Home

User Manual

Contents

1. Crime By Status Crime By Status grouped by Statusoferiminal C Apprehended MH At large EB Unknown Figure11 Map Viewer Link Map Intelligence Client 3 2 3 for Reporting Services User Manual 17 EMBED MAP AND REPORT IN ASP NET PAGE PREREQUISITES The following software should be installed before creating an ASP net page 1 SQL Server 2005 or 2008 2 Microsoft SQLServer Reporting Services 2005 or 2008 Report Services is bundled with SQLServer 2005 or 2008 Installer 3 Microsoft Visual Studio 2005 or 2008 EMBEDDING A MAP VIEWER IN ASP NET 1 Go to Start gt All Programs gt Microsoft Visual Studio 2005 and click on Microsoft Visual Studio 2005 to open up the Visual Studio 2005 IDE A screen similar to the following screen shot will be displayed s age Microsoft Visual Studio 181 xi Figure 12 Visual Studio 2005 IDE Microsoft Visual Studio 2005 Recent Projects Open Project Web Site Create Project Web Site Getting Started What s new in 05 Create Your First Application Use a Starter Kit How Dol Learn Visual C Connect With the Community Download Additional Content Visual Studio Headlines MSDN Visual Studio 8 substation MSDN Visual C LINQ to SQL Overview video Wed 19 Mar 2008 15 03 52 0700 Luca Bolegnese s presentation on LINQ at the Tech Ed Video of Luke Hoban s In Depth Look at C 3 0 Mon 25 Feb 2008 17 00 21 0800
2. catch ReportViewerException ex throw ex lt summary gt This method is used for creating the url string of the configured map lt summary gt lt param name reportViewer gt lt param gt lt param name userID gt lt param gt lt xreturns gt String lt returns gt public static string GetMapURL ReportViewer reportViewer string userID string MI SERVER ConfigurationManager AppSettings MI_ SERVER string MI CLIENT ConfigurationManager AppSettings MI_ CLIENT string PORT NUMBER ConfigurationManager AppSettings PORT NUMBER string PARAM DELIMITER ConfigurationManager AppSettings PARAM DELIMITER string reportName string Empty string reportPath string Empty string temp string Empty string url string Empty string connToken string Empty StringBuilder sb new StringBuilder ReportParameterInfoCollection parameterCollection reportViewer ServerReport GetParameters reportPath reportViewer ServerReport ReportPath reportName reportViewer ServerReport DisplayName connToken string Format amp connToken 0 1 reportID userID Replace connToken string Format amp connToken 0 1 reportName userID Replace Map Intelligence Client 3 2 3 for Reporting Services Development Guide 167 Domain sb Append MI_ SERVER sb Append PORT NUMBER sb Append MI_ CLIENT
3. else List lt string gt defaultValues new List lt string gt foreach string value in paramInfo Values defaultValues Add value J parm parameterCount new ReportParameter paramInfo Name defaultValues ToArray parameterCount 1 RenderReport reportViewerID parm return GetMapURL reportViewerID userID lt summary gt This is used to get all the Selection Layers lt summary gt lt param name reportViewerlD gt lt param gt lt param name userID gt lt param gt lt returns gt lt returns gt private static string GetLayerList ReportViewer reportViewerID string userID StringBuilder sb new StringBuilder Uri requestURI string MI SERVER ConfigurationManager Appsettings MI SERVER string PORT NUMBER ConfigurationManager AppSettings PORT NUMBER string PARAM DELIMITER ConfigurationManager AppSettings PARAM DELIMITER string documentName string Empty string connToken string Empty string layerList string Empty documentName reportViewerID ServerReport ReportPath Replace 20 connToken userID Replace sb Append MI_ SERVER sb Append PORT NUMBER sb Append miclient selectFilterMap document name sb Append documentName sb Append amp connToken sb Append connToken sb Append amp command 1ist sb Append amp columnDelimiter sb Append PARAM DELIMITE
4. Figure 76 Theme Builder Wizard Configure Tab Numeric Automatic Specific Colors Si amp Clo 12 Click FH save amp close The Theme Builder Wizard closes The created theme displays in the Color Theme section of the Relationship Layer configuration screen Map Intelligence Client 3 2 3 for Reporting Services Development Guide 91 Color Theme Fact Layer Shot Points Fact Column Whole Kg Function SUMI Scheme Quantile Class 1 Color Class 4 Color Class 3 Color Class 4 Color Empty Color Figure 77 Themes Section showing Specific Color Theme Legend Region Catch by half degree c 196 00 c 2 055 00 5 045 00 gt 6 045 00 Figure 78 Region Relationship Layer Map View and Legend showing Specific Color Theme eertttlttatencatk Ns Figure 79 Radius Relationship Layer Map View and Legend showing Specific Color Theme Map Intelligence Client 3 2 3 for Reporting Services Development Guide 92 SELECTING COLOR RANGE 1 Onthe Visual Feature options click the Color Range radio button Theme Builder EIDE TE Class Cout 4 EF Visual Feature C Specific Colors Color Range Hatches Fill Opacity Border Thickness 1 lt lt Back Save amp Close Next gt gt Figure 80 Theme Builder Wizard Features Tab Numeric Automatic Color Range Features Rendering Attributes 2 On the Fill Opacity field enter a number from 0 to 1 to indicate the
5. Return sb ToString Catch ex As Exception End Return GetExceptionMes sage ex Try End Function Private Dim Function GetExceptionMessage ByVal thrownException As Exception As String message As String String Empty message String Format Error 0 thrownException Message Return message End Function Public Function GetMapIntelligenceURL ByVal reportParameters As String As String Dim Dim Try formattedParameters As String String Empty parameterCollection As String parameterCollection reportParameters Split If Not reportParameters String Empty Then formattedParameters GetFormattedParameters parameterCollection End If Return CreateMapIntelligenceURL formattedParameters Catch ex As Exception Map Intelligence Client 3 2 3 for Reporting Services Development Guide 165 Return GetExceptionMessage ex End Try End Function Private Function GetFormattedParameters ByVal parameterCollection As String As String Dim temp As String String Empty Dim sb As New System Text StringBuilder Try For Each reportParameter As String In parameterCollection If Report Parameters reportParameter IsMultiValue Then temp Join Report Parameters reportParameter Value sb Append String Format 26 0 1 reportParameter temp Replace PARAM DELIMITER Else sb Append String Format 26 0 1 reportParameter Report Parameters reportParameter Value End
6. CENTER POINT SECTION Setting the Center Point controls the way your map is initially displayed on opening Default selects a center point by plotting all the points specified by the visible point layers and takes the center point of all points If no point layers are set as visible the Center point is taken from visible Region layers i e Relationship or Area Group Layers Coordinates allows you to specify a coordinate to set as the center point for the map If you select this option you will need to specify the latitude and longitude values for your center point You must specify a map width or the default center point will be used Address allows you to specify a valid street address to set as the center point for the map If you select this option you will need to specify the street address suburb city state and post code zip code values for your center point You must specify a map width or the default center point will be used Map Intelligence Client 3 2 3 for Reporting Services Development Guide 52 2 To set the Center Point using Coordinates 5 Click the Coordinates radio button 6 Inthe Map Width field type in the width of the map to be initially displayed P This value is in kilometers or miles depending on the unit of measurement selected in the Units section see Mote Preferences below If you do not specify a map width Map Intelligence will apply a default width that will display all your poin
7. Development Guide 62 DISPLAY INFORMATION Data columns can be sent to the Mapping Viewer to provide further information about each point The values contained in these columns displays in a pop up window when you move your mouse over a point in the map To configure the Display Information section 1 Onthe Display Information list box select the columns to make available on the Mapping Viewer 2 Select the data columns to display from the left hand list box and click the EE button To remove a selection select the data column from the left hand list box and click the WB sutton Mote To select all the data columns click the gt button To remove all sections click the lt lt button Display Information Id Codeone Vessel Name Depth Common Name Hour Groups Shot Ti whole Kg Image Depth Ranges Latitude Longitude Max of whole Kg Max of Depth Poul I I oe ul Figure 39 Display Information section Map Intelligence Client 3 2 3 for Reporting Services Development Guide 63 THEMES SECTION The Theme section allows the selection of layer theme Setting a theme involves color coding or assigning images to points in the layer using the Theme Builder Wizard To view the Theme Builder Wizard 1 Click The Theme Builder Wizard displays Mote The following theme types are available Single Shape Icon This option allows you to specify one shape of one color to represent all your points
8. sb Append MI SERVER sb Append PORT NUMBER sb Append miclient selectFilterMap document name sb Append documentName sb Append amp connToken sb Append connToken sb Append amp command get sb Append amp columnDelimiter sb Append PARAM DELIMITER sb Append amp rowDelimiter sb Append PARAM DELIMITER sb Append amp layerName sb Append layerName Replace 20 nN R requestURI new Uri sb ToString System Net HttpWebRequest rq System Net HttpWebRequest HttpWebRequest Create requestURI System Net HttpWebResponse resp System Net HttpWebResponse rq GetResponse StreamReader sr new StreamReader resp GetResponseStream selectediItems sr ReadToEnd Sr Close layerValues selectedItems Split return layerValues Map Intelligence Client 3 2 3 for Reporting Services User Manual 29 12 The next step is to design the web page that will display the map On the Solution Explorer right click on the website un Add New Item and select See example below Solution Explorer C RS5Integeo Demo P Solution i El C RSIntegeo Demo Publish Web Site ja Add New Item LEJ Add Existing Item G New Folder Add ASP NET Folder Add Reference Add web Reference a view Class Diagram Er Copy Web Site Figure 23 Adding New Item Map Intelligence Client 3
9. Point Layers are map layers where data is represented on the map as discrete point images or symbols For example a particular layer might represent the location of stores as push pin icons and another layer could represent accidents as colored dots where the color theme represents the severity of the accident Typically the rows in a table of data belong to a business concept such as people or address details where each column is an attribute of that concept Thus each row in your business data can be represented as an individual point in a point layer In Map Intelligence point layers form the foundation for relationship layers RELATIONSHIP LAYERS Radius relationship layers are circular regions with themes around certain points of interest that show information about other points which fall within that circular region These layers are generated by Map Intelligence They are based on calculations made by Map Intelligence on the specified data values as defined by the Layer Designer For example different colored circles indicate the average house price within half a kilometer of a proposed waste plant Another example is where different colored circles indicate the number of burglaries that have occurred within a five mile distance of houses belonging to known burglars In the current version of Map Intelligence the circle center points eg houses belonging to known burglars and the data being analyzed burglaries must be point
10. Delete Layer 93 Settings Edit Layer 92 Color of hatches on layers 137 Layer Properties Section 58 Color of region borders 138 Relationship Type Section 59 Opacity of circular region borders in radius Save Layer 92 relationship layer 137 Test Settings 92 Opacity of colored circular regions in radius layers 136 Relationship Layers Opacity of colored regions 136 Configure 57 Opacity of hatches on layers 136 Numeric Aggregation 63 Opacity of region borders 138 Radius Relationship Description 10 Thickness of circular region borders in radius relationship layer 137 Region Relationship Description 11 I Use map border attributes 138 Themes Section 63 Transparent Colors 83 Themes 146 Unshaded Colors 83 Thickness of circular region borders in radius Relatioship Layers relationship layer 137 Use map border attributes 138
11. ReportCredentials Constructor lt summary gt lt param name userName gt lt param gt lt param name password gt lt param gt lt param name domain gt lt param gt public ReportCredentials string userName string password string domain _userName userName _ password password Map Intelligence Client 3 2 3 for Reporting Services User Manual 22 _domain domain public System Security Principal Windowsldentity ImpersonationUser get Use the default Windows user Credentials will be provided by the NetworkCredentials property return null lt summary gt Read the user information from the Web config file By reading the information on demand instead of storing it the credentials will not be stored in session reducing the vulnerable surface area to the Web config file which can be secured with an ACL lt summary gt public System Net ICredentials NetworkCredentials get return new System Net NetworkCredential _userName password domain public bool GetFormsCredentials out System Net Cookie authCoki out string userName out string password out string authority userName userName password _password authority _domain authCoki new System Net Cookie ASPXAUTH ASPXAUTH Domain return true Figure 138 Code For Implementing Report Server Credentials 8 The next step is to add another
12. e Mote The column name must be unique 5 On the Icon Shape drop down list select the shape to represent each point in the layer Map Intelligence Client 3 2 3 for Reporting Services Development Guide 74 Theme Builder 1 Theme Type New Column Name lt lt Back Save amp Close Next gt gt Figure 55 Theme Builder Wizard 1 Theme Type Auto Classification 6 Click the Features tab or the Next button The Features tab opens 7 On the Scheme drop down list select a classification scheme You can use a standard classification scheme to group similar values to look for patterns in the data You can Mote Choose from two schemes for grouping data values into classes based on how the data values are distributed Equal Interval The difference between the high and low values is the same for every class So the classification of the data will be based on a set of equal splits For example if the lowest value is 0 and the highest value is 10 in the data and 5 classes are requested the range of each class will be 0 to 2 2 to 4 4 to 6 6 to 8 8 to 10 Quantile Each class contains an equal number of features In this case the points are sorted in ascending order for the chosen data field and each class is filled with total number of points number of classes points starting from the lowest value to the highest 8 On the Class Count drop down list select the number of colors to appear on the s
