start card ActiveSync is already installed on your 751G msdn microsoft com downloads After installation is complete the Microsoft ActiveSync Setup Wizard helps you connect your 751G to your PC or set up a partnership so you can browse for or move information between your 751G and your PC Disconnect the 751G from your PC and you are ready to go Note While Microsoft ActiveSync does synchronize files between your PC Z and your 751G the 751G does not support applications such as Calendar Contacts Tasks Inbox Channels and Pocket Access Microsoft WordPad WordPad works with Microsoft Word on your desktop to access copies of your documents You can create new documents on your 751G or you can copy documents from your desktop to your 751G Synchronize documents between your desktop and your 751G to have up to date content in both locations To access WordPad either double tap the Microsoft WordPad icon on OW your desktop or select Start gt Programs gt Microsoft WordPad a Hales For more information on using Microsoft WordPad select Start gt Help gt WordPad 30 751G Color Mobile Computer User s Manual Chapter 2 Windows CE NET Creating a Document Typing Mode Use WordPad to create documents such as
81. anual Index isZeroConfigEnabled 94 ITC DOCK SWITCH 71 ITC WAKEUP MASRK 71 ITC AMBIENT FRONTLIGHT 71 ITC AMBIENT KEYBOARD 71 ITC DEVID 80211RADIO INTEL 2011B 70 ITC DEVID 80211RADIO MAX values ITC DEVID 80211RADIO INTEL 2011B 70 ITC DEVID 80211RADIO NONE 70 ITC DEVID 80211RADIO NONE 70 ITC DEVID INTERMEC EVIO 69 ITC DEVID INTERMEC2D IMAGER 69 ITC DEVID OEM2D IMAGER 69 ITC DEVID SCANHW MAX values ITC DEVID INTERMEC EVIO 69 ITC DEVID INTERMEC2D IMAGER 69 ITC DEVID OEM2D IMAGER 69 ITC DEVID SCANHW NONE 69 ITC DEVID SE900 LASER 69 ITC DEVID SE900HS LASER 69 ITC DEVID SCANHW NONE 69 ITC DEVID SE900 LASER 69 ITC DEVID SE900HS LASER 69 ITC DEVID WANRADIO NONE 69 ITC DEVID WANRADIO SIEMENS MC45 69 ITC DEVID WANRADIO SIEMENS MC46 69 ITC DEVID WANRADIO SIERRA SB555 69 ITC DEVID WANRADIO XIRCOM GEM3 503 69 ITC KEYBOARD CHANGE CreateEvent 100 ITC NVPARM 80211 INSTALLED 70 ITC NVPARM 80211 RADIOTYPE 70 ITC NVPARM ANTENNA DIVERSITY 69 ITC NVPARM BLUETOOTH INSTALLED 70 ITC NVPARM CONTRAST 69 ITC NVPARM DISPLAY TYPE 68 ITC NVPARM FCN 69 ITC NVPARM EDBG SUBNET 69 ITC NVPARM EDG IP 68 ITC NVPARM ETHERNET ID 68 ITC NVPARM INTERMEC DATACOLLEC TION HW 69 ITC NVPARM INTERMEC DATACOLLEC TION SW 69 ITC NVPARM INTERMEC SOFTWARE C ONTENT 69 ITC NVPARM LAN9000 INSTALLED 70 133 Index ITC_NVPARM_MANF_DATE 68 ITC_NVPARM_MCODE 69 ITC_NVPARM_RTC_RESTORE 69
82. ar code label to The 751G may have decoded the bar code label in a symbology other than the enter data for your application The label s actual symbology Try scanning the bar code label again Make sure you scan data decoded by the scan module the entire label does not match the data encoded in the bar code label Cleaning the Scanner A Caution To keep the 751G in good working order you may need to clean the EA11 scanner window Clean the scanner window as often as needed for the environment in which you are using the 751G To clean the 751G use a solution of ammonia and water There are no user serviceable parts inside the 751G Opening the unit will void the warranty and may cause damage to the internal components Press the power switch to turn off the 751G Dip a clean cloth towel in the ammonia solution and wring out the excess Wipe off the scanner window wipe dry Do not allow abrasive material to touch this surface EA11 Scanner 751G with EA11 Scanner Note that this is the top of the unit 751G Color Mobile Computer User s Manual 109 Chapter 4 Maintaining the Computer 110 751G Color Mobile Computer User s Manual 5 Network Support The 751G Color Mobile Computer automatically installs the appropriate software for radio use when the unit is powered on It provides wireless connectivity via the Wireless Local Area Network WLAN using an 802 11b g radio option that provides up to 11 Mb sec through
83. arks Call this function before you call any other function found within this API It hunts out and connects to the 802 11b g radio available on the system Check extended error codes if it returns anything for information Definitions ifdef DYNAMIC LOADING typedef UINT PFN RadioConnect else UINT RadioConnect endif 751G Color Mobile Computer User s Manual Chapter 3 Configuring the Computer RadioDisconnect Call this function when done using the 802 11 API to clean up a connection from a previous RadioConnect call If you do not call this function you may leave memory allocated Syntax UINT RadioDisconnect Parameters None Return Values ERROR SUCCESS when successful otherwise ERR CONNECT FAILED Remarks None Definitions ifdef DYNAMIC LOADING typedef UINT PFN RadioDisconnect else UINT RadioDisconnect endif RadioDisassociate Call this function to have the 802 11b g radio disassociate from the current service set The radio then enters an off mode until it is woken again by setting the Service Set Identifier SSID Also the NDIS driver generates an NDIS media disconnect event Syntax UINT RadioDisassociate Parameters None Return Values ERROR SUCCESS when successful otherwise ERR CONNECT FAILED Remarks None Definitions ifdef DYNAMIC LOADING typedef UINT PFN RadioDisassociate else UINT RadioDisassociate endif Query Information Functions
84. art menu For more information on using Windows Explorer see Finding and Organizing Information on page 26 Using Microsoft ActiveSync on the PC Use the Explore in Microsoft ActiveSync to explore your 751G files and locate the program Right click the program and then click Create Shortcut Move the shortcut to the My Computer WindowsStart Menu folder The shortcut now appears on the Start menu For more information see ActiveSync Help Removing Programs ty Tap Start gt Settings gt Control Panel then double tap the Remove Programs icon Remove Poa If the program does not appear in the list of installed programs use Windows Explorer on your 751G to locate the program tap and hold the program and then tap Delete on the pop up menu 751G Color Mobile Computer User s Manual 29 Chapter 2 Windows CE NET Microsoft ActiveSync Gy Tap Start gt Settings gt Control Panel then double tap the PC e Connection icon Tap Change Connection then select the baud rate PC from the drop down list Connection Change Connection E OK Connect to desktop computer using Default USB v Warning Changing the connection may disable communications with your desktop computer Visit the following Microsoft web site for the latest in updates technical information and samples msdn microsoft com embedded downloads ce default aspx With Microsoft ActiveSync you can back up and restore your 751G data
85. bles or disables WEP encryption on the radio TRUE FALSE Syntax UINT EnableWep BOOL Parameters Set BOOL to TRUE to enable WEP encryption or FALSE to disable WEP encryption Return Values ERROR SUCCESS when successful ERR QUERY FAILED when the query failed or ERR CONNECT FAILED if a connection with the radio failed Remarks Call this function with TRUE as the parameter to enable WEP encryption Call this function with the FALSE pun to disable WEP encryption This is an alias for EncryptionStatus See the following EnableWEP TRUE EncryptionStatus NDIS ENCRYPTION 1 ENABLED EnableWEP FALSE EncryptionStatus NDIS_ One re eee Definitions ifdef DYNAMIC_LOADING typedef UINT PFN_EnableWep BOOL else UINT EnableWep BOOL endif 751G Color Mobile Computer User s Manual 87 Chapter 3 Configuring the Computer Syntax Parameters EncryptionStatus Call this function to set the desired encryption status UINT EncryptionStatus UINT mode NDIS ENCRYPTION 1 ENABLED WEP is enabled TKIP and AES are not enabled and a transmit key may or may not be available same as NDIS RADIO WEP ENABLED NDIS ENCRYPTION DISABLED Indicates that AES TKIP and WEP are disabled and a transmit key is available Same as NDIS RADIO WEP DISABLED NDIS ENCRYPTION NOT SUPPORTED Indicates that encryption WEP TKIP and AES is not supported Same as NDIS RADIO W
86. bundle of software that contains the Data Collection Engine DCE SmartSystems Funk Supplicant Intermec Settings and Intermec Developer Library IDL runtime The SSPB is stored in the Flash File Store folder off the root of your 751G and automatically installed on the device when it is initially started up Updated bundles are available as software downloads from the Intermec web site at www intermec com SmartSystems Click Downloads on the left to access the latest Intermec Resource Kits www intermec com IDL Storage Media ibd A Warning Resource Kits provide tools that build applications using the features of Intermec devices Resource kits include Bluetooth Communications Data Collection Device Settings Mobile Gadgets Printing and RFID This is for anyone who develops software for the 751G Note MultiMediaCards MMCs and CompactFlash CF storage cards are not supported in 751G Note The 751G currently supports Delkin Devices Secure Digital cards only Intermec Technologies cannot guarantee that other SD cards will work with the 751G The 751G supports the Secure Digital storage card Use the following procedures to insert a Secure Digital card access the files on a Secure Digital card and remove a Secure Digital card Warning Before installing a Secure Digital card inspect the gasket on the door for any damage or wear and replace the door if any damage or wear is found Otherwise use of thi
87. c W E X F Y LOG W Z 96 Passes an ID to use in a call to SignalStarted This argument is useful only during system startup that relies on a SignalStarted to call W is an integer value E Passes a signal event name to use when autoexec completes X is a string value F Overrides data file to use Must be a fully qualified name Default is autoexec dat in same location as AutoExec exe program Y is string value LOG Set to any value logs activity to AutoExec txt in the same location as the AutoExec exe program Default is disabled W Pauses the autoexec process by calling sleep for the number of seconds specified by Z Z is an integer value Process return code uses standard error codes defined in WinError h Keywords that AutoExec supports are QUIET Enables user notification when an error occurs LOGGING Enables logging to a trace file SIGNAL Enables the specified named event and is immediately signaled Useful for notifying other components of the current status CALL Processes another dat file When called file is complete file is resumed RUN Runs a program with a SW_SHOWNORMAL attribute Autoexec does not wait for the child process to exit LOAD Runs a program with a SW HIDE attribute Autoexec waits for 60 seconds for the child process to exit or EXECWAIT seconds if set EXEC Runs the specified program AutoExec waits 60 seconds for the child process to exit or EXECWAIT seconds if
88. d to an unsupported device 751G Color Mobile Computer User s Manual Chapter 3 Configuring the Computer Example CEDevice UnsupportedPlatforms CEDevice SH3 UnsupportedPlatforms pltfrml is still unsupported pltfrml pltfrml is unsupported VersionMin minor version Numeric value returned by OSVERSIONINFO dwVersionMinor The cab file is valid for the currently connected device if the version of this device is greater than or equal to VersionMin VersionMax major version Numeric value returned by OSVERSIONINFO dwVersionMajor The cab file is valid for the currently connected device if the version of this device is less than or equal to VersionMax BuildMin build_number Numeric value returned by OSVERSIONINFO dwBuildNumber The cab file is valid for the currently connected device if the version of this device is greater than or equal to BuildMin BuildMax uild number Numeric value returned by OSVERSIONINFO dwBuildNumber The cab file is valid for the currently connected device if the version of this device is less than or equal to BuildMax Example The following code example shows three CEDevice sections one that gives basic information for any CPU and two that are specific to the SH3 and the MIPS microprocessors CEDevice A template for all platforms UnsupportedPlatforms pltfrml Does not support pltfrml The following specifies version 1 0 devices only VersionMin 1 0 VersionMax 1
89. de 2 of 5 EAN UCC Composite PDF417 Telepen Code 11 Interleaved 2 of 5 Plessey UPC EAN Code 39 Matrix 2 of 5 QR Code 751G Color Mobile Computer User s Manual Chapter 3 Configuring the Computer Changing Comm Settings Tap Change Comm Settings to configure the settings for the COM1 port Current settings are restored after a warm boot is performed but are lost after a cold boot is performed When these settings are not changed the OK button is disabled grayed out When changes are made tap OK after it is enabled to accept these changes Baud Rate 1200 2400 4800 9600 19200 38400 57600 115200 Data Bits 7 or 8 Parity None Odd Even Mark Space Stop Bits lor2 Flow Control None or Hardware Improving the Performance of the Area Imager If you have problems scanning a bar code with the 2D imager try doing these tips to improve the performance of your imager Tap Start gt Settings gt Control Panel then double tap the Intermec e Settings icon to access the applet Tap to expand Data Collection gt Intermec Internal Scanner gt Imager Settings gt Predefined Modes then select Settings one of the following Data Collection Ei Internal Scanner Symbologies Symbology Options f Scanner Settings Imager Settings BE Predefined Modes 1D 1D and 2D Standard O 1D and 2D Bright Envi O 1D and 2D Reflective O Custom Sticky aimer LED duration F Dernde Security ari b
90. ding reader or configuration commands they must both be configured to receive the NGCFGRSP transactions and receive all 751G responses To set up the host computer verify host computer to IAS communication To set up the application prepare and write a host application that can communicate with the IAS and send transactions to and receive transactions from the 751G in this format transaction header TMF field commands where transaction is a 96 byte field with message number date time source application ID header destinations application ID transaction ID and other Set the system message SYS MSG flag to E in the transaction header TMF field is a 2 byte field containing one of these values CG Configuration Get request sent from the host application Cg Configuration Get response sent from the 751G to host computer CS Configuration Set request sent from the host application Cs Configuration Set response sent from the 751G to the host computer commands are the reader and configuration commands to set on the 751G or the current value to retrieve from the 751G To save configuration changes in flash memory send the 1 reader command as the last command See the Intermec Computer Command Reference Manual for supported commands 751G Color Mobile Computer User s Manual Chapter 3 Configuring the Computer Using Configuration Parameters A configuration parameter changes the way the 751G operates Use either of these
91. dio 2005 128 MB RAM 196 MB recommended 360 MB hard drive space minimum installation 720 MB for complete CD ROM drive compatible with multimedia desktop specification e VGA or higher resolution monitor Super VGA recommended Microsoft Mouse or compatible pointing device 751G Color Mobile Computer User s Manual Chapter 3 Configuring the Computer Packaging Applications for the Computer You could package an application as a cabinet cab file Recommended For simple applications the application itself may be the file to deliver It could be a directory structure that contains the application supporting files like ActiveX controls DLLs images sound files and data files Consider any of these when choosing a storage location for applications In the 751G are two built in storage options the Object Store and the Persistent Storage Manager PSM The Object Store is RAM that looks like a disk Anything copied here is deleted when a cold boot is performed on the unit The PSM is an area of storage embedded in a section of the system s FLASH memory This storage area is ot erased during a cold boot but it may be erased during the reflash You also have the option to store a persistent registry to the PSM region e f the optional Secure Digital storage card is in the system then consider this card the primary location to place applications installation files The SDMMC Disk folder represents the Secure D
92. disk_number subdir RPM EXE 1 c appsoft WCESTART INI 1 RPMCE212 INI 1 TAHOMA TTF 2 751G Color Mobile Computer User s Manual Example Chapter 3 Configuring the Computer Z Note subdir is relative to the location of the inf file SourceDisksFiles Required section begin wav end wav 1 sample hlp 1 1 SourceDisksFiles SH3 sample exe 2 Uses the SourceDisksNames SH3 identification of 2 SourceDisksFiles MIPS sample exe Required file list section Example DestinationDirs 0 SCE1 My Subdir Program Files My Subdir Files Common Files Shared 2 Yes Uses the SourceDisksNames MIPS identification of 2 DestinationDirs This describes the names and paths of the destination directories for the application on the target device Note Windows CE does not support directory identifiers O subdir String that identifies the destination directory The following list shows the string substitutions supported by Windows CE Use these only for the beginning of the path CE1 Program Files CE2 Windows CE3 My Documents CE4 Windows Startup CE5 My Documents CE6 Program Files Accessories CE7 Program Files Communication CE8 Program Files Games CEI Program Files Pocket Outlook CE10 Program Files Office CE11 Windows Start Menu Programs CE12 Windows Start Menu Programs Accessories CE13 Windows Start Menu Program
93. e sees 89 SetChantel s 2 ees sage Ne tette eret e foi een a tete teen ener qud 89 SetNetworkMode 0 ccc cece ee 90 SetPowerMGde erenn ced dade OI DPI ei a cd 90 SetSs Lost anton Rete torso uoti ae aly saa a at yin ater 91 SetC GOXStatusQ d Sedi phe hae Wb er erR 91 SetMixedCellModeQ lese es 91 751G Color Mobile Computer User s Manual Contents Helper Funcions cade este Pau t PEOR S bho eT Ue nee a eee 92 ConticnrePionle 2 viia E acd s dd Rae E EDUC E abd 92 EnableSuppLogpifig 2 obiret sacr entra d eet ee sabia etki nid 92 PnapleZere Cong O ina 3 x apum dopo Van wines Sines Wiens SE eats 93 GetCurrentDriverName 0 0 cee eee eee nee 93 PORC Embed herr er ea ginal Sivas ENO EOR ba BO 93 ISOLINOCO i hoses T oso e bene tese pus E edd 94 isSupplicant unb lad son Sik edu Fre tek nro ee ACE e t ch eue 94 iszetotontieEnabled s 223 resesi or SO EU Ea xd hisce tabe foa 94 RenewDEQGQBQ sca oe En eR ER e eM 95 ResetRadioToSystemSave phe eee vote be ass Pe EN be eee eee 95 StartScamdiist s xu ble ic er aA IUD RE 95 SPARES UD SL SABE sini eio cat gp dessa a ea Ee a boa nnd ann Mesa 96 StOpSUu pp HERES s dba m ue bas be brit La bibe I E se ees 96 SwitchPacketDrivetO oz osa LRL 96 Deprecated EutiGtloDis oe ooh Yoce oe oe ER CHE E E Rad oo a RD Rd 97 Nonfreations vos vxo ve att ita Seach Wale dale iab od eate edat beg he od Pleite 97 NLEDG tDevicelafo ie E e a vete d dota E La ERU 98 NEEDSetDevice