13. S value is the most common vessel catching fish within S label Map Intelligence Client 3 2 3 for Reporting Services Development Guide 86 Relationship Type Radius Region reference Region Layer Flg E Legend Description Most Common vessel catching fish within Popup Description PHvalue is the most common vessel cate Figure 71 Relationship Type Region Option Map Intelligence Client 3 2 3 for Reporting Services Development Guide 86 CREATING THEMES FOR RELATIONSHIP LAYERS Creating themes for Relationship Layers requires you to specify threshold conditions based on a Numeric or String aggregation using the Theme Builder Wizard on the Relationship Layer configuration screens Mote Hatches for Radius Relationship layers are not available for the current version of Map Intelligence NUMERIC AGGREGATION Map Intelligence allows the application of function on values from a specified column The specified built in map layer or a circle around a point is shaded according to the resulting values The available numeric functions are Count Sum Min Max Mean and Median 2 Creating q theme based on a Numeric Aggregation Them 1 Click 39 Theme The Theme Builder Wizard displays with the Theme Type tab open by default 2 Onthe Point Layer drop down list select the Point Layer containing the points to geographically relate to the reference layer 3 On the Column drop
14. Single Image Icon This option allows you to specify a single image to represent all the points in the layer Multiple Shape Icon This option allows you to select a shape and color code the shape according to the column value For example selecting the circle shape to represent all the fishing boat points then color coding the circles according to the name of the boat Multiple Image Icon This option allows you to select a different image for each column value Auto Classification This option allows you to specify the number of classes into which column values will be distributed 2 Creating a Single Shape Icon Theme 1 Click The Theme Builder Wizard displays with the Theme Type tab open by default 2 Onthe Theme Type drop down list select Single Shape Icon Map Intelligence Client 3 2 3 for Reporting Services Development Guide 64 3 On the Icon Shape drop down list select the shape that you want to use to represent each point in the layer Theme Builder 1 Theme Type Theme Type single Shape Icon Json Shape lt Back Save amp Close Next gt gt Figure 40 Theme Builder Wizard 1 Theme Type Single Shape Icon In this example the Square shape has been selected 4 Click the Configure tab or the Next button The Configure tab opens Map Intelligence Client 3 2 3 for Reporting Services Development Guide 65 5 Select a color from the color swatch xx Theme Builder x 5 Con
15. amp Close Next gt gt Figure 81 Theme Builder Wizard Configure Tab Numeric Automatic Color Range s amp Clo 13 Click FH Save 8 Close The Theme Builder Wizard closes The created theme displays in the Theme Section of the Relationship Layer configuration screen Ranged Color Theme Fact Laver Shot Points Fact Column Whole Ra Function SUM Scheme Quantile Start Color End Color Empty Color 22 Theme Figure 82 Themes Section showing Ranged Color Theme Map Intelligence Client 3 2 3 for Reporting Services Development Guide 94 Figure 83 Region Relationship Layer Map View and Legend showing Ranged Color Theme Manne Ft z atch go n su Figure 84 Radius Relationship Layer Map View and Legend showing Ranged Color Theme Map Intelligence Client 3 2 3 for Reporting Services Development Guide 95 SELECTING HATCHES 1 10 On the Visual Feature options click the Hatches radio button Theme Builder EDEN Class Cout EF Visual Feature Specific Colors Color Range Hatches Border Thickness 1 lt lt Back Save amp Close Next gt gt Figure 85 Theme Builder Wizard Features Tab Numeric Automatic Hatches Features Rendering Attributes On the Hatch Opacity field enter a number from 0 to 1 to indicate the opacity of the hatches On the Border Opacity field enter a number from 0 to 1 to indicate the opacity
16. gt lt f Form lt body gt lt html gt Figure 25 Source Design View Map Intelligence Client 3 2 3 for Reporting Services User Manual 31 15 On the lt title gt tag replace Untitled Page to Crime Analysis and replace the form id with crimeAnalysis as show below s Page Lanquage C AutoEwentWireup true CodeFile Crimedanalysis aspx cs Inherits Crimednalysis 7 lt DOCTYPE html PUBLIC W3C DTD XHTML 1 0 Transitional EN http E lt html xmlns httpiy www Wa org 109997 xhtml gt chead runat server gt lt title gt Crime Analysgsis lt title gt lt head gt lt body gt CGEM La BEINEAPAaLYVS1S runat server gt lt form gt lt body gt lt html gt Figure 26 Replacing the Form Id 16 Copy the following lines and paste it inside the form tag as shown below lt body gt lt form id crimednalysis rung lt Form lt body gt Figure 27 Form Tag ole p aya content gt lt table style width 100 gt Le lt td gt lt asp Label ID lblHeader runat server BackColor RoyalBlue Font Bold True Font Names Calibri Font Size 24pt ForeColor White Text Integeo Demo Crime Analysis Width 100 gt lt asp Label gt lt td gt lt CES lt table gt lt table style width 100 height 100 gt LUES lt td style width 20 height 100 valign top gt lt table width 100 gt ae lt td width 20 gt lt asp GridView ID grdCrimeStatus
17. gt HiddenField Databound 1 FileUpload Databound Wizard aml Multivienw Databound Databound s CHIME TY PE Databound Databound Pana Databound PlaceHolder a DJ view F Error List Ready Figure 28 Design View 18 On the Toolbox expand Data then drag and drop a ReportViewer Control as shown in the next figure Map Intelligence Client 3 2 3 for Reporting Services User Manual 35 Demo Microsoft Visual Studio File Edit View Website Build Debug Format Layout Tools Test Window Community Help rd X Ga A G FH EG bp Debug gt NET gt 8 95 Fa Bon Jsu 2 Z MESSE Se G e Toolbox rax Ped Standard o ooo g Pointer Integeo Demo Crime Analysis ud Gridview F ata PIRUYTYTUS HH Detailsview 7 Databound Fa H Formview Databound ih p z a Repeater Databound J SqlDataSource Lp AccessDataSource ig ObjectDataSource T XmiDataSource EN SiteMapDataSource Reportviewer Databou A i Databound Drop ReportViewer Here i 7 gt E DAY OF WEEK Databound Databound Databound Databound Databound h H CRIMETYPE Databound Databound Databound Databound Databound 4 gt Frem sauce FE P l s r D i Q i gt x 5 m a Error List Ready Figure 29 Adding a ReportViewer Cont
18. Area Group Layer Configure 93 Description 11 Area Group Layer Configuration Copy Layer 125 Data Source Section 95 Delete Layer 126 130 132 133 Edit Layer 125 Layer Properties TypeSection 94 Save Layer 125 Test Settings 125 Area Group Layers Display Information 98 Numeric Aggregation 99 String Aggregation 116 Themes Section 98 Transparent Colors 116 Unshaded Colors 116 Audience 5 Built in Layer 144 Client Configuration Configuration Screen Main Menu 25 Configuration Screens 25 Global Settings 27 Point Layer 35 Color of circular region borders in radius relationship layer 137 Color of hatches on layers 137 Color of region borders 138 Concepts Layer Types 10 Map Intelligence Client 8 Map Intelligence Server 8 The Mapping Viewer 11 What is a Layer 9 What is Map Intelligence 8 Configuration Frames Area Group Layer 93 Relationship Layer 57 Configuration Screens 25 Conventions 6 Coordinate System 144 Data Columns Configure 39 Description 144 End Users 5 Fact Columns Configure 95 Description 144 Global Settings 27 Center Point Coordinates 29 Center Point Section 28 Opening the Configuration screen 27 Preferences Section 30 Save Settings 33 Server Settings Section 27 Styles Section 32 Hatching 144 Map Intelligence Client 3 2 3 for Reporting Services Development Guide 173 Icons 145 Opacity of circular regio
19. BOATA BOATS BOATS BOATS BOATS Figure 105 Color Theme String Colors Map Intelligence Client 3 2 3 for Reporting Services Development Guide 112 HOHE Figure 106 Region Relationship Layer Map View and Legend showing Color Theme String Colors legend FEE l O m LJ E Figure 107 Radius Relationship Layer Map View and Legend showing Color Theme String Colors Map Intelligence Client 3 2 3 for Reporting Services Development Guide 113 SELECTING HATCHES 1 On the Visual Feature options click the Hatches radio button Theme Builder Visual Feature Colors Hatches Hatch Opacity Border Opacity Border Thickness Border Color Hatch Color Figure 108 Theme Builder Wizard Features Tab String Hatches Features Rendering Attributes On the Hatch Opacity field enter a number from 0 to 1 to indicate the opacity of the hatches On the Border Opacity field enter a number from 0 to 1 to indicate the opacity of region borders in the layer On the Border Thickness field enter a number from 0 to 1 to indicate the thickness in points or pixels depending on the GIS provider of the region borders in the layer On the Border Color field enter the hexadecimal color value or select a color from the color picker for the region border color The default color is black 000000 On the Hatch Color field enter a hexadecimal color value or select a co
20. Enter a threshold value in the top field Click the rectangle next to the field Select a hatch from the picker that you want to associate with the threshold value The selected threshold value and associated hatch displays in the preview window list Map Intelligence Client 3 2 3 for Reporting Services Development Guide 104 11 Configure all other threshold conditions that you wish to associate with a hatch 12 Click the Values Outside Threshold rectangle then select a hatch from the picker to represent any other values that have not been assigned a specific hatch 13 Click the Empty Values rectangle then select a hatch from the picker to represent any region or circle that does not contain any values 14 To delete values assigned to a specific color in the Preview window list click the check box next to the value and click Remove Selected fx Theme Builder Values Outside Threshhald Empty lt Back Save amp Close Next gt gt Figure 97 Theme Builder Wizard Configure Tab Numeric Manual Hatches Map Intelligence Client 3 2 3 for Reporting Services Development Guide 105 Save amp Close 15 Click FH Save 8 close The Theme Builder Wizard will close The created theme displays in the Theme Section of the Relationship Layer configuration screen Hatch Theme Fact Laver Shot Points Fact Column Whole Kg Function SUM lt 1000 lt 3000 lt 5000 lt 10000 Outside Threshold Emp
21. If Next Return sb ToString Catch ex As Exception Return GetExceptionMes sage ex End Try End Function REPORT OBJECT using System using System Data using System Configuration using System IO using System Text using System Web using System Web Security using System Web UI using System Web UI WebControls using System Web UI WebControls WebParts using System Web UI HtmlControls using Microsoft Reporting WebForms using System Web Services Protocols lt summary gt Summary description for ReportingObject lt summary gt public class ReportingObject public ReportingObject lt summary gt Map Intelligence Client 3 2 3 for Reporting Services Development Guide 166 This Method is used for rendering a report lt summary gt lt param name reportViewer gt lt param gt lt param name param gt lt param gt public static void RenderReport ReportViewer reportViewer ReportParameter param string url ConfigurationManager AppSettings REPORT SERVER Uri reportServerURL new Uri url try reportViewer ShowCredentialPrompts true reportViewer ServerReport ReportServerCredentials new ReportCredentials Username Password reportViewer ProcessingMode ProcessingMode Remote reportViewer ServerReport ReportServerUrl reportServerURL reportViewer ServerReport SetParameters param reportViewer ServerReport Refresh
22. Intelligence Client 3 2 3 for Reporting Services Development Guide 155 ADVANCE TOPICS AUTO PILOT MODE The Auto Pilot Mode APM controls some of the Map Intelligence Tools depending on the document being manipulated by the Client For example based on the name of a business intelligence document a Layer Designer can control what plugins must be excluded what plugins must be deactivated and what plugins must be activated and how An excluded plugin will not even appear in the list of plugins usually visible when the user clicks the Tools menu button in the Map Intelligence Mapping Viewer Auto Pilot mode requires some programming and access to the Map Intelligence server Further Information relating to Auto Pilot Mode can be found in the Auto Pilot Mode in Map Intelligence Technical Note INDEPENDENT MAPS AND LEGENDS This section explains how to extract components of the Map Intelligence GUI and display them separately within an Map Intelligence Client for Reporting Services MIRS and retrieve printed images based on print templates MAPS Independent maps can be retrieved as images and they are also implemented as tags that can be embedded in jsp s They can also be invoked directly from an HTML request Using the tag method the map can be requested as an image only or it can be interactive IMAGES The following parameters are available userid The id of the user that defines the users session Yes Determ
23. Microsoft Office Tools Outlook 6 0 0 0 we O 50727 CinProgram Files Common Files Microsoft Shared STOS OMicrosofk Office Tools Qutlook dll Microsoft Office Tools Word 6 0 0 0 ve 0 50727 C Program Files Common Files Microsoft Shared STOS OMicrosoft Office Tools Word dll Microsoft Reportviewer Common 6 0 0 0 ve 0 50727 CAProgram Files Microsoft Visual Studio 6 Reportviewer Microsoft Reportviewer Common dil Microsoft Reportyiewer Common 9 0 0 0 v2 0 50727 CiiProgram Files Microsoft Visual Studio 9 0 Reportviewer Microsoft Reportyiewer Common dll G R d ne H epg JEE il nora ile gl 150 0 osork Yisua Studio Repo we 0 50727 C padra Files Microsoft visual Studio 9 0 Reportviewer Microsoft Reportvienier WinFOrnE dll we O 50727 CiiProgram Files Microsoft SOL Server 100 D7S Tasks Microsoft Sglserver actives ScriptTask dll ve 0 50727 CiiProgram Files Microsoft SQL Server1 00 075 Tasks Microsoft Sqierver 45 Tasks dll Microsoft SqlServer BulkInsertTask v2 0 50727 CiiProgram Files Microsoft SQL Server1 00 075 Tasks Microsoft Sqlerver BulkInsertTask dll Microsoft Sqlserver ConnectionInfo ve 0 50727 C Program Files Microsoft SQL Serverl100 50K4ssemblies Microsoft SqlServer ConnectionInfo dil Microsoft Sqlserver ConnectionInfoExtended 10 0 0 0 we O 50727 C Program Files Microsoft SQL Server11001SDK ssemblies Microsoft SqlServer ConnectionInfoExten Microsoft P O
24. OM x M LUP gt lt P 4 b EREET rem sea fy Error List Ready Figure 16 Adding a new class 6 On the Add New Item window select Class then on the Name text box enter ReportCredential cs then click the L ss fon as show on the following figure Map Intelligence Client 3 2 3 for Reporting Services User Manual 21 Add New Item C3NRSIntegeovDemos oo E BB o n Templates isual Studio installed templates c B Text File aj DataSet aaj Re JE Class Diagram My Templates Search Online Templates n empty class declaration Name ReportCredentials cs Language visual CX j Place code in separate file r Select master page Am cae Figure 127 Add new item Window 7 Once the ReportCredentials cs has been added to the application the following lines of codes must be added to the class using System using System Data using System Configuration using System Web using System Web Security using System Web UI using System Web UI WebControls using System Web UI WebControls WebParts using System Web UI HtmI Controls lt summary gt Allows applications to provide credentials for connecting to a Reporting Services report server lt summary gt Serializable public sealed class ReportCredentials Microsoft Reporting WebForms ReportServerCredentials string _userName _password _domain lt summary gt
25. Select a color to indicate value less region and click OK Mote The colored rectangles change to the new color after each selection If the color picker does not have the preferred color right Click the colored rectangle and manually enter the Tip hexadecimal color value Theme Builder 5 Contigure Class 1 Class 2 Class 3 Class 4 Empty Color lt Back Save amp Close Next gt gt Theme Builder Wizard Configure Tab Numeric Automatic Specific Colors s amp Clo 12 Click FH save amp close The Theme Builder Wizard closes The created theme displays in the Color Theme section of the Area Group Layer configuration screen Map Intelligence Client 3 2 3 for Reporting Services Development Guide 129 Color Theme Fact Column Function scheme Class 1 Color Class z Color Class 3 Color Class 4 Color Empty Color Figure 128 Themes Section showing Specific Color Theme atch by half degree Figure 129 Area Group Layer Map View and Legend showing Specific Color Theme Map Intelligence Client 3 2 3 for Reporting Services Development Guide 130 SELECTING COLOR RANGE 1 10 11 12 On the Visual Feature options click the Color Range radio button Theme Builder 4 Features Scheme Quantile Class Cout 4 EF visual Feature Specific Colors Color Range Hatches Fill Opacity Border Opacity Border Thickness 1 zl lt lt Back Sav
26. Services Development Guide 151 DELETING A LAYER gt To delete an Area Group Layer 1 Onthe Layer Directory expand the Area Group Layers folder to view the layer list 2 Click the Area Group Layer to delete The layer configuration screen displays ha 3 On the Main Menu click Delete I 4 Click aaa to save the settings r Mote Clicking the Save button saves all the changes made to all configuration screens Note on Data Format Map Intelligence by default places commas in numbers greater than 999 The format can be changed by specifying the column format in the universe This only applies to columns with numeric values Map Intelligence Client 3 2 3 for Reporting Services Development Guide 152 TROUBLESHOOTING The following discussion presents the solutions to issues that may be encountered when using the Map Intelligence Client for Reporting Services CLIENT CONFIGURATION SERVER LOGIN ISSUES Problem Description Solution s gt Check if the SQL Server and SQL Server Reporting Services are already running Invalid login password server combination When logging in to the Client Configuration Server this message immediately displays even when the credentials entered are correct Check if the user logged in is included in the security The user is successfully logged in but there are no report items group user of the Reporting Services on the left panel of the Client Configurati
27. Wizard closes The created theme displays on the Theme Section of the Point Layer configuration screen Map Intelligence Client 3 2 3 for Reporting Services Development Guide 68 Themes Multiple Shape Icon Theme Theme 2 Column Common Mame Shape circle Arrow Squid Cuttlefishes J Flathead Jackass Marwan a Latchet Ocean Perch J Figure 45 Themes Section showing Multiple Shape Icon Theme Theme 2 O DDATA PETATE z TEDATA SECR one CERT EEN SEER ETE eloke D SEIT eg Boat e e i CI BAT Eee Figure 46 Map View and Legend showing the Multiple Shape Icon Theme we can see here that the Shot Points are themed according to the type of fish caught using the circle shape and the color assigned to each fish type Common Name Creating a Single Image Icon Theme 1 Click The Theme Builder Wizard displays with the Theme Type tab open by default Map Intelligence Client 3 2 3 for Reporting Services Development Guide 69 2 On the Theme Type drop down list select Single Image Icon Theme Builder 1 Theme Type Theme Type Single Image Icon lt lt Back Save amp Close Next gt gt Figure 47 Theme Builder Wizard Theme Type Single Image Icon 3 Click the Configure tab or the Next button The Configure tab opens 4 Select an Image from the bottom images list box A red square indicates the current selection
28. a themes based ona String Aggregation _ a Theme s 1 Click The Theme Builder Wizard displays with the Theme Type tab open by default 2 The Fact Column drop down list displays the previously selected column on the Area Group Layer configuration screen To change the column select the another column from the Fact Column drop down list Any changes to the Fact Column through the Theme Builder Wizard are reflected in the Fact Column field of Wote the Area Group Layer configuration screen Map Intelligence Client 3 2 3 for Reporting Services Development Guide 142 3 On the Data Type options click the Strings radio button Theme Builder 1 Theme Type Fact Column Data Type Numeric String lt lt Back Save amp Close Next gt gt Figure 147 Theme Builder Wizard Theme Type Tab String 4 Click the Data tab or the Next button The Data tab opens Map Intelligence Client 3 2 3 for Reporting Services Development Guide 143 5 Onthe Aggregation Function drop down list select the function to use for the layer The string functions available are Most Common Uniform and Majority Theme Builder lt lt Back lo Save amp Close Next gt gt Figure 148 Theme Builder Wizard Data Tab String with Most Common selected 6 Click the Features tab or the Next button The Features tab opens 7 On the Visual Feature options select the color mode rd Note Ther
29. aaa idiei 49 SON EE N A A A E N E NN E IAY EENAA AA A T TETA 49 Onea n ENE u uu AEA R 49 Configuration Screen Main Me enu u a i la qssasssskkaslusstaqasassssasakhasqawaassasayka 49 Global SetlIlnB Ba uu nsasanuuaassaumasaqasaaaaa awawawasapukusaaqkaawqusasqaaaqipaqqaqapasawawsaqawqasqassawcuqnaqutaa wanwa 51 Map Intelligence Layers 58 CAG V LOSS ui usu Sua anette teeta aioe ene Su s au BEES 58 EV I TPI C 5 5 ece rec rr etter er tr ere u a eure mnt ne 5 sa 58 RPM ch aoc ae ua 2 na ata av a clasts DE LER EE Ser dbid 59 Conipure B elati6 shfii Lavere Ree uu u Ame na Cn ne en ne 81 Map Intelligence Client 3 2 3 for Reporting Services User Manual Configure Area Group Layers ccsscsssssnsscavscasssnassaeccasccnssnnesenssancsasescausencsaecscceaaeeassaessnscanes 119 Fe SHOOTIN u uuu E aadanise EET ET Eee 153 CLIENT CONFIGURATION SERVER LOGIN ISSUES 153 GLOBAL SEP UNG ISSUES cuss aa EA 153 LATER SPS SEE stoned suonedeacnccacecerenncssouscnsastpoatensesctunnborcaeseoessnsnsscinnssataaueceneocestetaccenseneusrncueee 153 MAP RENDERING ISSUES ll ta l uuu R 155 ADVANCE TOPICS u A E E 156 AUTO PILOT MODE coiis aiai 156 INDEPENDENT MAPSAND LEGENDS L l s l p EA qasaqa 156 PPE EPIDI EE E m ashaka maa 160 Appendix A Client
30. change the theme displayed on the map A number of tools are also available from the Mapping Viewer that allows you to perform high level analysis Map Intelligence Client 3 2 3 for Reporting Services User Manual 11 LINKS TO MAP INTELIGENCE CLIENT FOR REPORTING SERVICES MIRS The following are the ways by which the link to the MIRS can be created 1 creating a link through the Report Manager 2 embedding the map reportin an ASP net page The following sections are dedicated to the procedural discussions of these methods LINK IHROUGH REPORT MANAGER 1 Create a Report project and set up a connection to the data source 2 Goto Report gt Report Properties The Report Properties window displays 4 Integeo Demo Reports Microsoft Visual Studio File Edt View Project Build Debug Format Report Tools Test Window Help il J 2 E 2 Sa m o o Ariz E3 2 BOG D D a EE 100 pil Yew Add Page Header u Add Page Footer Ruler Grouping Crime Type By Day of Week Crime By Day of Week a Week A oO Day of Week F GO gt Day of Week B i D EHE Day of Week E Day of Week C Day Day Day Day Day of Day of Week D of of of of Week Week Week Week Week A B C o E E J CrimetypeA E 1 Crimetype B Crimetype A Crimetype B Total Crimes Band Day_of_ Week Sum incidents IEC ze YPJ i Help make Microsoft SQL Server 2008 better x i auso Participate In the Customer Experience Improvement Progra
31. class that will handle the report and map rendering On the Solution Explorer right click on the App_Code folder and click on iia Add New Item On the Add New Item window select Class and on the Name text box enter ReportingObject cs then click L add 9 Onthe Solution Explorer right click on the Website and click on ele Bere eich On the Add OK Reference window scroll down on the list and select Microsoft ReportViewer WebForms and click w as shown on the following figure Map Intelligence Client 3 2 3 for Reporting Services User Manual 23 Add Reference ra 1 gt NET com Projects Browse Recent Microsoft Office Interop Excel 10 0 450 v1 0 3705 C Program Files MicroStrategy Office Microsoft Office Interop Excel dll Microsoft Office Interop OW 10 0 450 v1 0 3705 CilPrograrm Files MicroStrategy Office Microsoft Office Interop OWC dll Microsoft Office Interop PowerPoint 1D 0 450 v1 0 3705 Program Files MicroStrategy Office Microsoft Office Interop PowerPoint dil Microsoft Office Interop Word 10 0 450 v1 0 3705 Ci Program Files MicroStrategy Office Microsoft Office Interop Word dll Microsoft Office Tools Common 8 0 0 0 vz 0 50727 C Program Files Common Files Microsoft Sharediy STOS 0i Microsoft Office Tools Common dll RI Microsoft Office Tools Excel 6 0 0 0 ve 0 50727 C Program Files Common Files Microsoft Shared STOS OMicrosofk Office Tools Excel dll
32. data source data set is a stored procedure and it requires an input parameter s 1 define a default value for the parameter s 2 set the get default value property in client properties file to true Refer to the client properties section for more information The server must be restarted to apply the changes in client properties If no data is returned even if the default values for the parameters are already configured and the get default value property is set to true check if the report parameter property allows null value The query could be returning a blank null default value Check the test max rows and the max rows properties in the client properties file These properties limit the 1 number of retrieved records to the Reporting Services Server and 2 number of data to be displayed in the Theme Builder respectively Refer to the client properties section for more information Map Intelligence Client 3 2 3 for Reporting Services Development Guide 154 MAP RENDERING ISSUES Problem Description Connection refused connect This message displays on the Mapping Viewer Checksum failed The map is not visible or there are no rendered points in the map This message displays when the red exclamation point is clicked Layer lt layer name gt had an invalid value lt value gt in column lt column name gt Failed to generate a map error loading data source null This m
33. en mr pe F SA ee SS PF mA H H k wt na be i i oe FS Ps 1 Teeter Ps Sas T Siir 5 a Il REE li Fs r ens spm i eT 5 Tale eK a a m ba pe s ft Hite _ 504 We u A oe Te T e a i L k a AESI Es STS Figure 59 Map View and Legend showing the Auto Classification Theme we can see here that the Shot Points are themed according to the Whole Kg range they fall into for example all shot points with a catch less than 22 Kg are shown with a red star DEFAULT THEME The default theme is the theme that is first used when the Mapping Viewer is initially accessed This is the most recently created theme To edit a theme 1 Select the theme from the theme list then and click The Theme Builder Wizard displays Lal Save amp Close 2 Do the necessary changes and click The wizard closes gt To delete a theme 1 Select the theme from the theme list then and click lt This completes all the theme options available for point layers Map Intelligence Client 3 2 3 for Reporting Services Development Guide 78 TO TEST YOUR SETTINGS To test the Point Layer configuration kw Test 1 On the Main Menu click A browser opens displaying the layer configuration Note that tested layers are automatically added on the layer list in Layer Directory SAVING THE LAYER To save the Point Layer configuration i Save 1 On the Main Menu click ave to sa
34. l Vandalism i pelang N aa A ssault kj AK Theft e PS aa TIG T ad A ETN Theft thet wnat eet ie eee ea Bsa p Reserve ha 7 oer i v i be Fai TURE Singapore Strait Figure 33 Sample Asp Net with Report and Embedded Map Viewer Map Intelligence Client 3 2 3 for Reporting Services User Manual 41 CLIENT PROPERTIES The client properties file contains some properties for the MIRS configuration application To update locate this file through install dir tomcat webapps miclient WEB INF properties client Make sure to restart the MIRS Configuration Server to apply the changes made 1 Open the client properties file D client properties Notepad Fk Edt Format View Heb PTT77T77T77777777TTTTTT7TT7T777777777777777777777777777777777777777777 Client implementations can add properties here and read them by calling Client getProperties FEREEBEREREOBEREREREEREREREERERERERBEREREREERTRERBEREREREERERTR EE The class that extends com integeo eapIntelligence client wrapper clienct java eclient com Ha r ee TOONER CI TONE ROVE LENE client 4u com clientimp client com integeo mapIntel ligence client RSclient set this t true if the request file should be deleted after each request remove request Tile false set this to true if the request should use a splash screen This can potentially make requests slower but should be used if there are java
35. layer configuration displays 4 On the Layer Name field type the title of the layer 5 Click saa to save the settings The new layer appears on the Layer Directory Mote Clicking the Save button saves all the changes made to all configuration screens DELETING A LAYER To delete a Relationship Layer 1 On the Layer Directory expand the Relationship Layers folder to view the relationship layer list 2 Click the Relationship Layer to delete The layer configuration displays hara 3 On the Main Menu click Delete i A Click o Save Mote Clicking the Save button saves all the changes made to all configuration screens Note on Data Format Map Intelligence by default places commas in numbers greater than 999 The format can be changed by specifying the column format in the universe This only applies to columns with numeric values Map Intelligence Client 3 2 3 for Reporting Services Development Guide 118 CONFIGURE AREA GROUP LAYERS 2 To open the Area Group Layer configuration screen 1 Click Area Group Layers _ The Area Group Layer configuration screen displays 2 Click Ld ii The fields are cleared for new input Area Group Layers Cdnew Copy Save jo Delete f j Test Report Fisheries Training John Brown 8981 Sd set layer as visible in map Ed Enabte Popups Figure 113 Area Group Layer configuration screen LAYER PROPERTIES SECTION 2 To configure