94. e IpInBufSize Must be set to sizeof DWORD IpOutBuf Must point to a buffer large enough to hold the return data of the function If SPI GETPLATFORMTYTE is specified in pInBuf then the PocketPC V0 Unicode string is returned If SPI GETOEMINFO is specified in pInBuf then the Intermec 70010 Unicode string is returned nOutBufSize The size of pOutBufin bytes Must be large enough to hold the string returned IpBytesReturned The actual number of bytes returned by the function for the data requested Return Values Returns TRUE if function succeeds Returns FALSE if the function fails GetLastError may be used to get the extended error value 751G Color Mobile Computer User s Manual 67 Chapter 3 Configuring the Computer IOCTL HAL ITC READ PARM Usage Zinclude oemioctl h Syntax BOOL KernelloControl IOCTL HAL ITC READ PARM LPVOID lpInBuf DWORD nInBufSize LPVOID lpOutBuf DWORD nOutBufSize LPDWORD lpBytesReturned Parameters IpInBuf Points to this structure See JD Field Values below struct PARMS BYTE id BYTE ClassId h nInBufSize Must be set to the size of the PARMS structure IpOutBuf Must point to a buffer large enough to hold the return data of the function If this field is set to NULL and nOutBufSize is set to zero when the function is called the function will return the number bytes required by the buffer nOutBufSize The size of pOutBuf in bytes IpBytesReturned Number of b
95. e amp Sounds Pro 7 ok x volume Sounds Loud Enable sounds for M Events warnings system events V Applications M Notifications alarms reminders bad Jp Volum amp 6 41 aA E Intermec Settings Applet Use the Intermec Settings applet to gather view and update device configuration settings Information about the settings you can configure with the Intermec Settings applet is in the nzermec Computer Command Reference Manual P N 073529 available online at www intermec com See the Data Collection Resource Kit in the Intermec Developer Library IDL for information about data collection functions The IDL is available as a download from the Intermec web site at www intermec com idl Contact your Intermec representative for more information e Tap Start Settings Control Panel then double tap the Intermec Settings icon to access the applet Intermec Ble Ear view Hep Settings Communications Device Settings SmartSystems Information ION Configuration Printers Pl E ntem amp E 6 47 A E 751G Color Mobile Computer User s Manual 9 Chapter 1 Using the Computer Keypad Instructions for the keypad include the backlight and keypress sequences Backlight for Keypad You can configure your keypad to turn on a backlight to assist you when GD you are working in low lighting To adjust the backlight for the keypad tap Backlight Start gt
96. e Computer User s Manual xi Before You Begin Telephone Support These services are available from Intermec Technologies Corporation In the U S A and Canada call 1 800 755 5505 and Service Description choose this option Order Intermec Place an order 1 and then choose 2 products Ask about an existing order Order Intermec media Order printer labels and ribbons 1 and then choose 1 Order spare parts Order spare parts 1 or 2 and then choose 4 Technical Support Talk to technical support about 2 and then choose 2 your Intermec product Service Geta return authorization 2 and then choose 1 number for authorized service center repair e Request an on site repair technician Service contracts e Ask about an existing 1 or 2 and then choose 3 contract Renew a contract Inquire about repair billing or other service invoicing questions You can find information on Intermec telephone support services at www intermec com ait To find the correct telephone number for your country click Contact Who Should Read This Document Related Documents Xii The 751G Color Mobile Computer User s Manual is written for the person who is responsible for installing configuring maintaining and troubleshooting the product Before you install and configure your product you should be familiar with your network and general networking terms such as IP address This table contains a list of related Intermec documen
97. e IEEE 802 11i encryption standard for wireless LANs which provides per packet key mixing a message integrity check and a re keying mechanism thus overcoming most of the weak points of WEP This encryption is more difficult to crack than the standard WEP Weak points of WEP include No Initiation Vector IV reuse protection weak keys no protection against message replay no detection of message tampering and no key updates With preconfigured WEP both the client 751G and access point are assigned the same key which can encrypt all data between the two devices WEP keys also authenticate the 751G to the access point unless the 751G can prove it knows the WEP key it is not allowed onto the network WEP keys are only needed if they are expected by your clients There are two types available 64 bit 5 character strings 12345 default and 128 bit 13 character strings 1234567890123 Enter these as either ASCII 12345 or Hex 0x3132333435 Key Management Protocols WPA Wi Fi Protected Access WPA2 Wi Fi Protected Access This is an enhanced version of WEP that does not rely on a static shared key It encompasses a number of security enhancements over WEP including improved data encryption via TKIP and 802 11b g authentication with EAP WiFi Alliance security standard is designed to work with existing 802 11 products and to offer forward compatibility with 802 11i Second generation of WPA security Like WPA WPA2 provides
98. e a connection Microsoft ActiveSync File View Tools Help Sync Details Explore Options Connected Synchronized Information Type Status Click Explore to access the Mobile Device folder on your unit From your PC select Start gt Windows Explorer then browse the C Intermec 751G Mgmt Tools CabFiles path for any CAB files needed for your 751G Right click the file then select Copy In the Mobile Device folder go to the folder where you want the files located on the 751G do a right click for a pop up menu select Paste When the files are pasted perform a warm boot on the 751G then wait for the LED on the top left of your keypad to stop blinking Tap Start gt Programs gt Windows Explorer to locate the newly copied executable files then tap these files to activate their utilities Use the following steps to install an application using a storage card 1 Suspend the 751G and remove its Secure Digital storage card 2 Using a Secure Digital adapter place the Secure Digital storage card in your PC card drive then create a subdirectory on the Secure Digital drive in which to store your application Copy your application data files and all required DLLs and drivers to the subdirectory created on the Secure Digital storage card 4 Add your application to the AutoUser dat file on the SDMMC Disk 2577 directory with the following statement RUN your directory gt lt yourapp
99. e assigned to each physical key see the table starting on the next page The Scan Code is used at the lowest level of the system to let the keypad driver know which physical key was pressed The keypad driver takes that scan code and looks it up in a table a copy of the one stored in the registry to determine which values to pass on to the operating system Each registry key is just an array that describes to the keypad driver what value needs to be passed for each physical key The key values are indexed by the scan code this is a zero based index For example in the unshifted plane the 4 key has a scan code of 0x06 This means that the seventh word under the Vkey registry key has the value for the 4 key Taking a sample of the Vkey registry key shows the following values 00 00 0B 05 02 03 C1 07 04 03 BE 00 34 00 00 00 The value is 34 00 The values are in reverse byte order because that is the way the processor handles data When writing an application nothing needs to be done to swap the bytes as this happens automatically when the data is read into a byte value This is something to be aware of when looking at the registry Knowing this we can see that the value that the keypad driver passes to the system is a hex 34 Looking that up on an UNICODE character chart we see that it maps to a 4 If you wanted the key labeled 4 to output the letter A instead you would need to change the seventh word
100. e calling this function for this function to work properly Syntax UINT GetSSID TCHAR Parameters Pointer to a character array which is populated with the current SSID when successful Return Values ERROR_SUCCESS when successful ERR_QUERY_FAILED when the query failed or ERR CONNECT FAILED if a connection with the radio failed Remarks If ERROR SUCCESS is returned your TCHAR array is populated with the desired SSID Definitions ifdef DYNAMIC LOADING typedef UINT PFN GetSSID ICHAR else UINT GetSSID TCHAR endif 751G Color Mobile Computer User s Manual 83 Chapter 3 Configuring the Computer Syntax Parameters Return Values Remarks Definitions 84 GetPowerMode Call this function to get the current power savings mode of the radio Note Do not use Automatic Switching mode at this time UINT GetPowerMode ULONG amp NDIS RADIO POWER MODE CAM Continuous Access Mode ie always on NDIS RADIO POWER MODE PSP Power Saving Mode NDIS RADIO POWER UNKNOWN Unknown power mode NDIS RADIO POWER AUTO Auto NDIS RADIO POWER MODE FAST PSP Fast PSP good savings fast ERROR SUCCESS when successful ERR QUERY FAILED when the query failed or ERR CONNECT FAILED ifa connection with the radio failed If ERROR SUCCESS is returned the ULONG reference is populated with a parameter listed above ifdef DYNAMIC LOADING typedef UINT PFN GetPowerMode ULONG amp else UINT Ge
101. e ifthe main battery remains in the mobile computer The configuration and time are lost if The battery discharges beyond this level The battery is removed when the computer is not in suspend mode A cold boot reset is performed on the computer Installing and Charging the Battery Make sure you fully charge the battery before you use your 751G To charge the battery you need to install it in the 751G 1 Remove the two thumb screws on the connector cover to release the hand strap and back cover 2 Slide the bottom of the strap forward to release it from the retaining slot je 1 WEN L1 gt T ALI Retaining slot i Thumb screws 3 Tilt insert and place the battery into the compartment Make sure the battery compartment latch clicks in place to ensure the battery is secure _ Battery compartment latch Battery compartment P d AZ Battery pack 4 Insert your 751G into its single dock for charging 751G Color Mobile Computer User s Manual Chapter 1 Using the Computer gt Caution 5 Charge the battery pack for three hours before using However to ensure proper charging perform the remaining steps first with the AC adapter or dock connected a The first time you turn on your 751G it boots to the operating system After a few seconds you see the Windows CE NET Desktop screen Tap your stylus to advance to the next display on the screen b You will be prompted throu
102. ea imager to scan and enter bar code data The 751G supports reading 1D and 2D images These bar code symbologies are enabled by default on the 751G Code 39 Code 128 UPC A UPC E EAN 8 EAN 13 and Datamatrix If you are using bar code labels that are encoded in a different symbology you need to enable the symbology on the computer Use the Intermec Settings applet to enable and disable symbologies See the Intermec Computer Command Reference Manual available from the Intermec web site at www intermec com Scanning with the Area Imager The 751G has an area imager on the top of the unit that can scan 1D and 2D bar code symbologies It also supports omni directional 360 scanning where you can position the unit in any orientation to scan a bar code label Using the 2D imager is like taking a digital picture ram am JA fF 9 eO PN 751G Color Mobile Computer User s Manual 13 Chapter 1 Using the Computer To use the area imager 1 Press the power switch to turn on the 751G point the scanner window a few inches from the bar code label and hold steady 2 Press either Scan button and center the red aiming beam over the bar code label The aiming beam is smaller when the imager is closer to the bar code and larger when it is further away 3 When a bar code label is successfully read and a high beep is emitted release the Scan button you pressed Improving the Performance of the Area Imager If you have probl
103. ection a Bl oy 31 ey a Con 4S gt 10 17 pm A E 2 Enter a name for the connection such as VPN Connection Select Virtual Private Network PPTP then tap Next to continue Make New Connection Ix Type a name for the connection Fa ven Connection Select the connection type Dial Up Connection Q Direct Connection i Virtual Privat PPP over Ethernet PPPoE 116 751G Color Mobile Computer User s Manual Chapter 5 Network Support 3 Enter the Host name or IP address field Connection x 31 VPN Connection Host name or IP address Configure TCP IP Settings Security Settings ae 79m 4 You should not need to change any TCP IP settings Instances where you are to change TCP IP settings include the following To change these settings tap TCP IP Settings on the Connection page Otherwise tap Finish The server to which you are connecting does not use dynamically assigned addresses and you need to enter your TCP IP settings You need to change server DNS or WINS settings TCP IP Settings General l Name Servers zu VPN Connection C use Slip E Use software compression J Use IP header compression 31 5 Insert the necessary equipment into the device and double tap the new E VPN Connection icon to connect to the host VPN 6 Usea desired program to automatically begin connecting For example
104. ed to cause a warm reset after cab extraction will need to create the resetmeplease txt file in the Windows directory The preferred method to create this file is within the DllMain portion of the Setup dll file It looks like this include lt windows h gt include lt Tlhelp32 h gt include lt winioctl h gt include lt ce_setup h gt in the public SDK dir define IOCTL_TERMINAL_RESET CTL_CODE FILE_DEVICE_UNKNOWN FILE_ANY_ACCESS 2050 METHOD_NEITHER BOOL APIENTRY D11Main HANDL return TRUE DllMain Ld h DWORD reason LPVOID lpReserved J EEKE KK kk kkk kkk k kkk k kk k k k k k k k k k k k k k k k k k k kCk ck kCk Ck kCk CK Ck kc k Ck kCk ck kck ck kck ck kck ck kckck ck ck ck kk SDOCBEGINS BOOL IsProcessRunning TCHAR pname 62 751G Color Mobile Computer User s Manual Chapter 3 Configuring the Computer Description Get process table snapshot look for pname running Arguments pname pointer to name of program to look for for example app exe Returns TRUE process is running FALSE process is not running SDOCENDS J BRK KKK KK KCkCk KCkCk kCKCKCkCKCkCkC KI k k k KCKCK k k k k k k k k k k k k Ck kCk ck kok ck kck ck kck I ck k k BOOL IsProcessRunning TCHAR pname HANDLE hProcList PROCESSENTRY32 peProcess DWORD thDeviceProcessID
105. ef UINT PFN GetBSSID TCHAR else UINT GetBSSID TCHAR fendif 751G Color Mobile Computer User s Manual Chapter 3 Configuring the Computer GetDiversity Call this function to get the current diversity setting of your 802 11b g radio This function uses an optional NDIS5 1 OID to query the radio which a large number of 802 11b g devices do not support This function may be inaccurate Syntax UINT GetDiversity USHORT Parameters ANT PRIMARY The primary antenna is selected ANT SECONDARY The secondary antenna is selected ANT DIVERSITY The radio is in diversity mode and uses both antennas Return Values ERROR SUCCESS when successful ERR QUERY FAILED when the query failed or ERR CONNECT FAILED if a connection with the radio failed Remarks If ERROR SUCCESS is returned your USHORT reference is populated with one of the parameters listed above Definitions ifdef DYNAMIC LOADING typedef UINT PFN GetDiversity USHORT else UINT GetDiversity USHORT endif GetLinkSpeed Call this function to get the current link speed of the 802 11b g radio Syntax UINT GetLinkSpeed int amp Parameters This function accepts an int reference and your int is Ee ulated with the current link speed in Mbps rounded to the nearest whole integer for example 1 2 5 11 etc Return Values ERROR SUCCESS when successful ERR QUERY FAILED when the query failed or ERR CONNECT FAILED ifa connection wi
106. ems scanning a bar code with the 2D imager go to Improving the Performance of the Area Imager on page 41 for tips on improving its performance Software Build Version The Persistent Storage Manager PSM is an area of storage which is embedded in a section of the system s FLASH memory This storage area is not erased during a cold boot It may however be erased during the reflashing process In addition to storing applications and data files you do have the option to store a persistent registry to the PSM region To check to see if your 751G has the latest PSM build or the latest CE build double tap the Internet Explorer icon from the desktop then scroll eve down for the latest information displayed beneath the 751G Version 2 23 Information title Eile Edit View Favorites Ll ay z51 ea E 10 03 rm AS 14 751G Color Mobile Computer User s Manual Software Tools Chapter 1 Using the Computer The following Intermec software tools are available as free downloads SmartSystems Foundation Console www intermec com SmartSystems This tool includes a management console that provides a default method to configure and manage Intermec devices out of the box without the purchase of additional software licenses This is for anyone who must configure and deploy multiple devices or manage multiple licenses SmartSystems Platform Bundles SSPB The SmartSystems Platform Bundle SSPB is a
107. en release the Power key to turn off the 751G Remove the storage media access door 2 Gently depress the Secure Digital card to release the card then pull the card from its slot 3 Replace the storage media access door 4 Press the Power key for two to three seconds and then release the Power key to turn on the 751G Wireless Network Support Radios are installed at the factory and cannot be installed by a user The 751G must be serviced to install or replace radios Contact your Intermec representative for more information See Chapter 5 Network Support for information about supported radios void the user s authority to operate the equipment Z Note Changes or modifications not expressly approved by Intermec could 751G Color Mobile Computer User s Manual 17 Chapter 1 Using the Computer Accessories The following accessories are available for the 751G Note that this is not a complete list Contact your Intermec representative for information about these and other accessories that are not in this list Communications and charging dock Single bay communications cradle with serial USB O interface USB through multipurpose connector at base of unit or RS232 serial adapters Serial USB cables Snap on module for button memory CAC Common Access Card adapter Plug in interface CAC reader 4 slot battery charger Pistol grip scanning handle Holster Dust cover Physical and Environmental Specifications