36. test the Area Group Layer configuration f Test 1 On the Main Menu click A browser opens to display the layer configuration Note that tested layers appear on the layer list in the Layer Directory SAVING THE LAYER To save the Area Group Layer configuration 1 On the Main Menu click to save the layer settings The layer appears n the Layer Directory F Mote Clicking the Save button saves all the changes made to all configuration screens EDITING A LAYER 2 To edit an Area Group Layer configuration 1 On the Layer Directory expand the Area Group Layers folder to view the layer list 2 Click the Area Group Layer to edit The layer configuration screen displays for editing I Save 3 On the Main Menu click AWE to save the layer settings F Mote Clicking the Save button saves all the changes made to all configuration screens COPYING A LAYER gt To copy an Area Group Layer 1 On the Layer Directory expand the Area Group Layers folders to view the layer list 2 Click the Area Group Layer to copy The layer configuration screen displays 3 On the Main Menu click I 1Gopy The copied layer configuration displays 4 Onthe Layer Name field type the title of the layer 5 Click iia to save the layer settings The new layer displays on the Layer Directory Clicking the Save button saves all the changes made to all configuration screens Note Map Intelligence Client 3 2 3 for Reporting
37. the center point at which you wish the map to be initially displayed Map Intelligence Client 3 2 3 for Reporting Services Development Guide 53 Center Point Default Coordinates i Address Map Width Km 4 Street 1 Fish Market Avenue Suburb Adelaide state 4 Post Code Figure 26 Center Point Section Address Option PREFERENCES SECTION The Preferences section allows you to configure properties of the Mapping Viewer gt 5 To configure the Preference Section Select the Units radio button for the measurement that you would like to use for your analysis Imperial miles feet Metric kilometers meters On the 1st Delimiter drop down list select a character to act as a separator for your data as it is sent to the Map Intelligence Server On the 2 Delimiter drop down list select a second character to act as a separator for your data as it is sent to the Map Intelligence Server The delimiter characters act as a separators for your data as they are sent to the Map Intelligence Server The Wote Characters that do not exist within the data to avoid errors must be selected The default character for the 1 Delimiter is y and the default character for the 2nd Delimiter is b On the Extent Lock drop down list select an the extent lock option Mote The Extent Lock determines the map extent to be used when a user makes a new map request from the client The lock extent options are li
38. the configuration server LOOK AND FEEL To obtain the desired look and feel of the independent legend refer to the Technical Note Legend Customization Map Intelligence Client 3 2 3 for Reporting Services Development Guide 158 PRINTED IMAGES The results of printing with a print template can be returned as an image For details on what print templates are and creating them see the technical note on Creating a Print Template The following parameters are available The id of the user that defines the users session template The name of the print template to use x ooo Custom parameters defined in the template can be passed by prefixing their parameter names with _p The client retrieves a print template image by contacting the configuration server The following url will retrieve a legend http machine name pot number miclient getPrintTemplate Example To request the default print template image and pass the custom parameters w and h the following url would be used lt img src http machine name port number miclient getPrintTemplate 2 userid 123456 amp template default amp p w 400 amp p h 400 alt legend gt where the machine name and port number are those of the configuration server Map Intelligence Client 3 2 3 for Reporting Services Development Guide 159 APPENDICES APPENDIX A CLIENT METHODS There are two methods available for sending requests from the Business Intelligen
39. top drop down list Select a color from the color picker to associate with the selected value The selected value and associated color displays in the preview window list Map Intelligence Client 3 2 3 for Reporting Services Development Guide 145 If the color picker does not have the preferred color right Click the colored rectangle and manually enter Tip the hexadecimal color value instead 10 Configure any other values that you wish to associate with a color P Any values not assigned a specific color will be colored according to the color assigned to Other Values see Note below 11 Click the Empty Values rectangle and select a color from the color picker to represent any value less region 12 Click the Conflict Values rectangle and select a color from the color picker to represent any region that does not meet any specified condition e g a conflict condition will be returned if the Uniform function has been set and there is more than one type of value present in the region 13 Click the Other Values rectangle and select a color from the color picker to represent any values that have not been assigned with a specific color Theme Builder r F boarte r JBE eoan r L pears Remove Selected Empty Values Conflicting Values Other Values lt lt Back save amp Close Next gt gt Figure 150 Theme Builder Wizard Configure Tab String Colors 14 To delete val
40. will use the default value of the report parameter when retrieving data from the Report Server Mote This is applicable only during design time or configuration creating a map template 8 Settest max rows to a value corresponding to the number of rows data to be used when rendering the map during the design time or configuration P A value of zero means that the application will retrieve all the data This property affects the max rows Mote property in which the lesser the test max rows property the lesser the data retrieved Hence a smaller number of distinct values will be displayed 9 Set render max rows to a value corresponding to the number of rows data to be used when rendering the map during runtime BI Server Report Server requesting the map 10 Set reporting services version to version of the Report Server to be used Map Intelligence Client 3 2 3 for Reporting Services User Manual 43 Nate Versions 2005 and 2008 are currently supported If reporting services version is unspecified default is the 2005 version For optimum performance specify the exact version of the Report Server UPDATE THE SQL REPORTING USER NAME AND PASSWORD IN CONFIG PROPERTIES In case you need to replace the SQL Reporting user name and password in config properties _ USING THE COMMAND PROMPT 1 Open the command prompt on the MI Client for Reporting Services and change the directory to tomcat bin c C WINDOWS system32 c
41. 2 3 for Reporting Services User Manual 30 13 On the Add New Item window click on Web Form as shown on the following figure Add New Item C RSIntegeo Demo and on the Name field enter CrimeAnalysis and click Templates Visual Studio installed templates E _ Master Page Web User Control HTML Page wi Web Service at Class AJ Style Sheet Global Application Class op Web Configuration File AML File H ML Schema Text File faa Resource File T SOL Database a DataSet s Generic Handler 28 Site Map 2 Crystal Report mf Mobile web Form L VBScript File Ej Report JScript File Ef Mobile Web User Control Mobile Web Configuration File JF XSLT File cay Skin File D Browser File E Class Diagram My Templates 1 merr ee ed L T a A 4 Form For web Applications Name Crime nalysis Language visual cot Z Place code in separate file Select master page Figure 24 New Item Window 14 On the Solution Explorer double click on the CrimeAnalysis aspx and it should give you the following design source view ea Fage Lanquage C AutoEventWireup true CodeFile Crime nalygisg asbx cs Inherits Crimednalysis lt DOCTYPE html PUBLIC W3c DTD KHTML 1 0 Transitional EN http El lt html xmlnsg htth www Wi org 19997 xhtml gt lt head runat server gt lt title gt Untitled Page lt title gt lt head gt lt body gt storm Lo Loril runat server
42. 3 for Reporting Services User Manual 13 On the report layout add a textbox that will serve as a link to the to the Mapping Viewer ida Eh CE Bresrorrsnrrer serrerernorvvmrrensrvensormenreneseeseoomocorereserell View Crime Map 88 Crime By Day of Week Figure 8 Drag textbox to the Report Layout 6 Right click the textbox and select Text Box Properties 7 Onthe Text Box Properties window click Action Map Intelligence Client 3 2 3 for Reporting Services User Manual 14 8 Select hyperlink option Go to URL Text Box Properties General Change hyperlink options Number Alignment Enable as a hyperlink ae O None O Go to report Go to bookmark G Go to URL Border Fill Visibility Interactive Sort Select URL Expression button Figure 9 Textbox Properties Action Setting 9 Click the Expression button adjacent to the Select URL field Map Intelligence Client 3 2 3 for Reporting Services User Manual 15 10 On the Expression dialog call the GetMaplntelligenceURL function and indicate the parameters Expression a 5 x Set expression for Value Lode GetMapintelliqenceURhe crimeType status Categon Constants Ho constants are available for this Built in Fields property Parameters Fields Emple adaList Datasets H Variables E Operators E Common Functions x Figure 10 Calling Custom Code Funct
43. 36 Themes Section showing Hatched Theme Map Intelligence Client 3 2 3 for Reporting Services Development Guide 135 risi nga esac EEH lt 7 672 00 lt 6 309 00 lt 27 085 00 gt 22 085 00 Figure 137 Area Group Layer Map View and Legend showing Hatched Theme MANUAL METHOD 1 On the Method tab click the Manual radio button xx Theme Builder x 3 Method Theme Method Automatic amp Manual lt Back Save amp Close Next gt gt Figure 138 Theme Builder Wizard Method Tab Numeric Manual 2 Click the Features tab or the Next button The Features tab opens ee a Map Intelligence Client 3 2 3 for Reporting Services Development Guide 136 3 Onthe Visual Feature options select the color mode rd The are two 2 options for selecting the Visual Feature Mote Colors use to specify a particular color Hatches Use to specify a particular hatch SELECTING COLORS 1 On the Visual Feature options click the Colors radio button Theme Builder Visual Feature Colors Hatches Fil Opacity lt lt Back Save amp Close Next gt gt Figure 139 Theme Builder Wizard Features Tab Numeric Manual Colors Features Rendering Attributes 2 On the Fill Opacity field enter a number from 0 to 1 to indicate the opacity of the colored regions inthe layer 3 On the Border Opacity field enter a number from 0 to 1 t
44. BOE PWs WinForms Microsoft Sqherver activexScriptTask Microsoft SglServer 457 asks Microsoft SoglServer Omf 10 0 0 0 we 0 50727 C Program Files Microsoft SOL ServerY100YVSDKYVAssernbliesYiMicrosoFt Sq 5Server DrnF dll Microsoft Sqlerver Omf adapters 10 0 0 0 ve S0727 CAProgram Files Microsoft SQL Server 100 50 4ssemblies Microsoft SqlServer DmF adapters dll Mirna Ek Calo eee Pinball sere moon r ri Co r Aria Dilah Mirenen Ek Srl C u iu Lahore A ra bhai hienen FE Callan ie Pie bo abode sere dl 4 P Figure 149 Add Reference Window 10 In the Solution Explorer double click on Web Contig On the Web Config Add a section for the appSettings as shown in the figure below rr t lt sectionGroup name system web extensions type System Web Configuration sSystemWebExtensionssSectionGroup System Web Extensions Version 1 0 lt sectionGroup name scripting type System Web Configuration ScriptingsectionGroup system Web Extensions Version 1 0 61025 0 Culture ne lt section name scriptResourceHandler type System Web Configuration ScriptingsScriptResourceHandlerSection System Web Extensions Vers lt sectionGroup name webServices type System Web Configuration ScriptingWebServicesSectionGroup System Web Extensions Version 1 0 6102 lt section name jsonSerialization type System Web Configuration ScriptingJsonSerializationSection System Web Extensions Version 1 0 lt section name profileSe
45. Development Guide 125 Note that only one color and one hatch layer can be displayed simultaneously for a particular built in layer If you have multiple layers that use the same built in layer you can switch between these using the Theme Select option from the Mapping Viewer refer to the Map Intelligence Mapping Viewer User Manual Note Theme Builder aaa EGN by Calculation by Value Percentage lt lt Back Save amp Close Next gt gt 7 Click the Method tab or the Next button The Method tab opens 8 On the Theme Method options select mode of applying themes Mote There are two 2 methods for applying themes Automatic m Manual Map Intelligence Client 3 2 3 for Reporting Services Development Guide 126 AUTOMATIC METHOD 1 Onthe Theme Method options click the Automatic radio button Theme Builder Theme Method Automatic Manual lt Back Save amp Close Next gt gt Figure 126 Theme Builder Wizard Method Tab Numeric Automatic 2 Click the Features tab or the Next button The Features tab opens 3 On the Scheme drop down list select a classification scheme The standard classification scheme can be used to group similar values in looking for patterns in the data Note There are three 3 schemes for grouping data values into classes based on how the data values are distributed qual Interval The difference between the high and lo
46. Deviation Features are placed in classes based on how much their values vary from the mean First the mean and standard deviation of the data values are calculated The class breaks are found by successively adding or subtracting multiples of the standard deviation from the mean Map Intelligence Client 3 2 3 for Reporting Services Development Guide 89 4 Onthe Class Count drop down list select the number of colors to appear in your shading range P f Equal Interval scheme is selected on the Scale options click either the Linear or Logarithmic Note radio button f Standard Deviation scheme is selected on the Std Deviation Multiplier field type the multiplying factor 5 On the Visual Feature options select color mode f There are three options for selecting the Visual Feature Mote Specific Colors Allows you to specify a particular color for each class Color Range Allows you to choose a start and end color Hatches Allows you to specify a particular hatch for each class SELECTING SPECIFIC COLORS 1 On the Visual Feature options click the Specific Colors radio button Theme Builder Visual Feature Specific Colors Color Range Hatches Fil Opacity Border Opacity Border Thickness 1 lt lt Back Save amp Close Next gt gt Figure 75 Theme Builder Wizard Features Tab Numeric Automatic Specific Colors Features Rendering Attributes 2 On the Fill Op
47. In this environment a user can easily discover previously hidden information and data relationships Map Intelligence reduces the time needed to develop the applications from weeks and months to days and hours In many cases organizations have given up before solving the technical challenges that Map Intelligence solves Using web services from the vast range of online statistical and business information an organization s in house data can be quickly easily and dynamically augmented and enriched with geographical and satellite imagery Available services include census demographic and health data climatic hydrological and geological data Map Intelligence has two principal components THE MAP INTELLIGENCE CLIENT FOR REPORTING SERVICES MIRS The Map Intelligence Client for Reporting Services MIRS includes a number of configuration screens that enable you to design your mapping application Using the MIRS you select the underlying map you want to use specify the look and feel and build the different Map Intelligence layers to be used in your analysis Once this has been done your application is finished and in operation The MIRS sends a request to the Map Intelligence Server to display your application in a web browser THE MAP INTELLIGENCE SERVER AND BROWSER MAPPING VIEWER The Map Intelligence Server is the powerhouse behind the mapping application you designed using the MRS It processes all the information sent from the MIRS
48. Last Fall in Barcelona Spain two PM s from the C team gave talks on key parts of the new LINQ technology Found in Visual Studio 2008 Heroes Happen Here Wed 27 Feb 2008 10 05 10 0800 Welcome to the launch of Windows Server 2008 Visual Studio 2008 and SQL Server 2008 Together these three products provide a secure and trusted platform For building your most mission critical applications Learn more about these products and launch events in your area at HeroesHappenHere com Why Do Initializers Run In The Opposite Order As Constructors Part One Wed 19 Mar 2008 15 04 27 0700 Learn about the order in which constructors are called in class hierarchies that use inheritance Why Do Initializers Run In The Opposite Order As Constructors Part Two Wed 19 Mar 2008 15 03 58 0700 Learn more about the order in which constructors are called in class hierarchies that use inheritance Community Convergence XLI Wed 19 Mar 2008 15 03 57 0700 Links to various posts written by the C Team and related news We have moved Future Focus our peak at features that might appear in the next version of Visual Studio to the Code Gallery Future Focus II Call Hierarchy Wed 19 Mar 2008 15 03 56 0700 The success of the first Future Focus post has made it easy for us to continue sharing our plans For the future This month we switch our focus to the Visual Studio IDE as we investigate a new Feature named Call Hierarchy New and Updated Live API s for We
49. Map Intelligence Client User Manual for Microsoft Reporting Services pitney bowes Map Intelligence Client 3 2 3 for Reporting Services User Manual INTER OD BEEN SEE EEN u a sa 2 2 nasua 5 5 PUIDO E u uum aaa R numas sapapakaikasmaasanawasaasqassuaawananaaaaaasasaapanwashaksasasiappana 5 FANE Fo TET CG uuu s aa S u ES DEDE E SE uu A AE a ua 5 LO lli S nan tdadatmcawaensana EET O a 6 PROCS IS uu caacnc ea cateies EDER AAS 7 CONCEPT u uuu A 8 What is Map i tellipBejiceyuu ul aaa apasha Quawiasauataqasqkaqaqpasqassapasasssaqassawaksyaqaqa 8 The Map Intelligence Client for Reporting Services MIRS 8 The Map Intelligence Server and Browser Mapping VIQCWEL ccccsscccseceeseeeesceeeceeneeeeeeeaness 8 MP Tea Wey eh r u a i L n s 9 L TL TI nA AE 10 What is a Mapping Viewer ssssessssseessresrrrerrssrrsrerrrrsrensrrrserssersrrsrresersrerseesrerereeseessersrereeeseesse 11 LINKS TO MAP INTELIGENCE FOR REPORTING SERVICES MIRS 12 LINK THROUGH REPORT MANAGER 12 EMBED MAP AND REPORT in ASP NET PAGE 18 ACCESSING THE MIRS CONFIGURATION APPLICATIOLNN 47 MIRS CONPIGURATON uuu a a uk
50. Methods 160 Appendix B Features Rendering Attributes 162 Appendix C SAMPLE CODES au usai aiyakhiqiuaepasnekssatusakapapawawawawsaipuqawawqapasasaqa 165 ae SEE u m Q nn zs E A u u 170 MDE A Susan S S Z S nD S S SEES STR Fred 173 Map Intelligence Client 3 2 3 for Reporting Services User Manual INTRODUCTION PURPOSE This manual provides information about the Map Intelligence Client 3 2 3 for Reporting Services MIRS It explains the processes required for the developers to integrate Reporting Services to Map Intelligence Spatial Server AUDIENCE The effective use of Map Intelligence involves a number of separate processes which can be performed by different user groups The user groups involved are described below LAYER DESIGNERS Layer designers are responsible for configuring the Map Intelligence layers that are displayed on the Mapping Viewer Layer Designers are also responsible for configuring the settings for the Map Intelligence Server as well as the properties of the underlying map to be used for the analysis This user group should have a firm understanding of the spatial analysis required Layer designers are advised to read all sections of this manual END USERS End Users are users who want to view the configured layers on a map Th
51. ORDERS IN RADIUS RELATIONSHIP LAYER A number from 0 to 1 that indicates the opacity of all the circular region borders in a radius relationship layer Figure 171 Border opacity set to 1 Figure 172 Border thickness set to Figure 173 Border thickness set to 0 5 0 2 COLOR OF CIRCULAR REGION BORDERS IN RADIUS RELATIONSHIP LAYER The RGB setting for the border color as a six hexadecimal digit 3 byte number representing Red Green and Blue The default value is Black 000000 Figure 174 Border color set to Red Figure 175 Border color set to Blue Figure 176 Border color set to Yellow FFOOOO OOOOFF FFFFOO THICKNESS OF CIRCULAR REGION BORDERS IN RADIUS RELATIONSHIP LAYER The thickness in points or pixels depending on the GIS provider of the circular region borders as a positive integer Map Intelligence Client 3 2 3 for Reporting Services Development Guide 163 Figure 177 Border thickness set to 5 Figure 178 Border thickness set to 3 Figure20179 Border thickness set to 1 USE MAP BORDER ATTRIBUTES If Yes the default then the map s attributes are used otherwise the following settings are used OPACITY OF REGION BORDERS A number from 0 to 1 that indicates the opacity of all region borders qen Defor car NA u essence RA pen Bettas nd Figure 201 Border opacity set to 1 Figure 180 Border opacity set to 0 5 Figure 181 Border opacity set to 0 2 COLOR OF REGION BORDERS The RGB se
52. Page Figure 158 Method 2 No Splash Screen Map Intelligence Client 3 2 3 for Reporting Services Development Guide 161 APPENDIX B FEATURES RENDERING ATTRIBUTES OPACITY OF COLORED CIRCULAR REGIONS IN RADIUS LAYERS A number from 0 to 1 that indicates the opacity of all colored circular regions in radius relationship layers A Figure 159 Opacity set to 1 Figure 160 Opacity set to 0 5 Figure 161 Opacity set to 0 2 OPACITY OF COLORED REGIONS A number from 0 to 1 that indicates the opacity of all colored region layers P LOE cea ter es CE N SD Pta Dra tami ca Ne yanasa app Figure 162 Opacity set to 1 Figure 163 Opacity set to 0 8 Figure 164 Opacity set to 0 5 OPACITY OF HATCHES ON LAYERS A number from 0 to 1 that indicates the opacity of all hatched layers Ere pilot etenceiRin ay Deptlof Detence CRNA Figure 165 Opacity set to 1 Figure 166 Opacity set to 0 8 Figure 167 Opacity set to 0 5 Map Intelligence Client 3 2 3 for Reporting Services Development Guide 162 COLOR OF HATCHES ON LAYERS The RGB setting for the hatch color has a six hexadecimal digit 3 byte number representing Red Green and Blue The default value is Black 000000 Bero eten celta MA Bero beter celik MA Bero Deter celh MA Figure 168 hatch color set to Red Figure 169 Hatch color set to Green Figure 170 Hatch color set to Yellow FFOOOO OOFFOO FFFFOO OPACITY OF CIRCULAR REGION B
53. R sb Append amp rowDelimiter sb Append PARAM DELIMITER requestUR new Uri sb Tostring System Net HttpWebRequest rq System Net HttpWebRequest HttpWebRequest Create requestURI System Net HttpWebResponse resp System Net HttpWebResponse rq GetResponse Map Intelligence Client 3 2 3 for Reporting Services User Manual StreamReader sr new StreamReader resp GetResponseStream layerList sr ReadToEnd sr Close string listArray layerList Split return listArray lt summary gt This is used to get all the selected items from a selected layer lt summary gt lt param name layerName gt lt param gt lt param name reportViewerID gt lt param gt lt param name userID gt lt param gt lt returns gt lt returns gt private static string GetSelectedItems string layerName ReportViewer reportViewerlID string userID StringBuilder sb new StringBuilder Uri requestURI string MI SERVER ConfigurationManager Appsettings MI SERVER string PORT NUMBER ConfigurationManager Appsetrings PORT NUMBER string PARAM DELIMITER ConfigurationManager AppSettings PARAM DELIMITER string documentName string Empty string connToken string Empty string selectedItems string Empty String layerValues documentName r reportViewerlD sSe rverReport ReportPath Replace W s20 connToken userID Replace
54. SQL Overview video Wed 19 Mar 2008 15 03 52 0700 Luca Bolegnese s presentation on LINQ at the Tech Ed Video of Luke Hoban s In Depth Look at C 3 0 Mon 25 Feb 2008 17 00 21 0800 Last fall in Barcelona Spain two PM s from the C team gave talks on key parts of the new LINQ technology found in Visual Studio 2008 Heroes Happen Here Wed 27 Feb 2008 10 05 10 0800 Welcome to the launch of Windows Server 2008 Visual Studio 2008 and SQL Server 2008 Together ase Project Web Sit these three products provide a secure and trusted platform For building your most mission critical applications Learn more about these Pe AERA ir iweb 2 products and launch events in your area at HeroesHappenHere com i roject eb Site P Why Do Initializers Run In The Opposite Order As Constructors Part One Wed 19 Mar 2008 15 04 27 0700 Learn about the order in which constructors are called in class hierarchies that use inheritance Getting Started Why Do Initializers Run In The Opposite Order As Constructors Part Two i Wed 19 Mar 2008 15 03 58 0700 Learn more about the order in which constructors are called in class hierarchies that use inheritance z What s new in C Community Convergence XLI SEES Bos REO Wed 19 Mar 2008 15 03 57 0700 Links to various posts written by the CX Team and related news We have moved Future Focus our ata I i 5 peak at features that might appear in the next version of Visual Studio to the Code Gallery Learn Vis
55. Values rectangle and select a hatch from the picker to represent any values that have not been assigned with a specific hatch Theme Builder 5 Configure eje HA r H seat C Boat r HH seats Remove Selected Empty Values iiil Conflicting values gt A n Other values SSS lt Back Save amp Close Next gt gt Figure 109 Theme Builder Wizard Configure Tab String Hatch To delete values assigned to a specific hatch in the Preview window list click the check box next to the value and click Remove Selected s amp Close Click stale The Theme Builder Wizard closes The created theme displays in the Theme Section of the Relationship Layer configuration screen Map Intelligence Client 3 2 3 for Reporting Services Development Guide 115 Hatch Theme Fact Laver Fact Column a D 7 Mm eM O mro W 6 mr HL a on 3 3 3 a m Function Empty Hatch Conflict Hatch Other Values BOAT BOAT BOATS BOATA BOATS BOATS IASA s Figure 110 Hatch Theme String Hatches Legend TH H Z Mt Figure 111 Region Relationship Layer Map View and Legend showing Hatch Theme String Hatch ee a Map Intelligence Client 3 2 3 for Reporting Services Development Guide I 116 Sanne ler atch eye eae AN Figure 112 Radius Relationship Layer Map View and Legend showin
56. acity field type a number from 0 to 1 to indicate the opacity of the colored regions in the layer 3 On the Border Opacity field type a number from 0 to 1 to indicate the opacity of region borders in the layer On the Border Thickness field type a number from 0 to 1 to indicate the thickness in points or pixels depending on the GIS provider of the region borders in the layer Map Intelligence Client 3 2 3 for Reporting Services Development Guide 90 5 Onthe Border Color field type a hexadecimal color value or select a color from the color picker for the region border color The default color is black H000000 Examples of using various Feature Attributes can be seen in Appendix B Features Rendering Attributes on Note Page 162 6 Click the Configure tab or the Next button The Configure tab opens 7 Click the Class 1 colored rectangle 8 Select a color from the color picker 9 Repeat the above steps for each class 10 Click the Empty Color colored rectangle 11 Select a color to indicate value less region in the map and click OK Mote The colored rectangles will change to the new color chosen after each selection If the color picker does not have the exact color you wish to use you can right Click the colored rectangle and Tip manually enter the hexadecimal color value Theme Builder 5 Configure Class 1 Class 2 Class 3 Class 4 Empty Color lt lt Back Save amp Close Next gt gt
57. ap image width type hidden value 320 gt lt input name map image height type hidden value 240 gt lt input name map image not clickable type hidden value true gt lt input name map image border type hidden value 2 gt lt form gt lt body gt lt html gt Only the width or the height need be set but if both are set then the image is scaled based on a minimum of the Monte scales resulting from the width and height to the original Map Intelligence viewer width and height The aspect ratio of the original image is preserved LEGEND Previously the image was a jsp that generated html to render the legend in the browser It is now returned by a servlet as an image The servlet is named maplntelligence getLegendImage and has the following parameters available The id of the user that defines the users session size Determines the look and feel of the legend If none is specified the look and feel with an id of 1 is used See Look and Feel below for more information The client retrieves a legend by contacting the configuration server The following url will retrieve a legend http machine name pot number miclient getLegendImage Example To request a legend using the look and feel set of 2 the following url would be used lt img src http machine name port number miclient getl1legendImage userid 123456 amp size 2 alt legend gt where the machine name and port number are those of
58. are currently four Map Intelligence layer types Point Layers m Radius Relationship Layers 7 Region Relationship Layers 7 Area Group Layers See Concepts Layer Types for a full description of Map Intelligence layers The MIRS comes with configuration screens that allow you to create your Map Intelligence layers Point Layers ot ES Tabs leading to the configuration rt Crime Analysis j Layer Properties screens of Map Intelligence layers Figure 31 Layer Configuration Tabs After a new layer is tested saved the layer is listed in the Layer Directory This is located on the right of the configuration screens This can be used to navigate and open the various Map Intelligence layers MAP INTELLIGENCE Point Layers Cj new Pjcopy save Z Delete f Test Report Crime Analysis Layer Directory Display Information Layer Properties Layer Name point layer 1 Attending_Police ig point layer 1 Crime_Type Relationship Layers Data Source Name DataSet Date 5 Area Group Layers DayOfweek Minimum Zoom km id Incidents Maximum Zoom km Latitude Set layer as visible in map Longitude Enable Popups Layer Directory Point Layers Point Properties Label Column Multiple Shape Icon Theme Url Column Column Crime_Type Shape circle Id Column Assault m Theft El Coordinates C Street Address Vandalism Oo X Longitude Longitude Y Lat