108. enterprise and home Wi Fi users with a high level of assurance that their data remains protected and that only authorized users can access their wireless networks WPA2 is based on the final IEEE 802 11i amendment to the 802 11 standard ratified in June 2004 WPA2 uses the Advanced Encryption Standard AES for data encryption and is eligible for FIPS Federal Information Processing Standards 140 2 compliance Authentication EAP Extensible Authentication Protocol EAP FAST Flexible Authentication via Secure Tunneling LEAP Lightweight Extensible Authentication Protocol EAP PEAP Protected Extensible Authentication Protocol 751G Color Mobile Computer User s Manual 802 11b g uses this protocol to perform authentication This is not necessarily an authentication mechanism but is a common framework for transporting actual authentication protocols Intermec provides a number of EAP protocols for you to choose the best for your network A pL accessible IEEE 802 1X EAP type developed by Cisco Systems It is available as an IETF informational draft An 802 1X EAP type that does not require digital certificates supports a variety of user and password database types supports password expiration and change and is flexible easy to deploy and easy to manage Also known as Cisco Wireless EAP provides username password based authentication between a wireless client and a RADIUS server In the 802 1x framework traffic cannot
109. eret tie aah pce e CE actu eni doa 16 Attaching a Tab to the Secure Digital Card s ii voa Eo Po a ano tee 16 Accessing Files Stored on the Secure Digital Card 0 0 0000 17 Removing the Secure Digital Card pkec dorem ee ee ERVEERRRNEPEREGPEERES 17 Wireless Network SUpport jars losa et aret ee as Ua EUR PR Watters EE E 17 JACCOSSOT ON 4 Del hisein ate Ratu afta dot ril bool editae eroe eese e band 18 Physical and Environmental Specifications 5 152 oe Seve eme eem e le a 18 2 Windows CE NEV oer poe piore gaop ire pipe E ISP eR aac 21 Software Builds sura E shoe ER IAEA S OUR 4 baa ERU Ea Od ard a AUS 22 Where to Find Information sds ta hd audited nce A cette aha Ural edo Pardo d cs 22 Basie SRA US seen aac bee ac thon acd acce abest Ede buc e db beta dU doa fati d 22 Des tS PSCC A nos iistucuceyietei Db piel GUM trinh a pe ete hd De boa e laf tana d 23 Programs sss sales wove mas was Rocio ue Vcr uu Vans pU FAC o cete 23 Start Menu and Task Bats 2i via cad Ea tins ae s Rede Da ed 23 DIOOBCSEIONS 2i onte fet Eocateh ORT EUR FERA e eek oca E Reti ned 24 Entering InfotinatiOnodS iow sto Sew eu DESEE eae aha ee epee saa eats 24 Typing With the Onscreen Keyboard sco cut oes See ees 24 Using Transcriber tories teh Siete a gintaantan SA uut dA partae das aint 25 Selecting Typed Text 2 ouis yes anil peer rope kou anata aora orare 25 Finding and Organizing Information oie ov LE ERES RE ARONA ROG HUP 26 Customizing Your Com
110. ernet Using the 802 11b g infrastructure mode the 751G establishes a wireless connection to an access point linking you to the rest of the network e Ad hoc networks are private networks shared between two or more clients even with no access point Each wireless network is assigned a name or Service Set Identifier SSID to allow multiple networks to exist in the same area without infringement Intermec recommends using security measures with wireless networks to prevent unauthorized access to your network and to ensure your privacy of transmitted data Authentication cryptographically protected by both the network and the user transmitted data and encryption are required elements for secure networks Schemes are available to implement the features 751G Color Mobile Computer User s Manual Encryption AES Advanced Encryption Standard CKIP Cisco Key Integrity Protocol TKIP Temporal Key Integrity Protocol WEP Wired Equivalent Privacy encryption Chapter 5 Network Support A block cipher a type of symmetric key cipher that uses groups of bits of a fixed length called blocks A symmetric key cipher is a cipher using the same key for both encryption and decryption As implemented for wireless this is also known as CCMP which implements AES as TKIP and WEP are implementations of RC4 This is Cisco s version of the TKIP protocol compatible with Cisco Aironet products This protocol is part of th
111. es on your 751G Entering Information 24 You can enter information on your 751G in several ways depending on the type of device you have and the program you are using Typing Enter typed text into the 751G You can do this by tapping keys on the onscreen keyboard or by using handwriting recognition software Writing Using the stylus write directly on the screen Drawing Using the stylus draw directly on the screen Use the input panel to enter information in any program on your 751G You can either type using the onscreen keyboard or write using Transcriber The characters appear as typed text on the screen To show the input panel tap the Input Panel icon then tap Keyboard To hide the input panel tap the Keyboard icon then tap Hide Input Panel Tap to display the soft keyboard Panel amp Ky 12 16 ane Typing With the Onscreen Keyboard Tap the stylus input icon then tap Keyboard On the soft keyboard that is displayed tap the keys with your stylus Input Panel icon To type lowercase letters tap the keys with the stylus e To type a single uppercase letter or symbol tap the Shift key To tap multiple uppercase letters or symbols tap the CAP key Note that the CAP key only appears if the keyboard is set to small keys To convert to uppercase tap and hold the stylus on a letter and drag up e To add a space drag the stylus to the right across at least two keys To backspace drag the stylus to the le
112. es or longer it can no longer send or receive messages over the network The No Network Connection icon appears on the toolbar The 751G is not communicating with the access point The 751G is connected to the Intermec Application Server or host computer and you move to a new site to collect data The Network Connection icon was visible but is now replaced with the No Network Connection icon The Network Connection icon is in the toolbar but you cannot establish a terminal emulation session with the host computer The Network Connection icon is in the toolbar but the host computer is not receiving any data from the 751G 751G Color Mobile Computer User s Manual Solution Host may have deactivated or lost current terminal emulation session In a TCP IP direct connect network turn off the KeepAlive message from host to maintain the TCP session while a 751G is suspended The 751G is not connected to access point Ensure access point is turned on and operating Move closer to access point to reestablish communications Ensure the 751G is configured correctly for network 751G radio parameters must match all access point values If you have an 802 11b g radio and its radio initialization process failed reset the 751G see Resetting Your Computer on page 13 If No Network Connection icon still appears you may have a defective radio card For help contact your local Intermec representative Move closer to an
113. fatermec Val User s Manual bem 751G Color Mobile Computer Intermec Technologies Corporation Worldwide Headquarters Cedar Rapids Technical Communications 6001 36th Ave W 550 Second Street SE Everett WA 98203 Cedar Rapids IA 52401 U S A U S A www intermec com The information contained herein is provided solely for the purpose of allowing customers to operate and ser vice Intermec manufactured equipment and is not to be released reproduced or used for any other purpose without written permission of Intermec Technologies Corporation Information and specifications contained in this document are subject to change without prior notice and do not represent a commitment on the part of Intermec Technologies Corporation 2004 2006 by Intermec Technologies Corporation All rights reserved The word Intermec the Intermec logo Norand ArciTech Beverage Routebook CrossBar dcBrowser Duratherm EasyADC EasyCoder EasySet Fingerprint i gistics INCA under license Intellitag Intellitag Gen2 JANUS LabelShop MobileLAN Picolink Ready to Work RoutePower Sabre ScanPlus ShopScan Smart Mobile Computing TE 2000 Trakker Antares and Vista Powered are either trademarks or registered trademarks of Intermec Technologies Corporation There are U S and foreign patents as well as U S and foreign patent applications pending CERTIFIED Wi Fi is a registered certification mark of the Wi Fi Alliance Microsoft Windo
114. file to a destination rather than copies the file Default value is disabled D is an integer value D 1 indicates enabled 0 is disabled Q Indicates if a message box should appear when an error occurs Default is disabled Y is an integer value S Indicates a source file name and must be fully qualified Z is a string value Process return code uses standard error codes defined in WINERROR H Example use AutoCopy to copy the control panel from flash file store to windows autocopy exe S Flash File Store System Audio cpl D Windows Audio cpl use AutoCopy to move the control panel from flash file store to windows autocopy exe M1 S Flash File Store System Audio cpl D NWindowsNAudio cpl AutoReg The AutoReg AutoReg exe component adds registry information to the Windows Mobile registry It has no user interface and is configured through command line arguments Usage AutoReg D HKey Q filename D Deletes registry file after a good load allows systems with implemented hives H Saves registry path and all child entries to the specific REG registry file Q Indicates whether a message box should appear when a fatal error occurs filename Fully qualified file name to read from or write to encased in double quotes to support spaces in paths or file names See examples below Process return code uses standard error codes defined in WinError h Example use AutoReg to install this
115. ft across at least two keys To insert a carriage return tap and hold the stylus anywhere on the keyboard and drag down 1 2 3 4 5 6 7 8 9 0 Tab q wjejr it v uj ij O D Shift z x c v b n m Eti Bau AT Ite IS 751G Color Mobile Computer User s Manual Chapter 2 Windows CE NET If you want to use larger keys tap Start gt Settings gt Control Panel then double tap the Input Panel icon Tap Options then select Large keys Tap Input Panel OK then OK again to close the Input Panel properties Small keys J Use gestures for Space Backspace Shitt and Enter 1 PR Space amp ee Backspace F Ly Enter Using Transcriber With Transcriber you can write on the screen with the stylus just as you would on paper You can write a sentence or more of information then pause and let Transcriber change written characters to typed characters For specific instructions on using Transcriber double tap the Transcriber shortcut on the desktop screen then tap Help Tap OK to close the UTE Transcriber Intro box Transcriber Intro Transcriber reliably recognizes words and phrases written in WE prin and mixed print and cursive styles numbers 44 and arbitrary combinations of symbols Write anywhere on the screen Don t write too small Try notto rest your palm on the screen Lise these and other gestures ENTER SPACE BACKSPACE QUICK CORRECT e e y TAB
116. gh the several screens to complete the setup process Read the display messages and follow the instructions When you reach the Windows CE NET Desktop screen you have completed the setup You must use only the Intermec power supply approved for use with the 751G Using any other power supply will damage the 751G Note For help installing and using the single dock see the 700 Series Single Dock Quick Start Guide PIN 962 040 009 shipped with the dock Removing the Battery Follow these instructions to remove the battery from the 751G Only use the battery compartment latch to dislodge and remove the battery Using any other tool or method to remove the battery may damage the battery or the 751G Removing the main battery when the backup battery low or critically low icon appears on the status bar may cause your 751G to cold boot and you may lose data If you fail to replace the battery immediately you may lose important data or applications To remove the battery Pull up on the battery compartment latch then lift the battery out of the battery compartment j 1 L 7 Battery compartment latch ia a I ao VW j Battery compartment d Y c el anki oA sb fw Battery pack 751G Color Mobile Computer User s Manual Chapter 1 Using the Computer Maximizing Battery Life Set the Backlight Timeout to 10 seconds Verify that Radio Power Management is enabled Fast PSP Enabling radio power
117. ght is still on contact your local Intermec representative 751G Color Mobile Computer User s Manual Chapter 4 Maintaining the Computer Problems While Scanning Bar Codes continued Problem Solution The input device attached to the Set the Scanner Model command to the specific attached input device Check 751G does not work well or read enabled bar code symbologies and enable only the symbologies being used bar code labels very quickly The scanner will not read the bar Aim the scanner beam to cross entire bar code label in one pass Vary the scanning code label angle Check the quality of the bar code label Scan a bar code label that you know will scan Compare the two bar code labels to see if the bar code quality is too low You may need to replace the label that you cannot scan Ensure the bar code symbology is enabled Use the Intermec Settings applet to check the symbologies Expand Data Collection gt Symbologies beneath devices listed scanner virtual wedge to check and enable symbologies then scan the bar code label again Ensure the 751G application is expecting input from a bar code You may need to type this information instead The scanner does not read the bar The scanner window may be dirty Clean the window with a solution of ammonia code labels quickly or the scanning and water Wipe dry Do not allow abrasive material to touch the window beam seems to be faint or obscured You scan a valid b
118. grade The SmartSystems Console will tell you that it is installing the upgrade on your 751G Once the upgrade is done downloading to your 751G your 751G replaces the operating system and then automatically performs a cold boot Progress messages do appear on the 751G screen e The SmartSystems Console will show your 751G as offline note the red stop sign until the 751G reboots and reconnects to the system Troubleshooting Your Computer Before sending the 751G in for service save its data and configuration Intermec is responsible only for the keypad and hardware features to match the original configuration when doing repairs or replacements Problems While Operating the Computer Problem Solution You press the power switch to turn Make sure the backlight is on on the 751G and nothing happens Make sure you have a charged 751G Battery installed correctly For help see Installing and Charging the Battery on page 5 The battery may be discharged Replace the battery with a spare charged battery or charge the battery Perform a warm boot or press the reset button in the battery cavity The Battery status LED is on If the battery status LED is a steady green the battery is more than 9596 charged and unit is on a charger If the battery status LED is blinking red then the battery is low If the battery status LED is a steady red the main battery is on charge The 751G appears to be locked up Press the power switch to turn off the
119. h the radio failed Remarks None Definitions ifdef DYNAMIC LOADING typedef UINT PFN SetCCXStatus ULONG else UINT SetCCXStatus ULONG endif SetMixedCellMode Call this function to set the desired mixed cell mode Syntax UINT SetMixedCellMode ULONG Parameters NDIS_MIXED_CELL_OFF Disable Mixed Cell NDIS_MIXED_CELL_ON Enable Mixed Cell Return Values ERROR_SUCCESS when successful ERR QUERY FAILED when the query failed or ERR CONNECT FAILED if a connection with the radio failed Remarks None Definitions ifdef DYNAMIC LOADING typedef UINT PFN SetMixedCellMode ULONG else UINT SetMixedCellMode ULONG endif 751G Color Mobile Computer User s Manual 91 Chapter 3 Configuring the Computer Helper Functions ConfigureProfile If using the Intermec 802 11b g Profile Management system you can program the API to configure the radio to a specific profile by passing the profile name Syntax UINT ConfigureProfile TCHAR Parameters Pointer to a character array that contains the profile name This should be null terminated Return Values ERROR SUCCESS when successful ERR QUERY FAILED when the query failed or ERR CONNECT FAILED ifa connection with the radio failed Remarks Call this function with a pointer to a null terminated TCHAR array that contains the name of the profile you wish to configure This function reads profile data from the profile manager sets that profile a
120. igital card Use the small non volatile Flash File Store region to hold CAB files that rebuild the system at cold boot or install applications from a CAB file into the Flash File Store so they are ready to run when a cold boot is performed Since the FLASH in the system has a limited number of write cycles do not use the Flash File Store for excessive writing purposes however reading is okay Files copied to any of these locations are safe when a cold boot is performed on a 751G providing the AutoRun system is installed in the appropriate location You can find this system in the 751G Management Tools portion of the Intermec Developers Library CD Copying a cab file to the Flash File Store Persistent Copy CabFiles folder automatically extracts that cab file on every cold boot to ensure that your system is properly set up see Installing Cabinet Files on page 46 Launching Your Application Automatically components only It does not describe the bootstrap loader process It only describes the component installation process provided by Windows It is assumed that you understand the Microsoft Mobile startup procedures and are familiar with how Microsoft components start up Z Note This describes the system component startup for Intermec provided You can configure the various media used in the Windows system with a folder name and can change the media in the registry of the system Many of the startup components rely on f
121. ile Computer User s Manual xiii Before You Begin xiv 751G Color Mobile Computer User s Manual 1 Using the Computer This chapter introduces the 751G Color Mobile Computer developed by Intermec to enhance wireless connectivity needs This chapter contains hardware and software configuration information to assist you in making the most out of your 751G Note Desktop icons and applet icons are shown to the left Any place that Z Start is mentioned tap the following Windows icon in the bottom left corner of your desktop e 751G Color Mobile Computer User s Manual 1 Chapter 1 Using the Computer Ambient Light Sensor The ambient light sensor turns on the display lighting when conditions warrant but automatically turns if off again as surrounding light increases This conserves your 751G battery power Ambient Light Sensor 9 js To adjust the ambient light sensor tap Start gt Settings gt Control Panel A Double tap the Backlight icon then tap the right arrow to move to and tap Backlight the Both Power tab Make your selections then tap OK to exit this applet Extern Power Backlight On All Power Sources Automatic Backlight Control Disabled Turn Off In Normal Light Turn Off In Bright Light Pu J Contr o E 10 12 Au d a 2 751G Color Mobile Computer User s Manual Chapter 1 Using the Computer Audio System The audio system consists of the speaker
122. ile name is specified errors are displayed in message boxes If a file name is used the CAB Wizard runs without the user interface UD this is useful for automated builds cpu type Creates a cab file for each specified microprocessor tag which is a label used in the Win32 SETUP INF file to differentiate between different microprocessor types The cpu parameter followed by multiple cpu type values must be the last qualifier in the command line 751G Color Mobile Computer User s Manual 65 Chapter 3 Configuring the Computer a Example This example creates cab files for the ARM and MIPS microprocessors assuming the Win32 Setup inf file contains the ARM and MIPS tags cabwiz exe c myfile inf err myfile err cpu arm mips Note CabWiz exe MakeCab exe and CabWiz ddf Windows CE files available on the Windows CE Toolkit must be installed in the same directory on the desktop computer Call CabWiz exe using its full path for the CAB Wizard application to run correctly Troubleshooting the CAB Wizard To identify and avoid problems that might occur when using the CAB Wizard follow these guidelines Use 9696 for a percent sign 96 character when using this character in an inf file string as specified in Win32 documentation This will not work under the Strings section Do not use inf or cab files created for Windows CE to install applications on Windows based desktop platforms Ensure the MakeCab exe a
123. ing 1 through 4 3 For Association select Open and press Enter When working with Cisco Aironet access points you can select Network EAP 4 For Encryption select WEP and press Enter 5 For 8021x select PEAP TLS TTLS LEAP or EAP FAST and press Enter If you select TTLS or PEAP a Select User Name type your user name then press Enter b Select User Password type a user password then press Enter For Validate Server Certificate select Yes then press Enter Note that you must have the date on the 751G set correctly when you enable Validate Server Certificate d Enter a User Name and Subject Name You can also enter a Server 1 Common name or Server 2 Common name to increase security If you select TLS a Load a user and root certificate on your 751G page 118 b For Validate Server Certificate select Yes then press Enter Note that you must have the date on the 751G set correctly when you enable Validate Server Certificate You must enter a User Name and Subject Name You can also enter a Server 1 Common name or Server 2 Common name if you want to increase your level of security If you select LEAP or EAP FAST Select User Name then type your user name press Enter select User Password type a user password then press Enter 751G Color Mobile Computer User s Manual Chapter 5 Network Support Using
124. ing tap Pulse dialing If your type is tone dialing as most phone lines are then tap Tone dialing These selections apply to all connections Tap OK to return to the Settings page New Remove Local settings are Area code zs Tone dialing Country Region f Pulse dialing Disable call waiting dial z Dialing patterns ae Local Long Distance International 9 G 9 1FG 9 011 EFG 8 To start the connection use the Internet Explorer to visit web and WAP pages For more information see Internet Explorer on page 33 751G Color Mobile Computer User s Manual 115 Chapter 5 Network Support Connecting to Work If you have access to a network at work you can view intranet pages synchronize your 751G and possibly access the Internet Your network administrator may also give you Virtual Private Network VPN settings A VPN connection helps you to securely connect to servers such as a corporate network via the Internet Ask your network admisnistrator for a user name password domain name TCP IP settings and host name or IP address of the VPN server 2 To view additional information for any screen in the wizard or while changing settings tap the Help icon in the upper right corner a 1 Tap Start gt Settings gt Network and Dial up Connections then double tap the Make New Connection icon Make New emenn 7I Tx Conn
125. internal microphone and the external headset jack Speaker The speaker which is capable of variable volume levels is located on the back of the 751G This speaker has a transducer volume of 85 dB min at 10 cm 3 9 and a frequency range of 1 8 KHz Speaker 1 Warning Do not place the speaker next to your ear when the speaker volume is set to Loud maximum or you may damage your hearing Warning Microphone The built in microphone is located on the bottom of the unit next to the Hirose docking connector Hirose docking connector Microphone This is the bottom of the 751G Note that the keypad is to the bottom in this illustration 751G Color Mobile Computer User s Manual 3 Chapter 1 Using the Computer External Headset Jack The external headset jack connects a mobile phone style headset to the 751G for use in noisy environments The jack is a 2 5 mm three conductor jack with autosensing of the headset jack insertion which disables the internal speaker and microphone The external headset jack is located on the bottom of the 751G next to the Hirose docking connector External headset jack Hirose docking connector The 751G comes with a 14 4 Watt hour 7 2V replaceable Lithium Ion Lilon battery To view the status of this battery from the 751G tap Start gt Settings gt Control Panel Double tap the Power icon then tap the Battery tab Tap OK to exit this applet Power Properties
126. ions ifdef DYNAMIC LOADING typedef UINT PFN GetWepStatus ULONG amp else UINT GetWepStatus ULONG amp endif 751G Color Mobile Computer User s Manual 85 Chapter 3 Configuring the Computer Syntax Parameters Return Values Remarks Definitions 86 GetRadiolpAddress Call this function to obtain a formatted string indicating whether DHCP is enabled and what is the current adapters IP address Syntax UINT GetRadioIpAddress TCHAR Parameters Pointer to a character array that contains the formatted string of the IP address and static DHCP information Return Values ERROR_SUCCESS when successful ERR_QUERY_FAILED when the query failed or ERR CONNECT FAILED if a connection with the radio failed Remarks If ERROR SUCCESS is returned your TCHAR array contains a string formatted as follows IP DHCP Enabled nxxx xxx xxx xxx n or IP DHCP Disabled nxxx xxx xxx xxx n Definitions ifdef DYNAMIC_LOADING typedef UINT PFN GetRadioIpAddress TCHAR else UINT GetRadiolpAddress TCHAR endif GetCCXStatus Call this to get information about the current CCX status of the adapter UINT GetCCXStatus ULONG amp NDIS NETWORK EAP MODE OFF Disable EAP mode NDIS NETWORK EAP MODE ON Enable EAP mode ERROR SUCCESS when successful ERR QUERY FAILED when the query failed or ERR CONNECT FAILED ifa connection with the radio failed If ERROR SUCCESS is returned your ULONG reference
127. iple access points in a network with different SSIDs and the connection fails You receive a message saying The server certificate has expired or your system date is incorrect after you perform a clean boot on the 751G Solution Make sure the 751G IP address host IP address subnet mask default router are configured for network The 751G may not be communicating with access point Make sure the 751G network name matches access point network name SSID 802 1x security network may not be active Ensure the server software is properly loaded and configured on server PC See server software documentation for help The 751G may not be communicating with the intended access point Make sure the 751G network name matches the access point network name Default network name is INTERMEC Access point may not be communicating with server Ensure the access point is turned on properly configured and has 802 1x security enabled User Name and Password parameters on the 751G must match the user name and password on authentication server You may need to reenter the password on both the 751G authentication server On your authentication server the user and group are allowed and the group policy is allowed to log into the server For help see the documentation that shipped with your authentication server software IP address and secret key for access point must match the IP address and secret key on authentication server You
128. lane 0x0B None 0x0C Esc Esc minus sign 0x0D down arrow Down arrow Volume decrease 0x0E 1 1 Caps Send OxOF 7 7 PQRS PgUp 0x10 Alpha Alpha green plane 0x11 None 0x12 up arrow Up arrow Volume increase 0x13 right arrow Right arrow Tab 0x14 2 2 ABC End 0x15 8 8 TUV asterisk 0x16 0 0 Win 0x17 5 5 JKL A3 0x18 None 0x19 Action Action plus symbol OxlA 3 3 DEF backlight Ox1B 9 9 WXYZI PgDn 0x1C Enter Enter at symbol Ox1D 6 6 MNO A4 OxlE 101 Chapter 3 Configuring the Computer Scan Codes continued Press this Key Meaning ScanCode None 0x1 F 0x40 Battery LED Charge Detect 0x41 Left LED LCD frontlight 0x42 LED above Esc Ambient light 0x42 Threshold crossed 0x42 Headset detected 0x43 Keypad Backlight 0x44 LED above Esc Ambient Light 0x44 Threshold Crossed 0x44 Sample View of Registry Keys See the registry on your device for the latest 751G key mappings HKEY LOCAL MACHINE HARDWARE DEVICEMAP KEYBD ResumeMask dword 7 Vkey hex 00 00 08 05 02 03 C1 07 04 03 BE 00 34 00 00 00 25 00 00 00 08 00 03 02 00 00 1B 00 28 00 31 00 37 00 01 02 00 00 26 00 27 00 32 00 38 00 30 00 35 00 00 00 01 03 33 00 39 00 OD 00 36 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 0
129. lash File Store region and deliver Intermec value added functionality such as data collection unit configuration and diagnostics the Intermec wireless security suite and the SmartSystems Foundation You need to download the latest upgrade files from the Intermec web site to your desktop PC Contact your Intermec representative for web browser information then do the following 1 Start your web browser and go to the Intermec web site at the location given by your representative 2 Click the applicable link fill out the appropriate information then click Submit Information Click OK to continue 3 Click the link and download the zip file to your PC 4 Follow the steps in one of the next sections e f using a storage card to upgrade the 751G see below f using the SmartSystems Console to upgrade the 751G see Using the SmartSystems Console to Upgrade the Computer on page 105 Using a Storage Card to Upgrade the Computer 104 a To use a Secure Digital card to upgrade the 751G you need a Secure Digital card reader and a Secure Digital card formatted as FAT Note The 751G currently supports Delkin Secure Digital cards only Intermec cannot guarantee that other Secure Digital cards will work with the 751G 1 Locate the storage card access door at the top of the 751G remove its two screws remove the door then remove the storage card See the Model 751G Mobile Computer Quick Start Guide P N 962 054 093 for mo
130. ledRegKeys WO cFailedRegVals WO cFailedShortcuts HANDLE h TCHAR srcfile MAX_PATH TCHAR dstfile MAX_PATH D D D D if cFailedDirs cFailedFiles cFailedRegKeys cFailedRegVals cFailedShortcuts return codeINSTALL EXIT UNINSTALL f IsProcessRunning L autocab exe CreateFile L NNWindowsNN resetmeplease txt GENERIC READ GENERIC WRITE 0 NULL CREATE ALWAYS ILE ATTRIBUTE HIDDEN NULL i h E if h INVALID HANDLE VALUE CloseHandle h else Couldn t create the file If it failed because the file already exists it is not fatal Otherwise notify user of the inability to reset the device and they will have to perform it manually after all of the installations are complete end if else DWORD dret h CreateFile L SYII1 GENERIC_WRITE GENERIC_READ 0 NULL OPEN_EXISTING FILE ATTRIBUTE NORMAL NULL Force a warm start NOW if h INVALID HANDLE VALUE DeviceloControl h IOCTL TERMINAL RESET NULL 0 NULL 0 amp dret NULL Won t return but we ll show clean up anyway CloseHandle h else Couldn t access SYSIO Notify user end if 64 751G Color Mobile Computer User s Manual Chapter
131. letters or meeting minutes To create a new file tap File gt New then select either a blank document or a template depending on what you have selected in the Tools gt Options dialog box Select an input mode from the View menu You can open only one document at a time when you open a second document you have to save the first Documents you create or edit are usually saved as WordPad WPD but you can also save documents in other formats such as Word DOC or Rich Text Format RTF Windows Explorer contains a list of files stored on your 751G Double tap a file to open it To delete make copies of and rename files tap and hold a file in the list then select the action on the pop up menu File Edit view Go Fav x Tap any of the headers to change the order of the list address Program Files Office Templ lame Size Type Double tap to open a document Letter 8 70KB WordPad Tei Meeting Open p WordPad Tel Press and hold a document to see its pop up menu ne Copy Delete Rename Properties qq in e 2 Progr E y 18 13 PM D E You can change the zoom magnification by tapping View gt Zoom then select the percentage you want Select a higher percentage to enter text and a lower one to see more of your document If you are opening a Word document created on a desktop you may select View gt Wrap to Window so that you can see the entire document To check s
132. lready existing channel Syntax Parameters UINT SetChannel USHORT USHORT value that should populate with the desired channel 1 14 Return Values None Remarks Definitions None ifdef DYNAMIC_LOADING typedef UINT PFN_SetChannel USHORT else UINT SetChannel USHORT endif 751G Color Mobile Computer User s Manual 89 Chapter 3 Configuring the Computer Syntax Parameters Return Values Remarks Definitions Syntax Parameters Return Values Remarks Definitions 90 SetNetworkMode Call this function to set the desired Network Mode UINT SetNetworkMode ULONG NDIS_NET_MODE_IBSS 802 11b g Ad Hoc Mode NDIS NET MODE ESS 802 11b g Infrastructure Mode NDIS NET MODE UNKNOWN Anything Else Unknown Error NDIS NET AUTO UNKNOWN Automatic Selection Using this is not supported or recommended NDIS NET TYPE OFDM 5G 5 Gigahertz 54 Mbps NDIS NET TYPE OFDM 2 4G 802 11b g 2 4 Gigahertz ERROR SUCCESS when successful ERR QUERY FAILED when the query failed or ERR CONNECT FAILED ifa connection with the radio failed None ifdef DYNAMIC LOADING typedef UINT PFN SetNetworkMode ULONG else UINT SetNetworkMode ULONG endif SetPowerMode Call this function to set the desired power mode UINT SetPowerMode ULONG mode NDIS_RADIO_POWER_MODE_CAM Continuous Access Mode ie always on NDIS_RADIO_POWER_MODE_PSP Power Saving Mode NDI
133. mands in AutoUser dat and AutoRun dat Note If you need to add steps at boot time add them to AutoUser dat not Z to AutoRun dat AutoRun dat is provided by Intermec and is subject to change AutoUser dat is the designated place for the end user to add steps to the boot time process EXEC Launches a specified program waits for it to complete up to 10 minutes CALL Processes a specified file of commands and returns CHAIN Processes a specified file of commands and does not return RUN Loads a specified program and executes it LOAD Loads a specified program and executes it AutoRun handles quoted file names for the first parameter to allow specifying path names or file names that contain white space Note only one set of quotes per command is supported AutoRun dat entry examples RUN Flash File Store Apps some exe argl arg2 arg3 CALL Flash File Store 2577 usercmds dat AutoCopy AutoCopy AutoCopy exe copies moves files between locations It has no user interface and is configured through command line arguments It has support for the following parameters in no particular order 50 751G Color Mobile Computer User s Manual Chapter 3 Configuring the Computer Usage AutoCopy D W L X M D O Y S Z D Indicates destination file name and must be fully qualified W is a string value L Indicates qualified file name for logging to enable Default is disabled X string value M Moves
134. may need to reenter the IP address and secret key on both your access point and authentication server Authentication server software is running on server PC The 751G does not save WEP key values when changing the SSID Reenter the WEP key value after changing the SSID select Apply Network Settings from the 802 11 Radio menu You should now be able to connect to the different access points Date and time are not saved when a clean boot is performed Reenter the date and time then select Apply Network Settings from the 802 11 Radio menu Problems While Scanning Bar Codes Problem You cannot see a red beam of light from the scanner when you press the Scan button and aim the scanner at a bar code label When you release the Scan button or handle trigger the Good Read light does not turn off 108 Solution You may be too far away from the bar code label Try moving closer to the bar code label and scan it again For information see Scanning Bar Codes on page 13 You may be scanning the bar code label straight on Change the scanning angle and try again Move within two feet of a wall to test the effective scan of the scanner The Good Read light will remain on if you configure the 751G to use continuous edge triggering If you configure the 751G for level triggering and the Good Read light remains on there may be a problem Press the Scan button or pull the trigger again without scanning a bar code label If the li
135. methods to execute configuration parameters Scan EasySet bar code labels Use the EasySet application from Intermec Technologies Corporation to print configuration labels Scan labels to change imager configuration and data transfer settings See the EasySet online help for information Send Reader Commands through the Network or from an Application See the Intermec Computer Command Reference Manual for information Configuring the Printer The 751G works with a Zebra PT 03 Portable Printer which interfaces through an I O adapter P N 074143 Contact an Intermec representative for information about this printer Methods for printing using Windows CE at this time is as follows Add port drivers to print ASCII directly to the port Use LinePrinter ActiveX Control from the Software Developer s Kit SDK see the SDK User s Manual for more information Directly to a Port Printing directly to the port sends RAW data to the printer The format of this data depends upon your application and the printer capabilities You must understand the printer commands available for your specific printer Generally applications just send raw ASCII text to the printer Since you are sending data to the printer from your application directly to the port you are in complete control of the printers operations This allows you to do line printing print one line at a time rather than the page format printing offered by the GDI approach It is also m