59. ay columns to be included as additional information in the Information pop up box Each column has an associated aggregation function Display Information Codehalf ommon Mame COM y Codeone Depth Depth Ranges Hour Groups Shot Tin Id Image Latitude Longitude gt Mas af whale Iza Figure 122 Display Information Section 2 To configure the Display Information section 1 Select a data column from the list On selection a drop down list appears displaying a list of aggregation functions 2 Select an aggregation function The selected data column displays in the box on the right 3 Repeat steps 1 and 2 to add further data columns 4 To deselect a data column click the next to the selected data column name The example shown in the preceding figure shows the result of adding the Common Name data column On the Information popup box it can be seen that the most common fish caught in the grid area 9368 0 was Flathead 163 0 9 368 0 2 055 0 kg of fish caught in 9368 0 Common Name Flathead Figure 123 Example of Information Popup box with additional data column information CREATING THEMES FOR AREA GROUP LAYERS Map Intelligence Client 3 2 3 for Reporting Services Development Guide 124 Creating themes for Area Group Layers require you to specify threshold conditions based on a Numeric or String aggregation using the Theme Builder Wizard
60. b Developers Wed 19 Mar 2008 15 03 56 0700 A series of new or updated API s that developers can use for building web applications are available From the Windows Live Dey site The new services and APT s are listed below Go to Dave Treadwell s post to read about them in more detail Hanselminutes Podcast 103 Quetzal Bradley on Testing after Unit Tests and the Myth of Code Coverage Wed 19 Mar 2008 15 03 55 0700 Quetzal is a Developer in the Connected Systems Division and has some interesting ideas on testing after unit testing and code coverage Think 100 Code Coverage is enough ASP NET MYC Session at Mix08 TDD and MycMockHelpers Wed 19 Mar 2008 15 03 54 0700 Mocking is becoming more and more an important tool For developers Here is some mocking source that will get you started with ASP NET MYC l Map Intelligence Client 3 2 3 for Reporting Services User Manual 2 There are two ways on how you can create a Website Project in Visual Studio The first one is by clicking on the Website link under create inside the Recent Projects section as shown below Start Page Microsoft Visual Studio File Edit View Tools Test Window Community Help il E 2 2 a TF g seston 29 2 MT Start Page Solution Explorer M icrosoft 5 There are no usable V St d controls in this group I S u a u O 2005 Drag an item onto this text to add it to the toolbox Feer r Recent Projects MSDN Visual C LINQ to
61. cation to provide credentials for connecting to a Reporting Services report server Right click on the App_Code folder and click on Add New Item as shown in the following figure Demo 3 Microsoft Visual Studio 18 x File Edit View Website Build Debug Tools Test Window Community Help b H i s ss B 2 G Sl EG p Debug gt NET gt substation ASER BOS Solution Explorer Solution Demo 3 1 project Blea Age E Default 54 Ezi Add Existing Item ER New Folder a View Class Diagram e Refresh Folder amp cu GA Copy HL Paste x Delete Rename App_Code Web Folder Properties Folder Name App_Code Full Path C RSIntegeo DemolApp_Code Full Path Location of the folder Default aspx gt x Client Objects amp Events No Events v Ai lt s Page Language C AutoEventWireup true CodeFile Default aspx cs Inherits Default abl T lt DOCTYPE html PUBLIC W3C DTD XHTML 1 0 Transitional EN http wuw w3 org TR xhtmli DTD B L El lt html xmlns http wuw wu3 orq 1999 xhtml gt L lt head runat server gt AH lt title gt Untitled Page lt title gt ia lt head gt es EH lt body gt Es L a lt form id formi runat server gt c m lt div gt B C R r lt div gt t R F lt form gt al i H lt body gt lt html gt gr EH T SB abl H Bi E C Sa t F
62. ce application They are determined by the property lt code gt use splash screen lt code gt in the client properties file lt install dir gt tomcat webapps miclient WEB INF properties client By default the value is set to false The implications of choosing a particular method are described below use splash screen true The request is sent as described by the following diagram While the route taken is less efficient the Javascript security issues are eliminated A splash screen is displayed when the map is being retrieved BI Application Browser request file 3 Returns url et Map Request 2 Writes Request File Figure 157 Method 1 With Splash Screen 6 Returns the Map Intelligence Page 4 Request File Executes Map Intelligence Server p 5 Sende Request ta Request Map Intelligence File Map Intelligence Client 3 2 3 for Reporting Services Development Guide 160 use splash screen false The request is sent as described by the following diagram This is the most efficient route for the request to take Some browsers however have been known to have security issues with Javascript when using this method Also as the property name implies a splash screen is not displayed when waiting for a map BI Application Browser 4 Returns Map 1 Map Request Intelligence Page Configuration Map Intelligence Server 2 sends Request to Map Intelligence ee 3 Returns Map Intelligence
63. contain any of the following parameters S label Will be replaced with the label for the region S value S value will be replaced with the value of the column you selected as the Fact Column see Fact Column above ColumnName Replace ColumnName with the name of a column selected in Display Information see Error Not a valid result for table section of the Area Group Layer configuration screen The value of this column will be displayed in the popup description for the region S value items in S label Map Intelligence Client 3 2 3 for Reporting Services Development Guide 122 If this field is left blank a description will be generated by Map Intelligence 1 163 0 3528 1 63 0 9 366 0 r 9 366 0 r The total Whole Kg within 9368 0 is 22 055 0 kg of fish caught in 9368 0 The 22 055 0 using the Whole Kg layer most common type of fish caught was Flathead Common Marnie Flathead Figure 120 Information popup displaying a Map Intelligence Figure 121 Customized Popup description In this example generated Popup description the following description was entered into the Popup Description text box S value kg of fish caught in S label The most common type of fish caught was Common Name Map Intelligence Client 3 2 3 for Reporting Services Development Guide 123 DISPLAY INFORMATION SECTION The Display Information section shows a list of data columns these columns can be specified as displ
64. d Color Empty Color lt Back Save amp Close Next gt gt Figure 131 Theme Builder Wizard Configure Tab Numeric Automatic Color Range 5 amp Clo 13 Click FH save amp close The Theme Builder Wizard closes The created theme displays in the Theme Section of the Area Group Layer configuration screen Ranged Color Theme Fact Column Whole Kg Function SUM Scheme Quantile Start Color End Color Empty Color 2 Theme Figure 132 Themes Section showing Ranged Color Theme Map Intelligence Client 3 2 3 for Reporting Services Development Guide Legend Figure 133 Area Group Layer Map View and Legend showing Ranged Color Theme Map Intelligence Client 3 2 3 for Reporting Services Development Guide 133 SELECTING HATCHES 1 On the Visual Feature options click the Hatches radio button Theme Builder EDEN Class Cout 4 EF visual Feature C Specific Colors Color Range Hatches Border Thickness 1 iz lt lt Back Save amp Close Next gt gt Figure 134 Theme Builder Wizard Features Tab Numeric Automatic Hatches Features Rendering Attributes 2 On the Hatch Opacity field enter a number from 0 to 1 to indicate the opacity of the hatches 3 On the Border Opacity field enter a number from 0 to 1 to indicate the opacity of region borders in the layer 4 On the Border Thickness field enter a number from 0 t
65. der x 1 Theme Type Point Layer column Data Type Numeric ff String lt Back Save amp Close Next gt gt Figure 101 Theme Builder Wizard Theme Type Tab String 5 Click the Data tab or the Next button The Data tab opens 6 On the Aggregation Function drop down list select the function to use for the layer The string functions available are Most Common Uniform and Majority Theme Builder ae Back Save amp Close Next gt gt Figure 102 Theme Builder Wizard Data Tab String with Most Common selected Map Intelligence Client 3 2 3 for Reporting Services Development Guide 109 7 Click the Features tab or the Next button The Features tab opens 8 On the Visual Feature options select the color mode There are two 2 options for selecting the Visual Feature Note Colors Allows you to specify a particular color Hatches Allows you to specify a particular hatch SELECTING COLORS 1 On the Visual Feature options click the Colors radio button Theme Builder 4 Features Visual Feature Colors Hatches Fil Opacity Border Opacity Border Color E lt lt Back Save amp Close Next gt gt Figure 103 Theme Builder Wizard Features Tab String Colors Features Rendering Attributes 2 On the Fill Opacity field enter a number from 0 to 1 to indicate the opacity of the colored regions in the layer 3 On the Border Opacit
66. down list select the column to use to paint the regions The data for this column are extracted from the points and aggregated according to the geographical group of the points 4 Select the Numeric radio button Theme Builder 1 Theme Type point Layer Column Whole Ka Data Tyoe Numeric C String lt Back Save amp Close Next gt gt Figure 72 Theme Builder Wizard Theme Type Tab Numeric 5 Click the Data tab or the Next button The Data tab opens 6 On the Aggregation Function drop down list select the function to use for the layer Count Sum Min Max Mean and Median Map Intelligence Client 3 2 3 for Reporting Services Development Guide 87 7 Onthe Calculation option click either the by Value or by Percentage radio button P The aggregates can be used as the raw aggregate value or as a percentage of the total aggregate over Note the point layer Note that only one color and one hatch layer can be displayed simultaneously for a particular built in layer If you have multiple layers that use the same built in layer you can switch between these using the Theme Select option from the Mapping Viewer refer to the Map Intelligence Mapping Viewer User Manual Theme Builder x S gee by Calculatian by Value Percentage lt lt Back HH Save amp Close Next gt gt Figure 73 Theme Builder Wizard Data Tab Numeric 8 Click t
67. e reportViewer ServerReport ReportServerCredentials new ReportCredentials administrator Password2011 server EE G reportViewer ProcessingMode ProcessingMode Remote reportViewer ServerReport ReportServerUrl reportServerURL reportViewer ServerReport SetParameters param reportViewer ServerReport Refresh catch ReportViewerException ex throw ex lt summary gt This method is used for creating the url string of the configured map lt summary gt lt param name reportViewer gt lt param gt lt param name userID gt lt param gt lt returns gt String lt returns gt public static string GetMapURL ReportViewer reportViewer string userID string MI SERVER ConfigurationManager AppSettings MI_ SERVER string MI CLIENT ConfigurationManager Appsettings MI CLIENT string PORT NUMBER ConfigurationManager AppSettings PORT NUMBER string PARAM DELIMITER ContigurationManager Appsettings PARAM DELIMITER string reportName string Empty string reportPath string Empty string temp string Empty string url string Empty string connToken string Empty StringBuilder sb new StringBuilder ReportParameteriInfoCollection parameterCollection reportViewer ServerReport GetParameters Map Intelligence Client TE for Reporting Services User Manual 26 reportPath reportViewer ServerReport ReportPath reportName r
68. e amp Close Next gt gt Figure 130 Theme Builder Wizard Features Tab Numeric Automatic Color Range Features Rendering Attributes On the Fill Opacity field enter a number from 0 to 1 to indicate the opacity of the colored regions in the layer On the Border Opacity field enter a number from 0 to 1 to indicate the opacity of region borders in the layer Click the Configure tab or the Next button The Configure tab opens Click the Start Color colored rectangle Select the start color from the color picker and click OK Click the End Color colored rectangle Select the end color from the color window and click OK Click the Empty Color colored rectangle Select a color to indicate value less region and click OK Map Intelligence Client 3 2 3 for Reporting Services Development Guide On the Border Thickness field enter a number from 0 to 1 to indicate the thickness in points or pixels depending on the GIS provider of the region borders in the layer On the Border Color field enter a hexadecimal color value or select a color from the color picker for the region border color The default color is black 000000 131 F The colored rectangles will change to the new color chosen after each selection Note P If the color picker does not have the preferred color right Click the colored rectangle and manually enter the Tip hexadecimal color value Theme Builder 5 Contigure Start Color En
69. e are two options for selecting the Visual Feature Colors use to specify a particular color Hatches use to specify a particular hatch Map Intelligence Client 3 2 3 for Reporting Services Development Guide 144 SELECTING COLORS 1 On the Visual Feature options click the Colors radio button Theme Builder Visual Feature Colors Hatches Fil Opacy Border Thickness lt lt Back Save amp Close Next gt gt Figure 149 Theme Builder Wizard Features Tab String Colors Features Rendering Attributes On the Fill Opacity field enter a number from 0 to 1 to indicate the opacity of the colored regions in the layer On the Border Opacity field enter a number from 0 to 1 to indicate the opacity of region borders in the layer On the Border Thickness field enter a number from 0 to 1 to indicate the thickness in points or pixels depending on the GIS provider of the region borders in the layer On the Border Color field enter a hexadecimal color value or select a color from the color picker for the region border color The default color is black 000000 Click the Configure tab or the Next button The Configure tab opens On the top drop down list select a value from the specified fact column Mole In some instances only a sub set of values will be displays in the value list box Click l display all values Be aware that large datasets may take sometime to process Click the rectangle next to the
70. egree ost common value of Wessel Name within halfdeg using the Shot Points layer Most Common vessel catching fish within half degree m m LJ LJ C B BOATT BOAT2 BOATS BOATS BOATS BOATE other conflict empty Higure 67 Legend showing a generated description Map Intelligence Client 3 2 3 for Reporting Services Development Guide Ea C C LJ s BR C mm BOAT1 BOAT2 BOATS BOATS BOATS BOATE other conflict empty Figure 68 Legend_showing acustomized description 85 5 On the Popup Description field type a description to use for information pop ups of this layer The Popup Description describes each region of the layer and may contain any of the following parameters S label Will be replaced with the label for the region S value Will be replaced with the value for the region determined by the column selected in the theme see Figure 71 S value items in S label If this field is left blank a description will be generated by Map Intelligence F dbj 9 368 0 The most common value for essel Name within 9368 0 is BOAT4 using the Shot Points layer Figure 69 Information popup displaying a Map Intelligence generated Popup description F 9 366 0 BOAT4 is the most common vessel catching fish within 9368 0 Figure 70 Customized Popup description In this example the following description was entered into the Popup Description text box
71. eir roles include launching the Mapping Viewer to generate spatial representations of the data End Users are advised to read the separate Mapping Viewer User Manual SERVER ADMINISTRATORS Another type of user exists that is responsible for the installation and management of the Map Intelligence Server These users should be familiar with the organization s mapping server hereinafter referred to as GIS Provider Server Administrators are advised to read the separate Server Installation Guide and the Server and Administration Tools Guide Map Intelligence Client 3 2 3 for Reporting Services User Manual 5 CONVENTIONS The following table shows the conventions that are used in this document m w An arrow indicates the beginning of procedures consisting of sequential steps or one step procedures In examples lt gt indicate that the enclosed elements are optional or they are instances of code to be replaced by the user with applicable information Bold in procedural steps highlights user interface elements on which the user must perform actions Emphasis names of applications files windows and dialog boxes Example text Courier font indicates that the example text is code or syntax Courier italics Courier italic text indicates a variable field in command syntax Substitute a value in place of the variable shown in Courier italics Italic n stands for a variable number italic x can stand for a variable number or a l
72. el ID 1b1CrimeType runat server Text KS Eval Crimet ype HH gt lt asp Label gt lt ItemTemplate gt lt HeaderStyle Width 65 gt lt asp TemplateField gt lt Columns gt lt RowStyle Font Size Smaller gt lt HeaderStyle BackColor DarkOrange Font Size Small ForeColor White gt lt AlternatingRowStyle BackColor EQOEOEO BorderColor Black BorderStyle Solid BorderWidth 1px gt lt asp GridView gt lt td gt lt tr gt SCE lt td width 20 gt lt asp GridView ID grdValueOfCrime runat server AutoGenerateColumns False Width 70 Font Names Calibri gt lt Columns gt lt asp TemplateField gt lt HeaderTemplate gt lt asp CheckBox ID chkAll runat server gt lt HeaderTemplate gt lt ItemTemplate gt lt asp CheckBox ID chkItem runat server J gt lt ItemTemplate gt lt HeaderStyle Width 5 gt lt asp TemplateField gt lt asp TemplateField gt lt HeaderTemplate gt lt asp Label ID Label4 runat server Text VALUE OF CRIME gt lt asp Label gt lt HeaderTemplate gt lt ItemTemplate gt lt asp Label ID 1b1ValueOfCrime runat server Text Eval Band HH gt lt asp Label gt lt ItemTemplate gt lt HeaderStyle Width 65 gt lt asp TemplateField gt lt Columns gt lt RowStyle Font Size Smaller gt lt HeaderStyle BackColor DarkOrange Font Size Small ForeColor White gt lt AlternatingRowStyle BackColor EQOEOEO Bord
73. eportViewer ServerReport DisplayName connToken string Format amp connToken 0 1 reportID userID Replace connToken string Format amp connToken 0 1 reportName userID Replace sb Append MI SERVER sb Append PORT NUMBER sb Append MI CLIENT sb Append reportPath foreach ReportParameterInfo info in parameterCollection foreach string value in info Values i if info Values Count gt 1 temp string Format 0 1 value PARAM DELIMITER te temp value sb Append string Format amp 0 1 info Name temp temp string Empty url 8b Tostring url connToken return url lt summary gt This method is used for refreshing the Reporting Services report based on the selection made on the map lt summary gt lt param name reportViewer gt lt param gt lt returns gt lt returns gt public static string GetMapFilter ReportViewer reportViewerID string userID ReportParameterInfoCollection parameters reportViewerIlID ServerReport GetParameters ReportParameter parm new ReportParameter parameters Count Hashtable tblFilter new Hashtable String filterCol string Empty string values string Empty Sstring layerList GetLayerList reportViewerID userID Display all points on the map if there is no selection done on the map if layerList Length 1 amp amp layerList 0 stri
74. erColor Black BorderStyle Solid BorderWidth 1px gt lt asp GridView gt lt bax ccs EL lt td width 20 gt lt asp Button ID btnViewReport runat server OnClick btnViewReport Click Text View Report Font Names Calibri gt lt asp Button ID btnGetMapFilter runat server Text Get Map Filter Font Names Calibri gt lt td gt lt tr gt lt table gt lt Z td gt lt td style width 80 height 100 valign top gt lt y td gt A CEF LCE lt td style width 20 height 100 valign top gt Map Intelligence Client 3 2 3 for Reporting Services User Manual 34 lt td gt lt td style width 80 height 100 valign top align center gt lt div id MapView gt lt iframe id MapFrame runat server frameborder 0 scrolling no src about blank style width 100 height 640px visible true align left valign top gt lt iframe gt ci P tas lt tr gt lt table gt lt div gt 17 Switch to Design view by click the following button as shown in the next Toolbox Label TextBox Button Crimednalysis aspx Integeo Demo Crime Analysis CRME STATUS LinkButton ImageButton A HyperLink Databound Databound Databound DropDownList ListBox CheckBox CheckBoxList RadioButton m FadioButtonList Databound Image Databound Misette Databound Table Databound BullebedList Ave Databound
75. ery single column value Map Intelligence automatically assigns a default Wote icon for all values that have not been configured 7 Repeat the steps above if you want to assign themes to other columns H Save amp Close 8 Click The Theme Builder Wizard closes The created theme displays on the Theme Section of the Point Layer configuration screen Themes Theme 1 Huttiple Image Icon Theme Theme 2 BOAT 1 BOAT2 BOATS BOAT BOATS BOAT6 Figure 53 Themes Section showing Multiple Image Icon Theme Theme 2 Map Intelligence Client 3 2 3 for Reporting Services Development Guide 73 ects h a i Fred pe er eerie OR Pe FL tee aed fet lathe at Caterer t EXT CCE op Le es aT 10356 S rt Grakis Aowa Eg An r gad F lathe ds E athe E GE chops er EER Fun kum d Figure 54 Map View and Legend showing the Multiple Image Icon Theme we can see here that the Shot Points are themed according to the Vessel Name for example all yellow boats are BOAT 6 gt Creating an Auto Classification Theme 1 Click The Theme Builder Wizard displays with the Theme Type tab open by default 2 On the Theme Type drop down list select Auto Classification 3 On the Column Name drop down list select a column to configure this list contains all numeric data columns 4 Onthe New Column Name field type a new column name This column is used to store the classified values
76. essage displays when rendering the map from the Reporting Services server Solution s Check if the Map Intelligence Server and included GIS servers is already running Check the permissions granted for the logged user Make sure that the user is included in the Reporting Services Security Group User For Reporting Services 2005 check through Site Settings gt Security gt Configure Site Wide Security For Reporting Services 2008 check through Site Settings gt Security If during design time Reporting Services did not return any data check the test max rows and the max rows properties in the client properties file These properties limit the 1 number of retrieved records to the Reporting Services Server and 2 number of data to be displayed in the Theme Builder respectively Refer to the client properties section for more information The report field has an invalid data type e g the field expecting a decimal value but it s data type is an integer Also check the data type of the Longitude and Latitude fields of the report referenced by the map These should not be an integer type Valid data types are Single Double or Decimal The user credentials submitted to Reporting Services may not be authorized or was not configured properly Check the SQLReportingUser SQLReportingPassword and SQLReportingURL properties in the client properties file Refer to the client properties section for more information Map
77. etter This document provides examples and procedures using a right handed mouse If you use a left handed mouse adjust the procedures accordingly The Note icon indicates additional information relating to the topic The Tip icon suggests an alternative or shortcut procedure Map Intelligence Client 3 2 3 for Reporting Services User Manual 6 PREREQUISITES Please refer to your MI Client Readme for the list of prerequisites In addition to the MIRS prerequisites the Map Intelligence Server needs to be installed and configured in order to make the relevant maps colors and images available for your analysis The Map Intelligence Server requires that a suitable mapping server be installed The installation of the Map Intelligence Server and mapping server are beyond the scope of this manual For instructions on how to install and configure the Map Server refer to the Map Intelligence Server Installation Tip Guide and the Map Intelligence Server and Administration Tools Guide Map Intelligence Client 3 2 3 for Reporting Services User Manual 7 CONCEPTS WHAT IS MAP INTELLIGENCE Map Intelligence extends the no programming paradigm into mapping and merges location and spatial analytics into enterprise decision support and Business Intelligence applications Map Intelligence enables bi directional analysis between data visualized on maps and other more traditional representations such as tables of data charts and reports
78. evelopment Guide 84 Relationship Type Radius r Region Reference Point Layer Platforms Ol DE Radius Around Point km Pu 3 0 illegal catches occurred within a 20 km radius of the Marine Research platform Legend Description Number of Shot Points inside Excision Z Popup Description tivaluet illegal catches occured within a Figure 66 Relationship Type Radius Option Selecting the Region option 1 Select the Region radio button 2 On the Reference Region Layer drop down list select the built in map layer to shade Torefresh the Reference Region Layer drop down list click 2 Mote m Only layers containing regions can be used as reference layers Built in layers are arranged in a particular order on the map When selecting a built in layer to shade all map layers that sit under the selected layer are covered by the selected color or hatch 3 On the Label Column drop down list select the column in the map layer that contains the values to be used as labels for the regions Map Intelligence IGP users Labels will not be visible if the server setting Show Region Built in Label has Note Deen set to No Refer to the Settings section of the Map Intelligence Server Tools and Administration Guide 4 Onthe Legend Description field type a description to use for the legend of this layer If this field is left blank Map Intelligence automatically assigns a description Vessel by half degree Vessel by half d
79. figure Choose a color TLL LL a _ ae G G Zia G Hogg Hexadecimal Value Field lt lt Back Save amp Close Next gt gt Figure 41 Theme Builder Wizard 5 Configure In this example the color red has been selected If the particular color you wish to use is not shown on the color swatch you can type the hexadecimal value Tip directly into the text box below the color swatch Save amp Close 6 Click save amp ciose The Theme Builder Wizard closes An entry for the created theme displays on the Theme section of the Point Layer configuration screen Single Shape Icon Theme shape square Color Figure 42 Themes Section showing Single Shape Icon Theme 1 In this example we can see we selected a square shape and the color red Map Intelligence Client 3 2 3 for Reporting Services Development Guide 66 mis peas Ba lek TE mara C Epe He RA EE LI gE 1B Cha TES Boe TA aE CAT mm OO ee CTE Boats o Hem orme EN Een Figure 43 Map View and Legend showing the Single Shape Icon Theme we can see here that all the Shot Points are themed as red squares 2 Creating q Multiple Shape Icon Theme 1 Click the The Theme Builder Wizard displays with the Theme Type tab open by default 2 Onthe Theme Type drop down list select Multiple Shape Icon 3 On the Column Name drop down list select a column to configure this list contains all selected data c
80. g Hatch Theme String Hatch This completes all the theme options for relationship layers TO TEST YOUR SETTINGS To test the Relationship Layer configuration Test 1 On the Main Menu click A browser opens displaying the layer configuration The new layer is added on the relationship layer list in the Layer Directory SAVING THE LAYER 2 To save the Relationship Layer configuration 1 On the Main Menu click Save to save the layer settings The Layer will be saved and listed in the Layer Directory to the right of the screen P Clicking the Save button saves all the changes made to all configuration screens Note that saved layers are Mote added to the layer list in the Layer Directory EDITING A LAYER gt To edit a Relationship Layer configuration 1 On the Layer Directory expand the Relationship Layers to view the relationship layer list 2 Click the Relationship Layer to edit The layer configuration screen displays for editing 3 On the Main Menu click ko Save i P Clicking the Save button saves all the changes made to all configuration screens Mote Map Intelligence Client 3 2 3 for Reporting Services Development Guide 117 COPYING A LAYER To copy a Relationship Layer 1 On the Layer Directory expand the Relationship Layers folder to view the relationship layer list 2 Click the Relationship Layer to copy The layer configuration displays 3 On the Main Menu click Copy The copied
81. gions F Map Intelligence IGP users Labels will not be visible if the server setting Show Region Built in Label has been Note Set to No Refer to the Settings section of the Map Intelligence Server Tools and Administration Guide Figure 116 When no Label column has been selected no Figure 117 In this example the half degree column label labels appear on the map was selected now each half degree grid square on the map displays its code number label Map Intelligence Client 3 2 3 for Reporting Services Development Guide 121 7 On the Legend Description field type a description for the legend of this layer If this field is left blank Map Intelligence automatically assigns a description Catch by half degree Layer Name Catch by half degree The total Whole Kg within halfdeg using the Total kilograms of fish caught within halt hole Kg layer degree LJ lt 3 726 83 FH lt 3 725 83 lt 7 391 66 GE lt 7 391 66 EE lt 11 057 50 MS lt 11 057 50 Legend Description Legend Description MM lt 14 723 33 generated MB lt 14 723 33 custom MH lt 18 399 16 ME lt 18 399 16 Me gt 18 389 16 Me gt 18 389 16 EEN empty B empty Figure 118 Legend showing a Map Intelligence Figure 119 Legend showing a customized description generated description 8 On the Popup Description field type a description for the Information Popups of this layer The Popup Description describes each region of the layer and may