136. mit access to your 751G Power To maximize battery life Adding or Removing Programs Programs added to your 751G at the factory are stored in ROM Read Only Memory You cannot remove this software and you cannot accidentally lose ROM contents All other programs and data files added to your 751G after factory installation are stored in RAM Random Access Memory 751G Color Mobile Computer User s Manual 27 Chapter 2 Windows CE NET System 28 You can install any program created for your 751G as long as your 751G has enough memory The most popular place to find software for your 751G is on the Windows CE NET web site msdn microsoft com embedded downloads ce default aspx Adding Programs Using Microsoft ActiveSync Install applicable software on your PC before installing it on the 751G 1 Determine your 751G and processor type so that you know which version of the software to install Tap Start gt Settings gt Control Panel then double tap the System icon Note the processor information on the General tab beneath the Computer heading System Properties ok General Memory Device Name 4 gt System Microsoft Windows CE NET Version 4 20 Copyright 1996 2003 Microsoft Corp All rights reserved This computer program is protected by U S and international copyright law Computer Processor intel Corporation Memory 60212 KB RAM Expansion cards SAMSUNG WLA v Regis
137. n in the order provided 1 Create an INF file with Windows CE specific modifications below 2 Optional Create a SETUP DLL file to provide custom control of the installation process page 62 3 Use the CAB Wizard to create the cab file using the inf file the optional Setup dll file and the device specific application files as parameters page 65 Creating an inf File An inf file specifies information about an application for the CAB Wizard Below are the sections of an inf file Version This specifies the creator of the file version other relevant information Required Yes Signature signature_name Windows NT Provider INF creator Example RegSettings All CESignature Windows CE Example Version Signature SWindows NTS Provider Intermec CESignature SWindows CES 751G Color Mobile Computer User s Manual 53 Chapter 3 Configuring the Computer Required Processor Type UnsupportedPlatforms 54 CEStrings This specifies string substitutions for the application name and the default installation directory Required Yes AppName app name Name of the application Other instances of AppName in the inf file are replaced with this string value such as RP32 InstallDir default install dir Default installation directory on the device Other instances of 96InstallDir96 in the inf file are replaced with this string value Example
138. nd CabWiz ddf files included with Windows CE are in the same directory as CabWiz exe Use the full path to call CabWiz exe Do notcreate a cab file with the MakeCab exe file included with Windows CE You must use CabWiz exe which uses MakeCab exe to generate the cab files for Windows CE Do not set the read only attribute for cab files Customization and Lockdown 66 Some customers would prefer that their users not have access to all of the operating system features Intermec cannot customize the operating system in any way but a custom application can Delete items from the Start menu and Programs folder These items are just shortcuts in the file system so the application is not really being deleted Cold booting the device will bring these items back so the application will need to be run on every cold boot Use the RegFlushKey API to save a copy of the registry to a storage device See the IDL for more information on how to do this Saving a copy of the registry restores most system settings in a cold boot situation Usethe SHFullScreen API with other APIs to have the application take up the entire display and prevent the Start menu from being available Remap keys and disable keys on the keypad create a custom SIP or Make changes to the registry to configure the device 751G Color Mobile Computer User s Manual Chapter 3 Configuring the Computer Should you want your 751G to display a full
139. ne on keypad 99 OSVERSIONINFO dwBuildNumber 55 OSVERSIONINFO dwVersionMajor 55 OSVERSIONINFO dwVersionMinor 55 P Packaging an application Flash File Store 47 Object Store 47 Persistent Storage Manager 47 Secure Digital storage cards 47 Page format printing 39 Patent information vii Performing a cold boot 13 Physical dimensions specifications 19 Physical specifications 18 pInput NLEDSetDevice 98 PKFUNCS H IOCTL_HAL_GET_DEVICEID 71 IOCTL_PROCESSOR_INFORMATION 76 Planes keypad 99 Pocket PC IOCTL_HAL_GET_BOOTLOADER_VERI NFO 73 IOCTL HAL GET OAL VERINFO 72 Pocket Word synchronizing 32 typing mode 31 writing mode 32 pOutput NLEDGetDevicelnfo 98 Power applet battery status 4 Printer support 39 Printer Zebra PT403 portable 39 Processor information IOCTL_PROCESSOR_INFORMATION 76 Programs adding or removing Windows CE NET 27 PSM determining build version 14 packaging an application 47 Q Query information functions 79 R RadioConnect 78 751G Color Mobile Computer User s Manual Index RadioDisassociate 79 RadioDisconnect 79 Radios card support 17 Reader commands 39 Reading distances 2D area imager 42 EA11 42 Reboot methods IOCTL HAL COLDBOOT 99 IOCTL HAL REBOOT 98 IOCTL HAL WARMBOOT 99 Recharging time 19 Recovery CD RegFlushKey API 66 updating the system software 104 RegFlushKey 66 Registry keypad remapping 100 sample view of key mapping 102 save
140. nformation type for synchronization in ActiveSync When you select Files the My Documents folder for the 751G is created on your desktop Place all files you want to synchronize with the device in this folder Password protected files cannot be synchronized All WordPad files stored in My Documents and its subfolders are synchronized with the desktop ActiveSync converts documents during synchronization For more information on synchronization or file conversion see ActiveSync Help on the desktop 751G Color Mobile Computer User s Manual Chapter 2 Windows CE NET is deleted in the other location when you synchronize Z Note When you delete a file on either your desktop or your 751G the file Internet Explorer Use Microsoft Internet Explorer to view web sites or WAP pages To do this create the connection first via an ISP or network as described in Connecting to an Internet Service Provider on page 113 When connected to an ISP or network you can also download files and programs from the Internet or intranet To switch to Internet Explorer on your 751G double tap the Internet Explorer icon on your desktop or select Start gt Programs gt Internet Ka E 10 03 mm Ae Viewing Mobile Favorites and Channels 1 Tap Favorites from the tool menu to display your list of favorites 2 Tap the page you want to view se Eat view ENE 7 x ETATE Tap to add or delete a folder or favori
141. ng on the equipment A caution alerts you to an operating procedure practice condition or statement that must be strictly observed to prevent equipment damage or destruction or corruption or loss of data Note Notes either provide extra information about a topic or contain special instructions for handling a particular condition or set of circumstances Global Services and Support Warranty Information To understand the warranty for your Intermec product visit the Intermec web site at www intermec com and click Service amp Support The Intermec Global Sales amp Service page appears From the Service amp Support menu move your pointer over Support and then click Warranty Disclaimer of warranties The sample code included in this document is presented for reference only The code does not necessarily represent complete tested programs The code is provided as is with all faults All warranties are expressly disclaimed including the implied warranties of merchantability and fitness for a particular purpose Web Support Visit the Intermec web site at www intermec com to download our current manuals in PDF format To order printed versions of the Intermec manuals contact your local Intermec representative or distributor Visit the Intermec technical knowledge base Knowledge Central at intermec custhelp com to review technical information or to request technical support for your Intermec product 751G Color Mobil
142. ng the application 53 CabWiz ddf 66 CabWiz exe 53 66 Capacitor internal super 4 Card support radios 17 751G Color Mobile Computer User s Manual Secure Digital cards 16 pull tabs 16 Cisco Key Integrity Protocol 119 CKIP Cisco Key Integrity Protocol 119 ClassID field values VN_CLASS_ASIC 69 VN_CLASS_BOOTSTRAP 69 VN_CLASS_KBD 69 Cleaning the scanner window and screen 109 Cold boot IOCTL_HAL_COLDBOOT 74 Cold boot performing 13 COM port configuration 41 wedge settings 41 COMI port 39 Comm port wedge settings 41 Command line syntax AutoCab 46 Communications options 111 CompactFlash card slot 16 Computer shutdown 4 Configuration parameters 39 ConfigureProfile 92 Configuring security 118 Configuring the Computer troubleshooting 107 Connecting to an ISP 113 work 116 Connections ending 117 to an ISP 113 via modem 113 to work 116 via modem to an ISP 113 Conserving battery power 2 Contents in SDMMC Disk folder 17 Control panel applets backlight 10 intemec settings beeper volume 8 power battery status 4 CoreDIl dll 97 CreateEvent 100 Creating a modem connection to an ISP 113 CAB files 53 with CAB Wizard 65 751G Color Mobile Computer User s Manual Index INF files 53 D Deprecated functions 97 Desktop screen Windows CE NET 23 Deviceld h 71 Display specifications 18 DllRegisterServer 56 DllUnregisterServer 56 DRAM low battery shutdown 5 E EA
143. nt files c WinNT Fonts 3 CE Tools c windows ce tools wce400 700ie mfc lib x86 SourceDisksFiles Required section rpm exe 1 C Appsoft program wce400 WCEX86Re1700 wcestart ini 1 rpmce212 ini 1 intermec bmp 1 rpmlogo bmp rpmname bmp import bmp 1 export bmp 1 clock bmp 1 printer bmp 1 filecopy bmp 1 readme txt 1 lang_eng bin 1 rpmdata dbd 1 database wcel tahoma ttf 2 mfcce212 dll 3 olece212 dll 3 olece211 dll 1 c Nwindows ce tools wce400 NMSD61102 11 mfc lib x86 rdm45wce dll 1 c rptools rdm45wce 4_50 lib wce400 wcex86rel picfmt dll 1 c rptools picfmt 1_00 wce400 wcex86rel6110 fmtctrl dll 1 c rptools fmtctr1 1_00 wce400 wcex86rel16110 ugrid dll 1 c rptools ugrid 1_00 wce400 wcex86rel16110 simple dll 1 c rptools pspbm0c 1_00 wce400 wcex86rel psink dll 1 c rptools psink 1_00 wce400 WCEX8 6RelMinDependency pslpwce dll 1 c rptools pslpm0c 1_00 wce400 WCEX8 6Re1lMinDependency npcpport dll 1 c rptools cedk 212_03 installable drivers printer npcp dexcom dll 1 c rptools psdxm0c 1_00 x86 ncsce exe 1 c rptools ncsce 1_04 nrinet dll 1 c rptools ncsce 1_04 DestinationDirs Required section Shortcuts All 0 CE3 Windows Desktop Files App 0 InstallDir Files DataBase 0 InstallDir DataBase Files BitMaps 0 InstallDir Bitmaps Files Fonts 0 InstallDir Fonts
144. nts of the Windows CE RAM based object store page 74 IOCTL HAL WARMBOOT Performs a system warm boot preserving the object store page 73 Note Using IOCTL HAL REBOOT is no longer recommended use Z either IOCTL_HAL_WARMBOOT or IOCTL_HAL_COLDBOOT IOCTL_HAL_REBOOT is still supported for backward compatibility but its use can lead to difficulties Reprogramming the 751G Keypad Note Use caution when remapping the keypad Improper remapping may Z render the keypad unusable Data within the 751G could also be lost should any problems occur Applications have the ability to remap keys on the 751G keypad This allows applications to enable keys that would otherwise not be available such as the F1 function key Also to disable keys that should not be available such as the alpha key because no alpha entry is required Use care when attempting to remap the keypad because improper remapping may render the keypad unusable Cold booting the device loads the default keymap thus correcting this situation Note that remapping the keys in this way affects the key mapping for the entire system not just for the application that does the remapping There are three planes supported for the 751G keypad Keys used in more than one shift plane must be described in each plane e The unshifted plane contains values from the keypad when not pressed with other keys such as pressing 1 to enter a 1 e The orange plane contain
145. older names to locate information files applications or other related data 751G Color Mobile Computer User s Manual 47 Chapter 3 Configuring the Computer RunAutoRun 48 The registry keys used by FolderCopy and other startup components to retrieve the folder names are as follows Flash File Store HKLM Drivers BuiltIn FlshDrv FolderName Flash File Store SD Card Storage Card HKLM System StorageManager Profiles S DMMC Folder Storage Card During normal Windows system startup there are Intermec specific and non Intermec components that require an orderly start to properly function These non Intermec components may also need to start themselves so the Windows device can function properly Since there are possible configurations that come from using one or more optional built in peripheral devices the platform components starting on the next page are required to manage startup System components are installed and configured during the power up process from a single starting point RunAutoRun RunAutoRun exe built into the operating system image and located in the Windows folder checks for AutoExec AutoExec exe in the Flash File Store 2577 folder Folder names used for the mounted volumes are retrieved from the registry to maintain coherence with the naming of the mounted volumes on the platform These folder names are not hard coded AutoExec is reserved for Intermec use
146. ons Use the following information to programmatically control the vibrator to write an application to turn on the vibrator when a message is received via the WLAN radio link and turn it off when the user presses a key Vibrator support is in the NLED driver as a false LED The vibrator is LED 5 and identified with an CycleAdjust of 1 The vibrate option is available in the notifications panel when the vibrator is in the system Regarding an applications interface to Nled dll LEDs must be available for applications to use through the CoreDll dll file To use the LED functions declare these as extern C as follows extern C BOOL WINAPI NLEDGetDeviceInfo UINT nInfoId void pOutput extern C BOOL WINAPI NLEDSetDevice UINT nDeviceId void pInput The LEDs are enumerated for access through the data structures associated with these APIs Notification LED Radio On LED Alpha Lock LED Scanner LED Low Battery Vibrator NA BR rl c 751G Color Mobile Computer User s Manual 97 Chapter 3 Configuring the Computer NLEDGetDevicelnfo Usage include nled h Syntax BOOL NLEDGetDeviceInfo UINT nInfold void pOutput Parameters nInfold Integer specifying the information to return These values are defined NLED_COUNT_INFO pOutput buffer specifies the number of LEDs on the device NLED_SUPPORTS_INFO_ID pOutput buffer specifies information about the capabilities supported by the LED NLED_SETTINGS_INF
147. pelling select text then tap Tools gt Spell Check To use your new document as a template move the document to the Templates folder Using the input panel enter typed text into the document For more information on entering typed text see Entering Information on page 24 To format existing text and to edit text first select the text You can select text as you do in a Word document using your stylus instead of the mouse to drag through the text you want to select You can search a document to find text by tapping Edit gt Find 751G Color Mobile Computer User s Manual 31 Chapter 2 Windows CE NET Writing Mode Ele EA view For e x M Undo Ctr Z Redo Ctrbe Tap to return to the document Cut Ctr X bw C Cte f Pete coy ping Notd the Clear Del Select All Ctr A Find Ctrl F Find Next Ctrl 4 Ctrl H y Uu Tap to hide or show the keypad With Transcriber enabled use your stylus to write directly on the screen The zoom magnification is greater than in typing mode to allow you to write more easily For more information on writing and selecting writing sce Entering Information on page 24 Ele Edit view Fon e x Bring Pl WF Doc4 AW PM DA E Transcriber enabled Synchronizing WordPad Documents 32 WordPad documents can be synchronized with Word documents on your desktop To synchronize files first select the Files i
148. put Note Desktop icons and applet icons are shown to the left Any place that Z Start is mentioned tap the following Windows icon in the bottom left corner of your desktop e 751G Color Mobile Computer User s Manual 111 Chapter 5 Network Support 802 11b g Communications Note The Network Selection APIs change the network adapter Z configuration programmatically See Networking APIs on page 78 for the APIs To configure the radio 34 1 Tap Start gt Settings gt Network and Dial up Connections C SWLD26C1 2 Double tap the applicable radio connection icon to access and configure its properties 802 11bg High Speed wi ok x 802 11bg High Speed wi ok x IP Address Name Servers IP Address Name Servers An IP address can be autornatically Name server addresses assigned to this computer Obtain an IP address via DHCP Primary DNS rar scm l 5 Secondary DNS 2 x IP Address Ca a Primary wins Subnet Mask Secondary WINS Default Gateway Pe Pd Cone je E y 15 22 PM I E a Come e E y 15 23 PM A E IP Address Name Servers These two screens are for the Samsung radio using the SWLD26C1 connection icon shown on the left Should your 751G have the Wistron radio installed you can expect to see a BCMCF1 connection icon To configure the 802 11b g network adapter power through Intermec Settings 1 Select Star
149. puter eese een 27 Adjusting Settings cud uideris creen Qtr eed du A sb ei Duende erd aude 27 Adding or Removing Programs ossi vat wis s eee ea Rd 27 NEGEDSOL A CHYES VINE S i es CRETA ME egies DACUSQOERGACER EEA Fa VERE REED 30 Microsoft WordPad r eis ded amd bend Edere due dat d dta dri diua 30 Creating a Document eein te er ie epe quu eee rey ate ea 31 Typing Modes ranes oett en bool t aka Ruie Rea de Reo AN Lob e eoo p 31 Widang Mode scout obse edP REOR EE BRUCE Gy Rae pares prs 32 Synchronizing WordPad Documents ola aie al oa dr E e s PERS ADU 32 Internet Exploreras v 2244s oo VAS us io eia Ee rubet aut dedu Dd des bd 33 Viewing Mobile Favorites and Channels 0 0 0 cee cece ee eee 33 Browsing the Interne 42 Epp Lo Soter Sou ka ea eto e babe ns 33 vi 751G Color Mobile Computer User s Manual Contents 3 Configuring the Computer 0 000 2 eee ees 35 Configuring Parameters 1 oss ko eed ce aora e Boe Mapa ep ican Rea a ke 36 Configuring the Computer With Intermec Settings 0006 36 Synchronizing the Computer System Time with a Time Server 36 Configuring the Computer through the Network 97 Configuring the Computer in a TCP IP Direct Connect Network 37 Configuring the Computer in a UDP Plus Network 38 Using Configuration Parameters Li pied da eine eta e RE ERE OR RES o d 39 Contieutine the Printers ts toscano s nt ep reed eb dete ta eet 39
150. q bent RUM Ds 51 Lun 5 PTT 52 Creating Cab Files ei mise Wind n E E O E e a E E OU aI 53 Creating Device Specific Cab Files uar ESO S PROB OP Ee 53 Creating an inf iles oo Cody Dd RERO edid Quat D did 53 CESES oae aE a e tie E ER a EA Wile a 54 Sample INF Files osarwks ayia toe a E a BED E a DE 59 Using Installation Functions in Setup dll 0 onunu uuaa 62 After the CAB File Pxtracuolixg snus bias tn Korea face ORDRE ees 62 Creating Cab Files with CAB Wizard iz oes dared see cathe HER eae 65 Troubleshooting the CAB Wizard 4e per 9a ewe had een pd pac wie 66 Customization and Lockdomttss ces Mer aren tee cet ow eva ow ie et rrene rre 66 751G Color Mobile Computer User s Manual vii Contents viii Kernel I OGonttols t ixi ids baile PROCU bU bLbCU cece ee 67 IOCTL HAL GET DEVICE INFO eeeeee RR RR 67 IOCTL HAL ITC READ PARM seee RR RI RR 68 IOCTL HAL ITC WRITE SYSPARM ssese RR RR 70 IOCTL HAL GEL DEVIGBID IMS quer ePvel Up elite 71 IOCTL HAL GET OAL VERINFO eeesee Rn 72 IOCTL HAL GET BOOTLOADER VERINFO seen 73 IOCTL HAL WARMBOO T 3e eee Rhe ee ue E e qe eie RN 73 IOCTE HAL COEDDBGOQT karaan v ete dee vede ete eder 74 IOCTL_HAL_GET_RESET_INFO 0 0 ai eia i i s 74 IOCTL_HAL_GET_BOOT_DEVICE 0 0 0 0 0 RR IRR 75 IOGEL HAL REBOOT neepa n a veste ND ee Abi e 76 IOCTL_PROCESSOR_INFORMATION 0 0 0 0 0 0c cece eee eee 76 IOGTE GER GPUS IDs es ace e haa b
151. r ULONG amp endif GetWepStatus Call this to get the current state of the radio s WEP and encryption levels Syntax UINT GetWepStatus ULONG amp Parameters NDIS ENCRYPTION 1 ENABLED WEP is enabled TKIP and AES are not enabled and a transmit key may or may not be available same as NDIS RADIO WEP ENABLED NDIS ENCRYPTION DISABLED Indicates AES TKIP WEP are disabled transmit key available Same as NDIS RADIO WEP DISABLED NDIS ENCRYPTION NOT SUPPORTED Indicates WEP TKIP AES not supported Same as NDIS RADIO WEP NOT SUPPORTED NDIS ENCRYPTION 1 KEY ABSENT Indicates AES TKIP WEP disabled transmit key not available Same as NDIS RADIO WEP ABSENT NDIS ENCRYPTION 2 ENABLED Indicates that TKIP and WEP are enabled AES is not enabled and a transmit key is available NDIS ENCRYPTION 2 KEY ABSENT Indicates no transmit keys available for use by TKIP or WEP TKIP WEP enabled AES is not enabled NDIS ENCRYPTION 3 ENABLED Indicates that AES TKIP and WEP are enabled and a transmit key is available NDIS ENCRYPTION 3 KEY ABSENT Indicates no transmit keys available for use by AES TKIP WEP and AES TKIP WEP enabled Return Values ERROR_SUCCESS when successful ERR QUERY FAILED when the query failed or ERR CONNECT FAILED if a connection with the radio failed Remarks If ERROR SUCCESS is returned your ULONG reference is populated with one of the parameters listed above Definit
152. r Mobile Computer User s Manual 35 Chapter 3 Configuring the Computer Configuring Parameters You can configure many parameters on the 751G such as the bar code symbologies it decodes or the network settings These characteristics are controlled by configuration parameters The values you set for these configuration parameters determine how the computer operates Use configuration commands to configure the 751G Configuring the Computer With Intermec Settings eg Intermec Settings Use the Intermec Settings applet to configure the 751G and view system information You can access the Intermec Settings applet while running any application From the 751G desktop select Start Settings Control Panel then double tap the Intermec Settings icon Communications Device Settings SmartSysterns Information ION Configuration Printers a C interm amp ES 6 47 am AS For detailed information on most of the commands available in the Intermec Settings applet see the Intermec Computer Command Reference Manual P N 073529 via the Intermec web site Go to Before You Begin for access information Synchronizing the Computer System Time with a Time Server 36 It is important that the time on all of your 751Gs be synchronized with a network time server to ensure real time communications and updates Network time servers acquire Coordinated Universal Time UTC from an outside source such as the U S
153. r an at symbol orange BkSp Enter a backslash orange Esc Enter a minus sign orange Action Enter a plus sign orange right arrow Tab to the right orange left arrow Tab to the left orange up arrow Increase volume orange down arrow Decrease volume Alpha Green Plane Keys You can enter the alphabet using the Alpha green plane keys Below and on the next page are the key sequences When you press Alpha the Scanning Alpha LED shows red for the Alpha mode The keypad stays in Alpha mode until you press Alpha again To type a lowercase c press Alpha 2 2 2 To type a letter on the same key as the last letter entered wait two seconds then enter the correct series of keystrokes to create the next letter While in the Alpha mode and you press 1 to initiate the CAPS mode you will render a CAPS LOCK until you press 1 again Once you are in CAPS mode you stay in CAPS until it is pressed again Press 0 to enter a space Alpha Green Plane Keys To Enter Press the Keys To Enter Press the Keys a Alpha 2 A Alpha 1 2 b Alpha 2 2 B Alpha 1 2 2 c Alpha 2 2 2 C Alpha 1 2 2 2 d Alpha 3 D Alpha 1 3 e Alpha 3 3 E Alpha 1 3 3 f Alpha 3 3 3 F Alpha 1 3 3 3 g Alpha 4 G Alpha 1 4 h Alpha 4 4 H Alpha 1 4 4 i Alpha 4 4 4 I Alpha 1 4 4 4 j Alpha 5
154. r the 751G cab files register DLLs create shortcuts modify registry entries and run custom setup programs Tap a cab file to extract that file or place the cab file on one of the approved storage devices in the CabFiles folder then perform a warm boot on the 751G There are two methods available to extract a cab file e Tapa cab file to extract it With this method the cab file is automatically deleted when the extraction process is successful unless the cab file is set with the read only attribute Use the AutoCab method to extract all files when a cold boot is performed on the 751G This method is on the ntermec Developer Library CD see its Software Tools User s Manual for information Developing Applications for the Computer 46 ibd 751Gs run applications programmed in Microsoft Visual Studios 2005 Use this chapter to understand what you need to develop a new application for the 751G Note Microsoft eMbedded Visual C 4 0 may be used but some features are not available Use Resource Kits from the Intermec Developer Library IDL to develop applications for your 751G which are downloadable from the Intermec web site at www intermec com idl You need the following hardware and software components to use the resource kits Pentium desktop 400 MHz or higher e Windows 2000 Service Pack 2 or later or Windows XP Home Professional or Server For native and managed development Microsoft Visual Stu
155. re information 7 P a mm _ Storage Media Access Door a e j This shows the top of the 751G Note the keypad is to the bottom 2 Place the storage card in your desktop PC card reader then copy all required upgrade files to the storage card 3 Remove the storage card from your card reader reinstall it in the 751G 4 Press the Reset button inside the battery compartment to perform a cold boot Do not use force or a sharp object when pressing the Reset 751G Color Mobile Computer User s Manual Chapter 4 Maintaining the Computer button or you may damage the Reset button e P Reset button This shows the back of the 751G inside the battery compartment 5 Return the 751G to DC power such as installing it into a dock connected to external power 6 When the Bootloader Menu shows complete remove the storage card then press the Reset button again to load the new operating system Z Note The upgrade will fail if the 751G is not connected to external power For help see Accessories on page 18 7 When the 751G finishes booting insert the battery then close the battery door You may use the 751G You have reset the 751G to its default configuration You need to set the date and time and to set its network communications parameters to reestablish communications with the other devices in the wireless network Using the SmartSystems Console to Upgrade the Computer You can use the SmartSystems Con
156. registry information autoreg exe Flash File Store install reg use AutoReg to install this registry information Delete the file afterwards autoreg exe D Flash File Store install reg use AutoReg to extract registry information to a file autoreg exe HHKEY LOCAL MACHINENSoftwareNMIntermecNVersion version reg The format of the input file in this example is the standard registry format which should ease the creation of the input file since there are many publicly available utilities to generate a registry file besides Notepad 751G Color Mobile Computer User s Manual 51 Chapter 3 Configuring the Computer AutoCab AutoCab AuotCab exe extracts files registry settings and shortcuts from Windows cabinet CAB files The Windows startup sequence invokes AutoCab as a part of AutoExec and AutoRun During the Windows Mobile startup sequence AutoCab processes all cab files in the CabFiles directory relative to the current location of Autocab unless the location is overridden by command line arguments AutoCab can run as a stand alone program to install a cab file or a directory of cab files AutoCab only installs the cab file if it was not installed before by AutoCab To track the installation of a cab file AutoCab marks the cab file with the System attribute This attribute is ignored if the device is performing a clean boot on a non persistent file system AutoCab preserves the cab file af
157. rom the Internet A 1 Determine your 751G and processor type so that you know which y version of the software to install Tap Start gt Settings gt Control Panel System then double tap the System icon Note the processor information on the General tab beneath the Computer heading 2 Download the program to your 751G straight from the Internet using Internet Explorer You may see a single EXE or ZIP file a SETUP EXE file or several versions of files for different 751G types and processors Be sure to select the program designed for the Windows CE NET and your 751G processor type 3 Read program installation instructions Read Me files or other documentation Many programs provide installation instructions 4 Tap the file such as EXE file to start the installation wizard Follow the directions on the screen Adding a Program to the Start Menu You can either use Windows Explorer on the 751G to move the program to the My Computer Windows Start Menu folder or use Microsoft ActiveSync on the PC to create a shortcut to the program and place the shortcut in the My Computer Windows Start Menu folder Using Windows Explorer on the Computer Tap Start gt Programs gt Windows Explorer and locate the program Tap and hold the program and tap Cut on the pop up menu Open the My Computer Windows Start Menu folder tap and hold a blank area of the window and tap Paste on the pop up menu The program now appears on the St
158. s 39 INF files creating 53 Input panel keyboard 24 Pocket Word 31 selecting typed text 25 transcriber 25 Windows CE NET 23 Installation functions Setup dll 62 751G Color Mobile Computer User s Manual Installing applications Avalanche 45 SmartSystems 45 using a storage card 44 using Secure Digital cards 44 with ActiveSync 43 Intermec Developer Library 9 Intermec part numbers 18 Intermec settings 802 11b g 112 beeper volume 8 127 Intermec Settings applet Funk security 120 Intermec settings applet smartsystems 9 41 127 INTERMEC_PACKET_DRIVER SwitchPacketDriver 96 Internal card slots 16 Internal scanners reading distances 2D area imager 42 EA11 42 specifications 18 Internet Explorer browsing the Internet 33 software build version CE NET 14 PSM 14 Internet Explorer Mobile getting connected 113 IOCTL GET CPU ID 77 IOCTL HAL COLDBOOT 74 99 IOCTL HAL GET BOOT DEVICE 75 IOCTL HAL GET BOOTLOADER VERINF O 73 IOCTL_HAL_GET_DEVICE_INFO 67 IOCTL_HAL_GET_DEVICEID 71 IOCTL HAL GET OAL VERINFO 72 IOCTL HAL GET RESET INFO 74 IOCTL HAL ITC READ PARM 68 IOCTL HAL ITC WRITE SYSPARM 70 IOCTL HAL REBOOT 76 98 IOCTL HAL WARMBOOT 73 99 IOCTL PROCESSOR INFORMATION 76 isDHCPEnabled 93 isOrinoco 94 ISP connecting to via Windows Mobile 113 creating a modem connection 113 Internet Explorer 33 Windows Mobile 113 isSupplicantRunning 94 751G Color Mobile Computer User s M
159. s Communications CE14 Windows Start Menu Programs Games CE15 Windows Fonts CE16 Windows Recent CE17 Windows Start Menu InstallDir Contains the path to target directory selected during installation declared in CEStrings AppName Contains the application name defined in the CEStrings section 0 CE2 Windows 751G Color Mobile Computer User s Manual 57 Chapter 3 Configuring the Computer CopyFiles This section under the DefaultInstall section describes the default files to copy to the target device Within the DefaultInstall section files were listed that must be defined elsewhere in the inf file This section identifies that mapping and may contain flags Required Yes copyfile_list_section copyfile_list_section flags Flag Value COPYFLG WARN IF SKIP 0x00000001 COPYFLG NOSKIP 0x00000002 COPYFLG NO OVERWRITE 0x00000010 COPYFLG REPLACEONLY 0x00000400 CE COPYFLG NO DATE DIALOG 0x20000000 CE COPYFLG NODATECHECK 0x40000000 CE COPYFLG SHARED 0x80000000 Example destination filename source filename The source filename parameter is optional if it is the same as destination filename The numeric value that ie an action to be done while copying files The following table shows values supported by Windows CE Description Warn user if skipping a file is attempted after error Do not allow a user to skip copying a file Do not overwrite files in destination
160. s a shortcut to a folder shortcut list section zarget file path String value that specifies the destination location Use the target file name for a file such as MyApp exe that must be defined in a file copy list For a path use a f le ist section name defined in the DestinationDirs section such as DefaultDestDir or the InstallDir string shortcut list section standard destination path Optional string value A standard 96 CEx96 path or 96InstallDir96 If no value is specified the shortcut_list_section name of the current section or the DefaultDestDir value from DestinationDirs is used Example CEShortcuts Shortcuts All Shortcuts Al11 Sample App 0 sample exe Uses the path in DestinationDirs Sample App 0 sample exe InstallDir The path is explicitly specified Sample INF File Version Required section Signature SWindows NTS Provider Intermec Technologies Corporation CESignature SWindows CES 751G Color Mobile Computer User s Manual 59 Chapter 3 Configuring the Computer CEDevice ProcessorType DefaultInstall Required section CopyFiles Files App Files Fonts Files BitMaps Files Intl Files TelecomNcsCE Files Windows Files Import Files Export Files Work Files Database Files WinCE AddReg RegSettings All CEShortcuts Shortcuts All SourceDisksNames Required section 1 App files c appsoft 2 Fo
161. s is for anyone who must configure and deploy multiple devices or manage multiple licenses Use the Intermec Settings applet to do device configuration settings within the SmartSystems Foundation Information about the Intermec Settings applet is in the Intermec Computer Command Reference Manual P N 073529 available online at www intermec com Information about the SmartSystems Foundation is available as an online help within the SmartSystems Console application Select SmartSystems gt Help in the console to access the manual e Tap Start Settings the System tab the Intermec Settings icon then tap to expand the SmartSystems Information option Intermec x Settings Data Collection Communications Device Settings SmartSystems Information H Ready to Work Identity Administrator Location ION Configuration Printers a E inter E 12 20 au D E 751G Color Mobile Computer User s Manual 127 Chapter 5 Network Support 128 751G Color Mobile Computer User s Manual Index 751G Color Mobile Computer User s Manual 129 Index Symbols __resetmeplease__ txt 62 Numerics 1D area imager reading distances 42 2D area imager reading distances 42 2D Imager about 40 802 1 1b g API 78 configuration profiles 78 network adapter power 112 802 11b g information radios 112 802 1x authentication Funk 123 802 1x security troubleshooting 108 80211API dll 78 80211PM dll 78 A Acces
162. s low batteries or when the 751G is connected to a PC or to the Internet You can tap an icon to open the associated setting or program Programs You can switch from one program to another by selecting it from the Start menu You can customize which programs you see on this menu For information see Adjusting Settings on page 27 To access some programs tap Start gt Programs and then the program name Start Menu and Task Bar The Start Menu is located at the bottom of the screen It displays the active program and allows you to switch to programs and close screens E Intermec Settings Tap to access the Intermec Settings applet 7 Programs se Favorites Tap to see more programs iL Documents Tap to see web sites or WAP pages Settings amp Hep O Run Tap to configure your unit a TN Tap to display the input panel Tap to see text files and other documents ap Suspend x amp By 12 10 mu A E The task bar which displays the current time is at the bottom of the screen The task bar includes menu names buttons and the Input Panel icon Use this task bar to perform tasks in programs 751G Color Mobile Computer User s Manual 23 Chapter 2 Windows CE NET Notifications When you have something to do your device notifies you in any of the following ways You can choose notification types A message box appears on the screen e A sound which you can specify is played A light flash
163. s terminal in a hazardous environment may cause loss of life 751G Color Mobile Computer User s Manual 15 Chapter 1 Using the Computer Accessing the Secure Digital Card Slot To access the card slot locate the access door at the top of the 751G loosen its two screws then remove the door Note that the screws to this door are to be torqued to 1 5 in lbs See the Model 751G Mobile Computer Quick Start Guide P N 962 054 093 for more information 2 Pas WY TA _ Storage Media Access Door 7 9 oO i CT This illustration shows the top of the 751G Note the keypad is to the bottom Internal Card Slots and Connector Secure Digital card slot Below is a view of the various card slots within your 751G Note that you only have access to the Secure Digital card slot The other two slots are embedded into the unit and cannot be removed A radio is embedded in the CompactFlash card slot and is not accessible The Secure Digital card goes into the bottom left card slot The SmartCard adapter plugs into the 6 pin connector in the bottom right CompactFlash card slot 6 pin connector This illustration shows the top of the 751G Note the keypad is to the bottom Attaching a Tab to the Secure Digital Card 16 The Secure Digital storage card as ordered from Intermec come with acrylic adhesive pull tabs If you are using a storage card that you plan to remove from the 751G this
164. s the default active profile and configures the radio appropriately If needed the supplicant and any other related services are automatically started and stopped Definitions fifdef DYNAMIC LOADING typedef UINT PFN ConfigureProfile TCHAR felse UINT ConfigureProfile TCHAR fendif EnableSuppLogging Call this function to set the desired supplicant logging mode Syntax UINT EnableSuppLogging ULONG Parameters NDIS_SUPP_LOGGING_ON Supplicant Logging Enabled NDIS_SUPP_LOGGING_OFF Supplicant Logging Disabled Return Values ERROR SUCCESS when successful Remarks Definitions 92 None ifdef DYNAMIC else LOADING typedef UINT PFN EnableSuppLogging ULONG UINT EnableSuppl endif Logging ULONG 751G Color Mobile Computer User s Manual Chapter 3 Configuring the Computer EnableZeroConfig This enables or disables the Wireless Zero Configuration Wizard from Microsoft After calling this function a warm boot is required for the change to take effect Note Enabling this function effectively disables all the SET commands in this API Syntax UINT EnableZeroConfig USHORT Parameters TRUE Enable Wireless Zero Config FALSE Disable Wireless Zero Config Return Values ERROR SUCCESS when successful ERR ZERO CONFIG CHANGE FAILED when the query failed Remarks Call this function to set the desired Zero Config status Definitions ifdef DYNAMIC LOADING typedef UINT
165. s values from the keypad when a key is simultaneously pressed with the orange key such as pressing orange 1 to enter a Send command The alpha plane contains values from the keypad when the keypad is placed in alpha mode by pressing the green Alpha key such as pressing Alpha 1 to enter a Caps command Key Values Key values for each plane are stored in the registry All units ship with a default key mapping already loaded in the registry Applications that wish to change the default mapping need to read the appropriate key from the registry into an array of Words modify the values required and then write the updated values back into the registry The registry access can be done with standard Microsoft API calls such as RegOpenKeyEx RegQueryValueEx and RegSetValueEx 751G Color Mobile Computer User s Manual 99 Chapter 3 Configuring the Computer For the 751G keypad these registry keys contain the plane mappings e The unshifted plane mapping is in the registry at HKEY LOCAL MACHINEMHARDWARENDEVICEMAPNKEYBDNVkey The orange plane mapping is in the registry at HKEY_LOCAL_MACHINE HARDWARE DEVICEMAP KEYBD VkeyGold The alpha plane mapping is in the registry at HKEY_LOCAL_MACHINE HARDWARE DEVICEMAP KEYBD VkeyAlpha How Key Values Are Stored in Registry To know which fields to update in the registry you must know what Scan Codes ar
166. sole to upgrade the operating system on your 751G The console is part of SmartSystems Foundation and is available from the Intermec web site via the Intermec Developer Library IDL Before you can upgrade your computer you need the SmartSystems Foundation To download SmartSystems Foundation go to www intermec com idl and open the Device Management page the device upgrade exe file This file is available from the Intermec web site at www intermec com Go to Service amp Support gt Downloads Make sure the file you select is for your language 1 Install SmartSystems Foundation on your PC and open the SmartSystems Console 2 Ensure the SmartSystems Console and 751Gs are on the same subnet 3 Make sure your 751Gs are either in a communications dock or charging dock such as the AD14 or that power management is disabled 4 Download the device upgrade exe file to your desktop PC 751G Color Mobile Computer User s Manual 105 Chapter 4 Maintaining the Computer 5 Double click the exe file on your desktop PC An InstallShield application starts and walks you through the process of extracting the upgrade files in the default location Note Do not change the default location where InstallShield extracts the Z files The SmartSystems Console requires that the files be in this location 6 From the SmartSystems Console locate the device upgrade to install 7 Drag and drop the device upgrade onto each 751G you want to up
167. sory list 18 ActiveSync installing applications 43 ActiveSync See Microsoft ActiveSync Adding programs Microsoft ActiveSync 28 to the Start menu 29 via Microsoft ActiveSync 29 via Windows Explorer 29 Windows CE NET 27 AddWep 87 Adjusting settings Windows CE NET 27 Advanced Encryption Standard 119 AES Advanced Encryption Standard 119 Alpha plane on keypad 99 Ambient lighting 2 ANT_DIVERSITY GetDiversity 81 ANT_PRIMARY GetDiversity 81 ANT_SECONDARY GetDiversity 81 APIs 802 1 1b g 78 Applets backlight 2 intemec settings beeper volume 9 41 127 intermec settings 802 11b g 112 funk security 120 130 smartsystems 9 41 127 system properties 26 utilities 7 ASCII printing 39 printing to a port port print method 39 raw text to printer 39 AutoCab command line syntax 46 AutoUser dat 44 Avalanche 45 B Backlight applet ambient light sensor 2 Backlight control panel applet keypad 10 Bar codes troubleshooting 108 Basic connect disconnect functions 78 Battery ambient lighting 2 capacity 19 low battery conditions 4 specifications 19 status 4 Beeper softening the volume 9 volume turning it on 8 Browsing the Internet Internet Explorer 33 Build information CE NET 14 PSM 14 C CAB files after the extraction 62 creating 53 INF files 53 with CAB Wizard 65 installation functions SETUP DLL 62 Cabinet Wizard creating CAB files 65 troubleshooting 66 usi
168. t gt Settings gt Control Panel then double tap the Intermec e Settings icon Intermec Sete 2 Tap to expand Communications gt 802 11 Radio 3 Configure your radio settings then tap File gt Save Data Collection Communications Device Name WindowsCE E1 802 11 Radio Security Choice Funk Secu Allow Security Changes Microsoft Security f Funk Security 4 IP Settings t8 Certificates Radio Measurement 150 Radio State On Ethernet Adapter UDP Plus Device Setti mem E 15 27 Pm E 112 751G Color Mobile Computer User s Manual Chapter 5 Network Support Remote Access Modems You can set up connections to the Internet and corporate network at work to browse the Internet or intranet send and receive e mail and synchronize information using ActiveSync Connections are made via wireless networks Your 751G has two groups of connection settings My ISP and My Work Network Use My ISP settings to connect to the Internet Use My Work Network settings to connect to any private network My ISP Once connected you can send and receive e mail messages by using Messaging and view web pages by using Internet Explorer Mobile The communication software for creating an ISP connection is already installed on your 751G Your service provider provides the software needed to install other services such as paging and fax services If this is the method you want to use
169. t contains a byte value of the desired setting IOCTL HAL GET DEVICEID This returns the device ID There are two types of device IDs supported which are differentiated based on the size of the output buffer The UUID is returned if the buffer size is set to sizeof UNIQUE DEVICEID otherwise the oldstyle device ID is returned Usage include pkfuncs h include deviceid h 751G Color Mobile Computer User s Manual 71 Chapter 3 Configuring the Computer Syntax BOOL KernelloControl IOCTL HAL GET_DEVICEID LPVOID lpInBuf DWORD nInBufSize LPVOID lpOutBuf DWORD nOutBufSize LPDWORD lpBytesReturned Parameters IpInBuf IpInBufSize IpOutBuf nOutBufSize IpBytesReturned Return Values Should be set to NULL STRICT ID settings are not supported Should be set to zero Must point to a UNIQUE DEVICEID structure as defined by DEVICEID H if the UUID is to be returned The size of the UNIQUE DEVICEID in bytes if the UUID is to be returned A DEVICE ID as defined by PKFUNCS H is returned if the size in bytes is greater than or equal to sizeof DEVICE ID The number of bytes returned by the function Returns TRUE if function succeeds Returns FALSE if the function fails GetLastError may be used to get the extended error value IOCTL HAL GET OAL VERINFO Returns the HAL version information of the Pocket PC image Usage Zinclude oemioctl h Syntax
170. tPowerMode ULONG amp endif GetRSSI Call this function to get the current RSSI Radio Signal Strength Indicator in Dbm Syntax UINT GetRSSI ULONG amp Parameters References a ULONG populated with current RSSI after a successful call Return Values ERROR SUCCESS when successful ERR QUERY FAILED when the query failed or ERR CONNECT FAILED ifa connection with the radio failed Remarks If ERROR SUCCESS is returned your ULONG reference contains the RSSI Valid RSSI range is from 100 Dbm to 30 Dbm Definitions ifdef DYNAMIC LOADING typedef UINT PFN GetRSSI ULONG amp else UINT GetRSSI ULONG amp endif 751G Color Mobile Computer User s Manual Chapter 3 Configuring the Computer GetTXPower Call this function to get the current transmit power of the radio Syntax UINT GetTXPower ULONG amp Parameters NDIS POWER LEVEL 63 63 mW NDIS POWER LEVEL 30 30mW NDIS POWER LEVEL 15 15 mW NDIS POWER LEVEL 5 5mW NDIS POWER LEVEL 1 1mW NDIS_POWER_LEVEL_UNKNOWN Unknown Value or Error Return Values ERROR_SUCCESS when successful ERR_QUERY_FAILED when the query failed or ERR CONNECT FAILED if a connection with the radio failed Remarks If ERROR_SUCCESS is returned your ULONG reference is populated with the TX power in milliwatts mW Valid ranges are from 5 mW to 100 mW Definitions ifdef DYNAMIC LOADING typedef UINT PFN GetTXPower ULONG amp else UINT GetTXPowe
171. tall applications on all of your wireless 751Gs The wireless 751G ships with the Avalanche Enabler already loaded on it The Avalanche Enabler is configured to activate automatically typically on a clean boot Note If you manually activate the Avalanche Enabler on the 751G you may be prompted for a password when you exit the Avalanche Enabler The default password is leave When the Avalanche Enabler is activated the 751G attempts to connect to the Avalanche Agent When the 751G connects to the Agent the Agent determines whether an update is available and immediately starts the software upgrade file transfer or configuration update 1 Use the Avalanche Management Console to install software packages and updates For help see its online help contact an Intermec representative or visit the Wavelink web site at www wavelink com 2 Schedule the 751G updates or manually initiate an update using the Avalanche Management Console 751G Color Mobile Computer User s Manual 45 Chapter 3 Configuring the Computer Installing Cabinet Files Cab files short form of cabinet files are compressed folders as defined by Microsoft A cabinet file is a single file usually suffixed with cab that stores compressed files in a file library A compressed file can be spread over several cabinet files During installation the setup application decompresses the files stored in a cabinet and copies them to the user s system Fo
172. te link Organize Favorites Intermec Technologies News amp Information Homepage USATODAY com Tap the favorite to view Browsing the Internet 1 Set up a connection to your ISP or corporate network using information as described in Connecting to an Internet Service Provider on page 113 751G Color Mobile Computer User s Manual 33 Chapter 2 Windows CE NET 2 To connect and start browsing either tap Favorites from the toolbar then tap the favorite to view or in the Address bar that appears at the top of the screen enter the web address you want to visit using the input panel then tap the Enter key on the panel to go to that web site Ble Ed view Favorte fe x e S RFID Ei 9 50 ma Rs Tap the drop down arrow to select from previously entered addresses Tap to bring down a list of addresses od 8 RFID Ei s 52 a DA to add select Favorites Add to Favorites Z Note To add a favorite link while using the 751G go to the page you want 34 751G Color Mobile Computer User s Manual 3 Configuring the Computer There are multiple ways to get an application to your 751G Mobile Computer like there are multiple ways to package the application for delivery Note Desktop icons and applet icons are shown to the left Any place that Z Start is mentioned tap the following Windows icon in the bottom left corner of your desktop e 751G Colo
173. ter User s Manual 125 126 Chapter 5 Network Support eg Intermec Settings Configuring Microsoft Security The default security setting is Funk If you want to use Microsoft security you need to select it as your security choice 1 Select Start gt Settings gt Control Panel then double tap the Intermec Settings icon Tap to expand Communications gt 802 11 Radio gt Security Choice Select Microsoft Security from the drop down list then press Enter Communications Device Name WindowsCE E1 802 11 Radio Security Choice GREE iroso Security El Mici usui Se H Funk Security IP Settings Certificates Radio Measurement 150 Radio State On Ethernet Adapter UDP Plus Device Settings SmartSystems Information ION Configuration z BY mer 6 EL 11 24 Pm DA 2 Tap Yes or press Esc to clear the alert box save your settings then perform a clean boot on the 751G 751G Color Mobile Computer User s Manual Chapter 5 Network Support SmartSystems Foundation Use the SmartSystems Foundation www intermec com SmartSystems to configure and manage your network You can also contact your Intermec representative for support This tool available as a free download from Intermec includes a management console that provides a default method to configure and manage Intermec devices out of the box without the purchase of additional software licenses Thi
174. ter installation if the ReadOnly attribute is set If not set the cab file is deleted automatically after installation Command line switches are described as follows Usage AutoCab ChkRst File Force Log Move Quiet Show Signal ChkRst Set to 1 to configure AutoCab to check for the Reset flag after all cab files are installed This file is created by cab files that want a clean reset after installation Default is 0 do not check for flag File Specifies the cab files to extract Note that the specified files need not end with the cab extension Force Forces the specified cab files to extract regardless of whether it was previously extracted Log Set to 1 to create log file in same folder AutoCab is running Debugs cab installation Default is 0 disabled Move Set to 1 to force source cab file deletion even when read only bit set on file Default is 0 disabled Quiet Set to 0 to allow AutoCab to display user error message box Debugs cab installation Default is 1 quiet Show Set to 0 to prevent showing any installation progress interfaces Also prevents user from canceling installation Set to 1 to show normal installation Set to 2 to show Intermec installation progress interface user can see what is installing but cannot cancel it Default is 1 show normal Signal Set to string name of signal to use at the completion of cab installation before a reboot occurs if en
175. tered to Pl WU syste FA p 7 27 am TA E 2 Download the program to your PC or insert the CD or disk that contains the program into your PC You may see a single EXE or ZIP file a SETUP EXE file or several versions of files for different 751G types and processors Be sure to select the program designed for the Windows CE NET and your 751G processor type 3 Read any installation instructions Read Me files or program documentation Many programs provide special installation instructions 4 Connect your 751G and PC 5 Double click the EXE file If the file is an installer the installation wizard begins Follow the directions on the screen Once the software is installed the installer automatically transfers the software to your 751G e If the file is not an installer an error message stating that the program is valid but it is designed for a different type of computer is displayed Move this file to your 751G If you cannot find any installation instructions for the program in the Read Me file or documentation use Microsoft ActiveSync Explore to copy the program file to the My Computer Program Files folder on your 751G For information on copying files using Microsoft ActiveSync see ActiveSync Help Once installation is complete tap Start gt Programs and then the program icon to switch to it 751G Color Mobile Computer User s Manual Chapter 2 Windows CE NET Adding a Program Directly f
176. th the radio failed Remarks Data returned is valid if ERROR SUCCESS is returned Definitions ifdef DYNAMIC LOADING typedef UINT PFN GetLinkSpeed int amp else UINT GetLinkSpeed int amp endif 751G Color Mobile Computer User s Manual 81 Chapter 3 Configuring the Computer Syntax Parameters Return Values Remarks Definitions 82 GetMac Call this function to get the MAC address of the 802 11b g radio Call RadioConnect before calling this function for this function to work properly Syntax UINT GetMac TCHAR Parameters Pointer to a character array which is populated with the MAC address after a successful call Return Values ERROR_SUCCESS when successful ERR_QUERY_FAILED when the query failed or ERR CONNECT FAILED if a connection with the radio failed Remarks If ERROR SUCCESS is returned your TCHAR array is populated with the formatted MAC address of the adapter as follows xx xx xx xx XX XX Definitions ifdef DYNAMIC LOADING typedef UINT PFN GetMac TCHAR else UINT GetMac TCHAR endif GetNetworkMode Call this function to get the current Network Mode SSID for the 802 11b g radio UINT GetNetworkMode ULONG amp NDIS NET MODE IBSS 802 11b g Ad Hoc Mode NDIS NET MODE ESS 802 11b g Infrastructure Mode NDIS NET MODE UNKNOWN Anything Else Unknown Error NDIS NET AUTO UNKNOWN Automatic Selection Use of this option is not supported or recommended
177. tive programs currently running on your 751G To start Task Manager 1 Tap Start gt Settings gt Control Panel then double tap the System icon 2 Tap the Memory tab then tap Active Programs for the Task Manager System Properties iz ok x Memory Device Name amp lt 1 Move slider to the left for more memory to run programs Move it to the right for more storage space Only unused RAM black portion of the slider bar can be adjusted m m im m c n n n i i aaa m n n Storage Program memory memory 30080KB total 30132kKBtotal 7656KB in use 14948KBin use 751G Color Mobile Computer User s Manual Chapter 2 Windows CE NET To use a different application select an application then tap Switch To To stop an application select that application then tap End Task Task Manager Active Tasks System Properties Control Panel Customizing Your Computer Date Time Display Owner a Password 2 c9 Power You can customize your 751G by adjusting settings and installing software Adjusting Settings You can adjust settings to suit the way you work To see available options tap Start gt Settings gt Control Panel then double tap any of the applets You might want to adjust the following Date Time To change the time or calendar Display To customize the look of the desktop Owner To enter your contact information Password To li
178. tly through an access point or through the network Use the TMF protocol to send and receive transactions between the host application and the 751G To set up the host computer verify communication with the 751G To set up the application prepare and write a host application that can communicate with the IAS and send transactions to and receive transactions from the 751G in this format TMF field commands where TMF field is a 2 byte field containing one of these values CG Configuration Get request sent from the host application Cg Configuration Get response sent from the 751G to the host computer CS Configuration Set request sent from the host application Cs Configuration Set response sent from the 751G to the host computer commands are the reader and configuration commands to set on the 751G or the current value to retrieve from the 751G To save configuration changes in flash memory send the 1 reader command as the last command See the Intermec Computer Command Reference Manual for a list of commands Example In the host application you want to get the current values of two configuration commands from the 751G Send the cG NaBV transaction from the host application Note The transaction header is not shown in this example You do not need a transaction header for a host application in a TCP IP network but you do for a UDP Plus network where CG is a TMF Configuration Get request 4 is the Change Configuration re
179. to 41 the hexadecimal representation of A from the UNICODE chart then put the key back into the registry If you wish to disable a certain key remap its scan code to 0x00 Note Do not remap scan codes 0x01 0x41 0x42 0x43 0x44 Remapping Z these could render the 751G unusable until a cold boot is performed Change Notification Changing registry keys alone does not immediately change key mappings To notify the keypad driver the registry was updated use the CreateEvent API to signal the TTC_KEYBOARD_CHANGE named event 100 751G Color Mobile Computer User s Manual Chapter 3 Configuring the Computer Advanced Keypad Remapping It is possible to map multiple key presses or named system events to a button changing what buttons fire the scanner controls the volume and suspend resume the device These options can cut down the number of keys to press or remapping which key behaves like the action key Scan Codes At the lowest driver level the 751G keypad identifies keys as scan codes sent via the keypad microcontroller and cannot be changed without modifying the keypad firmware 751G Color Mobile Computer User s Manual Scan Codes Press this Key Meaning ScanCode Reserved 0x00 I O I O button 0x01 Scanner Handle Trigger 0x02 Scanner Left 0x03 Scanner Right 0x04 4 4 GHI A2 0x06 None 0x07 left arrow Left arrow Back Tab 0x08 None 0x09 BkSp BkSp forward slash 0x0A orange Orange p
180. to configure Intermec specific applications It launches the CAB installer AutoCab AutoCab exe to install platform cab files to the system such as Intermec Data Collection When the AutoExec is complete RunAutorun then checks for the existence of AutoRun AutoRun exe and executes this program from the first media it is found on This order is Secure Digital SDMMC Disk 2577 Object Store 2577 Flash File Store Flash File Store 2577 AutoRun is reserved for customer use to configure application launch sequences It launches the AutoCab installer and any customer programs added to the AutoUser dat file Shown is the hierarchy of these files runautorun autocab customer autocab applications 751G Color Mobile Computer User s Manual UT AutoExec Chapter 3 Configuring the Computer AutoExec AutoExec exe automates operations such as pausing launching processes or signaling and is configured through the AutoExec data file AutoExec dat This script file must be in the same directory as the program itself Note Intermec considers the usage of the AutoExec data file as Intermec Private AutoExec installs Intermec applications such as Data Collection Security Supplicants Intermec Management applets and shortcuts from components found in the Flash File System Do not modify the AutoExec data file Instead use the AutoRun program to add software components Usage AutoExe
181. tomaracters After you enter a passphrase the 751G internally converts it to a pre shared key This value must match the passphrase on the authenticator 6 Exit the Intermec Settings applet Using 802 1x Authentication 802 1x authentication provides centralized user authentication using an authentication server authenticators access points and supplicants These components communicate using an EAP authentication type such as TLS Transport Layer Security or PEAP Protected Extensible Authentication Protocol 802 1x security provides data encryption using dynamic WEP key management To use 802 1x security you need e An access point with an 802 11b g radio A751G with an 802 11b g radio and the 802 1x WPA security option 751G Color Mobile Computer User s Manual 123 Chapter 5 Network Support 124 Configuring 802 1x Security With Funk Security This sets 802 1x security on your 751G with Funk security Bis dr view ner o x B Profile Label Profile 1 Network Type Infrastre E SSID INTERMEC Power Mode Enabled 8021x LEAP Association Open Encryption WEP Pre Shared Key e BY C imer B 11 15 PM DA E 1 Make sure you have configured the communications and radio parameters on your 751G and that Funk is your security choice 2 Open Intermec Settings Tap to expand Communications gt 802 11 Radio gt Funk Security gt Profile X with X be
182. transfer between the scanner subsystem and user applications Automatic Data Collection COM Interfaces These COM interfaces allow user applications to receive bar code data and configure and control the bar code reader engine ITCAxBarCodeReaderControl functions These ActiveX controls allow user applications to collect bar code data from the scanner to configure the scanner and to configure audio and visual notification when data arrives ITCAxReaderCommand functions Use these ActiveX controls to modify and retrieve configuration information using the reader interface commands Scanning EasySet bar code labels You can use the EasySet bar code creation software from Intermec Technologies Corporation to print configuration labels Scan the labels to change the scanner configuration and data transfer settings Use the software to print scannable configuration labels to change your configuration settings For more information see the EasySet online help EasySet is available from the Intermec Data Capture web site Data Collection Configuration 40 From the 751G tap Start Intermec Settings to configure scanner settings See the ntermec Computer Command Reference Manual online manual for information about the settings you can configure with this applet Note that these are in alphabetical order Codabar Code 93 MaxiCode RSS 14 Codablock A Code 128 Micro PDF417 RSS Expanded Codablock F Data Matrix MSI RSS Limited Co
183. ts and part numbers Document Title Part Number Model 751G Mobile Computer Quick Start Guide 962 054 093 Intermec Computer Command Reference Manual 073529 Important 2610C Radio Information 075494 The Intermec web site contains Intermec documents in PDF that you can download for free 751G Color Mobile Computer User s Manual Before You Begin To download documents 1 Browse to www intermec com 2 Click Service amp Support gt Manuals 3 In the Select a Product field choose the product whose documentation you want to download To order printed versions of the Intermec manuals contact your local Intermec representative or distributor Patent Information This product is protected by one or more of the following patents 4 882 476 4 894 523 4 953 113 4 961 043 4 970 379 4 988 852 5 019 699 5 021 642 5 038 024 5 081 343 5 095 197 5 144 119 5 144 121 5 182 441 5 187 355 5 187 356 5 195 183 5 195 183 5 195 183 5 216 233 5 216 550 5 218 191 5 227 614 5 233 172 5 241 488 5 243 602 5 258 606 5 278 487 5 288 985 5 308 966 5 322 991 5 331 136 5 331 580 5 342 210 5 349 678 5 359 185 5 371 858 5 373 478 5 389 770 5 397 885 5 410 141 5 414 251 5 416 463 5 442 167 5 464 972 5 468 947 5 468 950 5 477 044 5 486 689 5 488 575 5 500 516 5 502 297 5 504 367 5 508 599 5 514 858 5 530 619 5 534 684 5 536 924 5 539 191 5 541 419 5 548 108 5 550 362 5 550 364 5 565 669 5 567 925 5 568 6
184. u 29 URL 30 Microsoft security 120 Microsoft WordPad 30 Modems creating a connection to an ISP 113 N nDeviceld NLEDGetDevicelnfo 98 NDIS_ENCRYPTION_1_ ENABLED EncryptionStatus 88 GetWepStatus 85 NDIS ENCRYPTION 1 KEY ABSENT EncryptionStatus 88 GetWepStatus 85 NDIS ENCRYPTION 2 ENABLED EncryptionStatus 88 GetWepStatus 85 NDIS ENCRYPTION 2 KEY ABSENT EncryptionStatus 88 GetWepStatus 85 NDIS ENCRYPTION 3 ENABLED EncryptionStatus 88 GetWepStatus 85 NDIS ENCRYPTION 3 KEY ABSENT 751G Color Mobile Computer User s Manual Index EncryptionStatus 88 GetWepStatus 85 NDIS ENCRYPTION DISABLED EncryptionStatus 88 GetWepStatus 85 NDIS ENCRYPTION NOT SUPPORTED EncryptionStatus 88 GetWepStatus 85 NDIS MIXED CELL OFF SetMixedCellMode 91 NDIS MIXED CELL ON SetMixedCellMode 91 NDIS NET AUTO UNKNOWN GetNetworkMode 82 SetNetworkMode 90 NDIS NET MODE ESS GetNetworkMode 82 SetNetworkMode 90 NDIS NET MODE IBSS GetNetworkMode 82 SetNetworkMode 90 NDIS_NET_MODE_UNKNOWN GetNetworkMode 82 SetNetworkMode 90 NDIS_NET_TYPE_DS GetNetworkType 83 NDIS_NET_TYPE_FH GetNetworkType 83 NDIS NET TYPE OFDM 2 4G GetNetworkMode 82 SetNetworkMode 90 NDIS NET TYPE OFDM 5G GetNetworkMode 82 SetNetworkMode 90 NDIS NET TYPE UNDEFINED GetNetworkType 83 NDIS NETWORK EAP MODE OFF GetCCXStatus 86 SetCCXStatus 91 NDIS NETWORK EAP
185. ucceeds Returns FALSE if the function fails GetLastError may be used to get the extended error value Returns Xscale processor ID Usage Zinclude oemioctl h Syntax BOOL KernelloControl IOCTL GET CPU ID LPVOID lpInBuf DWORD nInBufSize LPVOID lpOutBuf DWORD nOutBufSize LPDWORD ipBytesReturned Parameters IpInBuf Should point to a CPUIdInfo structure defined in OEMIOCTL H IpInBufSize Should be sizeof CPUIdInfo IpOutBuf Should be NULL nOutBufSize Should be set to 0 IpBytesReturned Returns sizeof PROCESSOR INFO Return Values Returns TRUE if function succeeds Returns FALSE if the function fails GetLastError may be used to get the extended error value 751G Color Mobile Computer User s Manual 77 Chapter 3 Configuring the Computer Networking APIs 80211API DLL 80211PM DLL URODDSVC EXE ZNICZIO DLL The API provided by Intermec Technologies exposes a limited set of routines that allows a programmer to access and affect the 802 11b g network interface card from within their application The routines provided also reads writes values to the CE registry that pertain to the 802 11b g radio driver By using the provided functions a programmer can alter the 802 11b g parameters of Network Name SSID WEP keys infrastructure modes radio channel and power management modes A programmer can also retrieve network connect status and signal strength indication from the RF network card The API
186. uch faster since data does not have to be converted from one graphics format to the other display to printer Most Intermec printers use Epson Escape Sequences to control print format operations These commands are available in documentation you receive with your printers or from technical support Win32 APIs are required to print directly to the port Directly to a Generic Serial Port To print directly to a generic serial port printer non Intermec printers Use CreateFile to open ports COMI can be opened on most devices Use WriteFile to send data directly to the printer Use CloseHandle when you are finished printing to close the port 751G Color Mobile Computer User s Manual 39 Chapter 3 Configuring the Computer Configuring the Scanner The 751G comes with a 2D Imager that decodes several stacked 1D and 2D symbologies including PDF417 Data Matrix and MaxiCode without painting It can also read 1D codes from any orientation For example the scan beam does not need to align perpendicular to the symbol in order to read it Photography is a secondary application the lens in the device favors bar code reading Photos are 640x480 256 gray scale An ImageDemo application is available to demonstrate imager features See the mageDemo User s Guide P N 934 002 001 for more information Scanner Control and Data Transfer The data server and associated software provide ways to handle scanner control data
187. ur bytes returned in buffer pointed to by pOurBuffer ITC NVPARM CONTRAST Returns device default contrast setting Two bytes returned in buffer pointed to by pOutBuffer ITC NVPARM MCODE Returns manufacturing configuration code for device Sixteen bytes returned in buffer pointed to by pOutBuffer ITC NVPARM VERSION NUMBER Returns firmware version for various system components These values for C assId field of PARMS structure are allowed when ITC NVPARM VERSION NUMBER used in id field VN CLASS KBD Returns five byte string including null terminator with ASCII value representing keypad microprocessor ver sion in system String format is x xx with terminating null character VN CLASS ASIC Returns five byte string including null terminator with ASCII value representing version of FPGA firmware in system String format is x xx with terminating null character VN CLASS BOOTSTRAP Returns five byte string including null terminator with ASCII value representing version of Boot strap Loader firmware in system String format is x xx with terminating null character ITC NVPARM INTERMEC SOFTWARE CONTENT Reads manufacturing flag bits from non volatile data store dictating certain software parameters BOOLEAN DWORD returned in buffer pointed to by pOutBuffer indicating whether Intermec Content enabled in XIP regions TRUE indicates enabled FALSE is not enabled ITC NVPARM ANTENNA DIVERSITY Reads state of antenna diversity flag BOO
188. vation SmartSystems Wistron radio EA11 imager Microsoft WordPad and IrDA and LAN interfaces 751G Color Mobile Computer User s Manual iii 751G Color Mobile Computer User s Manual Contents Contents Before You Begins oir Oo to Dol UA a eek Ya Pare dA oP ake A dedi xi Safety Information oro dep bota eu e be be Age en BER RE net xi Global Services and Support iu eie bh dpa tede ee Rhee a Le eed D xi Who Should Read This Document leeeeeeeeeeeeeeeeeeeen xii Related Doc ments aes is nesr deis oa ements oa eee tio e E uis spa EE eh xii Patent Information ag voa a bXd epe E isin beets A Hes LUPO Seq oed xiii 1 Using the Comp ter serere ce eee a S eate qi 1 Ambient Light Sensor 3 5 Weg kad s PM REA Ud RU ON ar ear aan dea 2 Audio System oss seant tos wel dial sc Re RN NES e REV tn ta e ene nine hate cs uu AS pies 3 ship D II 3 Microphone 1459 bateeteod n koe eset e ade entes oceans ansaid 3 External Headset Jack er ere eee ree RE E 4 Battery d cse IAMENAD e Rer RR Nm er re reto pre UE S ed ds 4 Installing and Charging the Battery ot asi a oae eret docto te oe qe 5 Removing the DAHeryo s ota los e sam o v oec S hg use ceu ewe 6 Maximizing Battery Lifen acs musai ex bates eot u haters ters 7 DEEPER c EE E M MEE DAT 7 Enabling the Registry SIordges scot ws dae eeu ei DEDE HERE 7 Enabl tie the Beeper oiioe er vido Dir behets shay lub dr a i etia ates 8 Adjusting the Beeper Vol ime a sciet
189. ws and the Windows logo are registered trademarks of Microsoft Corporation in the United States and or other countries Bluetooth is a trademark of Bluetooth SIG Inc U S A This product includes software developed by the OpenSSL Project for use in the OpenSSL Toolkit www openssl org This product includes cryptographic software written by Eric Young EAY cryptsoft com This product uses Regex Index software during its operational phases The owner of Regex has granted use of the software to anyone provided such use is accompanied by the following copyright and permission notice Regex Index Version 3 31 16th Dec 2001 Copyright 1998 2001 Dr John Maddock Permission to use copy modify distribute and sell this software and its documentation for any purpose is hereby granted without fee provided that the above copyright notice appear in all copies and that both that copyright notice and this permission notice appear in supporting documentation Dr John Maddock makes no representations about the suitability of this software for any purpose It is provided as is without express or implied warranty ii 751G Color Mobile Computer User s Manual Document Change Record This page records changes to this document The document was originally released as Revision A Revision Letter Date Description of Change B 04 2005 Added AIT III information C 12 2006 Updated to include information about assured radio deacti
190. y 107 Typing mode Pocket Word 31 Typing on the screen Pocket Word 31 U Unshifted plane on keypad regular keypad 99 Updating bootloader 43 URLs full screen display 67 Microsoft support 22 Windows CE NET support 22 URODDSVC EXE 78 Utilities applet registry save 7 UUID 71 V Vibrator programming 97 Viewing mobile favorites and channels Internet Explorer 33 VN CLASS ASIC 69 VN CLASS BOOTSTRADP 69 VN CLASS KBD 69 WwW WAN radio IDs ITC_DEVID_WANRADIO_NONE 69 ITC DEVID WANRADIO SIEMENS MC 45 69 ITC DEVID WANRADIO SIEMENS MC 46 69 ITC DEVID WANRADIO SIERRA SB555 69 WAP pages 33 connecting to an ISP 113 Warm boot IOCTL HAL REBOOT 76 IOCTL HAL WARMBOOT 73 751G Color Mobile Computer User s Manual Index Wavelink Avalanche 45 WCEStart ini 56 Web pages 33 connecting to an ISP 113 WEP Wired Equivalent Privacy encryption 119 Wi Fi Protected Access 119 121 Windows CE NET basic skills 22 Desktop screen 23 notifications 24 programs 23 Start menu 23 support URLs 22 task bar 23 where to find information 22 Windows Explorer adding programs to Start menu 29 Windows CE NET 26 Windows Mobile getting connected 113 Wired Equivalent Privacy 119 125 Wireless connectivity troublshooting 107 Wireless network security 118 specifications 18 Wistron radio 802 11b g information 112 WordPad 30 creating a document 31 Work getting connected 116 WP
191. ytes returned by the function for the data requested Return Values Returns TRUE if function succeeds Returns FALSE if the function fails GetLastError may be used to get the error value Either ERROR INVALID PARAMETER or ERROR INSUFFICIENT BUFFER may be returned when this function is used to get the error ID Field Values The id field of the PARMS structure may be one of the following values ID Field Values ITC NVPARM ETHERNET ID Returns Ethernet 802 11b or 802 11b g MAC Address Six bytes returned in buffer pointed to by pOurBuffer ITC NVPARM SERIAL NUM Returns serial number of device in BCD format Six bytes returned in buffer pointed to by pOutBuffer ITC NVPARM MANF DATE Returns device manufacture date in BCD YYYY MM DD format 4 bytes sent in buffer pointed to by OutBuffer ITC NVPARM SERVICE DATE Returns last device service date in BCD YYYY MM DD format Four bytes sent in buffer pointed to by pOutBuffer ITC NVPARM DISPLAY TYPE Returns device display type One byte returned in buffer pointed to by pOutBuffer ITC NVPARM EDG IP Returns device Ethernet debug IP address Four bytes returned in buffer pointed to by pOutBuffer 68 751G Color Mobile Computer User s Manual Chapter 3 Configuring the Computer ID Field Values ITC NVPARM EDBG SUBNET Returns device Ethernet debug subnet mask Four bytes returned in buffer pointed to by pOutBuffer ITC NVPARM ECN Returns ECNs applied to device in bit array format Fo

Download Pdf Manuals

image

Related Search

Related Contents

  here - Neo Car Audio  HUVUDRUBRIK 1  • MODO/P • MODO/V Membrane d`étanchéité bitume  Valueline VLCP60803B20 camera cable  KOHLER K-R776-SD-VS Installation Guide  Handbuch Stationäres ec  LG TM520 Manual  BA Grenoble RD169 i 95%  Handout - Associazione Medici Endocrinologi  

Copyright © All rights reserved.
Failed to retrieve file