82. gner For example different colored circles indicate the average house price within half a kilometer of a proposed waste plant Another example is where different colored circles indicate the number of burglaries that have occurred within a five mile distance of houses belonging to known burglars In the current version of Map Intelligence the circle center points eg houses belonging to known burglars and the data being analyzed burglaries must be point layers Regional Relationship Layer A Region Relationship layer corresponds to a map area of any shape that is solely geographical in its definition and not generated by Map Intelligence Examples would be suburbs zip codes local government areas or police precincts Region Relationship layers can be given themes according to specified data rules associated with the points that fall within that region An example of such a theme could be color coding precincts according to the number of crimes that have taken place within their boundaries or applying different hatches to suburbs based on the total value of house sales that have occurred in each one Map Intelligence works out in which region a point eg a sale or accident physically belongs by doing a spatial calculation Relationship Layer For further information see Radius Relationship Layers and Regional Relationship Layers Theme A theme can be described as a representation of map features according to different associated values
83. hading range Map Intelligence Client 3 2 3 for Reporting Services Development Guide 75 Theme Builder x 4 Features scheme lt Back Save amp Close Next gt gt Figure 56 Theme Builder Wizard 1 Theme Type Auto Classification 9 Click the Configure tab or the Next button The Configure tab opens 10 Click the Class 1 colored rectangle 11 Select a color from the color picker 12 Repeat the above steps for each class A The colored rectangles will change to the new color after each selection If the color picker does not reflect the preferred color type the hexadecimal value instead Tip Map Intelligence Client 3 2 3 for Reporting Services Development Guide 76 Theme Builder 5 Configure Class 1 Class 2 Class 3 Class 4 lt Back Save amp Close Next gt gt Figure 57 Theme Builder Wizard Configure Tab Auto Classification 5 amp Clo 13 Click FH save amp Close The Theme Builder Wizard closes The created theme displays on the Color Theme section of the Relationship Layer configuration screen Themes Shape Column scheme Class 1 Color Class 2 Color Class 3 Color Class 4 Color Figure758 Themes Section showing Auto Classification Theme Map Intelligence Client 3 2 3 for Reporting Services Development Guide 77 Shot Points eo le mn s l Fur fpg Fra K s Fm m 2 ih foal Pa ig CLES OF L G K Pasan Caco ree
84. he Method tab or the Next button The Method tab opens There are two 2 methods for applying themes Mote Automatic Manual Map Intelligence Client 3 2 3 for Reporting Services Development Guide 88 AUTOMATIC METHOD 1 Onthe Theme Method options click the Automatic radio button Theme Builder Theme Method Automatic Manual lt Back Save amp Close Next gt gt Figure 74 Theme Builder Wizard Method Tab Numeric Automatic 2 Click the Features tab or the Next button The Features tab opens 3 On the Scheme drop down list select a classification scheme A standard classification scheme may be used to group similar values to look for patterns in the data The Note following are schemes for grouping data values into classes based on how the data values are distributed Equal Interval The difference between the high and low values is the same for every class So the classification of the data will be based on a set of equal splits For example if the lowest value is 0 and the highest value is 10 in the data and 5 classes are requested the range of each class will be 0 to 2 2 to 4 4 to 6 6 to 8 8 to 10 Quantile Each class contains an equal number of features In this case the points are sorted in ascending order for the chosen data field and each class is filled with total number of points number of classes points starting from the lowest value to the highest Standard
85. hosted http server MI CLIENT This is the name of the miclient miclient renderMap documentld PORT NUMBER The Port number used by the MI Client 59092 The URL of the Report Server http server ReportServer REPORT_SERVER Figure 22 Configuration Setting Definition On the solution explorer double click on the ReportingObject cs and copy and paste the following code using System using System Data using System Configuration using System Collections using System Collections Generic using System IO using System Net using System Text using System Web using System Web Security using System Web U1 using System Web UI WebControls using System Web UI WebControls WebParts using System Web UI HtmlControls using Microsoft Reporting WebForms lt summary gt Summary description for ReportingObject lt summary gt public class ReportingObject public ReportingObject lt summary gt This Method is used for rendering a report lt summary gt lt param name reportViewer gt lt param gt lt param name param gt lt param gt public static void RenderReport ReportViewer reportViewer ReportParameter param string url ContiguralionManager Appsettings REPORT SERVER Uri reportServerURL new Uri url LEV Map Intelligence Client 3 2 3 for Reporting Services User Manual 25 reportViewer ShowCredentialPrompts tru
86. html gt m lt head runat server gt lt title gt Untitled Page lt title gt lt head gt lt body gt i lt form id formi iS lt div gt runat server gt lt div gt F lt form gt lt body gt L lt html gt 4 TEET Error List Creating project Demo project creation successful g Figure 15 Solution Explorer window Once you have added the App_Code folder you will notice that a new folder named App_Code is added on the Solution Explorer Map Intelligence Client 3 2 3 for Reporting Services User Manual r aHes aA Solution Demo 3 fe AC RSIntegeo Demi App_Data k H 52 Default aspx Ea App_LocalResources App_WebReferences App_Browsers Full Path a Opened LIRL Policy File Port number Use dynamic ports Full Path The local disk location of the Web Add ASP NET Folder YI Build Web Site Publish Web Site Add New Item Add Existing Item New Folder Add Reference Add Web Reference View Class Diagram Copy Web Site X Start Options Set as StartUp Project View in Browser Browse with Refresh Folder Cut Cop Remove Property Pages Run Code Analysis on Web Site 5 The next step is to add a class that will implement the IReportServerCredentials interface The IReportServerCredential interface allows an appli
87. ick the colored rectangle and Tip manually enter the hexadecimal color value 3 Click the Send Styles checkbox Ed If the Send Styles checkbox is unchecked the Mapping Viewer will use the Default Look and Feel settings Mote Configured on the Map Intelligence Server Styles Backeround Button Button Button Buttons Header Background Panel Background Style Preview Map appears here Header Text Button Text send Styles Figure 29 Styles Section showing a blue color scheme Map Intelligence Client 3 2 3 for Reporting Services Development Guide 56 SAVING THE SETTINGS To save the Global Settings 1 Onthe Main Menu click sale The following dialog box displays Configuration saved successfully OK Figure 30 Saved Configuration Confirmation Message 2 Click OK to close P Clicking the Save button saves all changes made to all configuration screens Note Map Intelligence Client 3 2 3 for Reporting Services Development Guide 57 MAP INTELLIGENCE LAYERS OVERVIEW Maps are made up of layers Map features such as roads parks or traffic lights are held on different layers Each map is composed of one or more layers that are superimposed to give the final map look and feel Layers that reside as part of the mapping environment are referred to as built in layers Layers created dynamically from external data sources are known as Map Intelligence layers There
88. ient properties File Map Intelligence Client 3 2 3 for Reporting Services User Manual TAM eportingrastword lt Passwor TT G SQLReportingue Http elmerMeporervers Parameter delimiter SQLReportingURL filter servlet http 0oServeriost f eosServerPort bustinessobijects enterprise1ls desktoplsasunch jiewersz cdz ade mrilteriInterface sp SQLReportingUser delimiter get default value test max rows renqer max rows reporting services version 42 2 Setmax rows to a value corresponding to the number of distinct values that must be retrieved for the provided column in the Configure tab of the Theme Builder See the following figure 10 8997 Distinct values of 11 5648 the column selected 11 7457 12 1728 12 1991 12 2674 lt lt Back Save amp Close Next gt gt Figure 17 Configure Tab of Theme Builder with sample of retrieved values related to the max rows setting 3 Set SOLReportinguUser to the userID used in accessing the Report Server from which the MI Runtime Client will connect 4 SetSOLReportinoPassword tothe password used in accessing the Report Server from which the MI Runtime Client will connect 5 Set SQLReportingURL to the URL for accessing the Report Server from which the MI Runtime Client will connect 6 Set delimiter toa character used to delimit parameters in RS Report 7 Set get default value to True if the MIRS Configuration
89. iia Mote Clicking the Save button saves all the changes made to all configuration screens Note on Data Format Map Intelligence by default places commas in numbers greater than 999 The format can be change by specifying the column format in the universe This only applies to columns with numeric values Map Intelligence Client 3 2 3 for Reporting Services Development Guide 80 CONFIGURE RELATIONSHIP LAYERS For a description of Relationship Layers see Concepts Layer Types Relationship Layers 2 To open the Relationship Layer configuration screen 1 Click Relationship Layers _ The Relationship Layer configuration screen displays 2 Click Ld wae The fields are cleared for new input Relationship Layers Co New copy Save SK Delete be Test Report Fisheries Training John Brown 8981 W D Set layer as visible in map Figure 60 Relationship Layer configuration screen Map Intelligence Client 3 2 3 for Reporting Services Development Guide 81 LAYER PROPERTIES SECTION gt To configure the Layer Properties section On the Layer Name field type a title for the layer P Spaces can be used but must not be used at the beginning or end of the layer name For Map Intelligence Mote Servers 3 1 or below only letters numbers and spaces may be used Specify a range in which the layer will be visible on the map by entering a Minimum Zoom and Maximum Zoom value The layer will only be visible if
90. ines the width of the map in pixels No Determines the width of the map in pixels No P If the width and height are not specified then the size of the map will be the size from the current user session Mote The client retrieves a legend by contacting the configuration server The following url will retrieve a map http machine name port number miclient getMapImage Map Intelligence Client 3 2 3 for Reporting Services Development Guide 156 Example To request a map with width 400 and height 400 the following url would be used lt img src http machine name port number miclient getMapImage userid 123456 amp w 400 amp h 400 alt map gt where the machine name and port number are those of the configuration server TAGS The tag creates a map image based on the main map image but scaled to the required size usually smaller Attributes can be set for a border and an action to be applied when the image is clicked on If no height is given then the scale is based on the width of the map image and vice versa based on the aspect ration of the main map settings The following parameters are available Parameter Name Value userid The id of the user that defines the users session map image width The width in pixels of the map NOTE that the width will be coerced to the aspect ratio of the main map if it turns out that the suggested width is greater than the width derived from the scaling of the main map maintaining it
91. ing to the color assigned to Other Values See the ist A following discussion Click the Empty Values rectangle and select a color from the color picker to represent any value less region or circle Click the Conflict Values rectangle and select a color from the color picker to represent any region or circle that does not meet any specified condition e g a conflict condition will be returned if the Uniform function has been set and there is more than one type of value present in the region Map Intelligence Client 3 2 3 for Reporting Services Development Guide 111 13 Click the Other Values rectangle and select a color from the color picker to represent any values that have not been assigned with a specific color Theme Builder r E eoat r jD soan r L Boarta Remove Selected Empty Values Conflicting Values Other Values lt lt Back Save amp Close Next gt gt Figure 104 Theme Builder Wizard Configure Tab String Colors 14 To delete values assigned to a specific color in the Preview window list click the check box next to the value and click Remove Selected 5 amp Clo 15 Click E save ciose The Theme Builder Wizard closes The created theme displays in the Theme Section of the Relationship Layer configuration screen Color Theme Fact Laver Shot Points Fact Column Vessel Mame Function Most Common Empty Conflict Other Values BOAT 1
92. ion Mote The report parameters must be enclosed by are case sensitive Sy If multiple parameters separate by comma See the preceding figure Map Intelligence Client 3 2 3 for Reporting Services User Manual 11 Click OK The window closes PR port Manager Microsoft Internet Explorer Pr EJ Bfe Edt yew Favores Took tep K Bock Q i iz J Sewth Feo O O fa CB i Address http oc aot iReports Pages Repat asp 7IhenPath 2F Integeos Demo Reports 22 Aust akan 2f AL Cranes Analysis kj leks My Subscriptions SQL Server Reporting Services Home iate settings eg Home gt Integeo Demo Reports gt Australia gt Search for AU Crime Analysis l iB New Subscription Status of Crime fapprehended At large Unknow w Crime Type fassoult Theft Vandalism Day Of Week in Mon Sat Sun Thu Tue w Monetary Value of Crime fe 1K 10K 20 IK 10K RTE in afk o r pi f 100 Find Next Select a format sue a rime Analysis View Crime Map Crime Type By Day of Week Sun 26 n Thu Wed P s sus Mon Sun E WThef l Assautt E N vandalism SR Unknow GEE Alt large GB Approhendid Thet Asset Vandalism Map Intelligence Microsoft Internet Explorer x 2 MP Py http mirs 9090 mapInteligence createMap Navigate W Legend Crime By Type Crime By Type grouped by Climetyoe Assault Theft Vandalism
93. layers Figure 2 The Mapping Viewer displaying a Point layer The points represented by an image of a boat indicate the position of the boat when it pulled up its net Figure 3 The Mapping Viewer displaying a Radius Relationship layer The green circle on the map shows an exclusion zone where fishing is prohibited We can see that 3 boats were fishing illegally Map Intelligence Client 3 2 3 for Reporting Services User Manual 10 A Region Relationship layer corresponds to a map area of any shape that is solely geographical in its definition and is not generated by Map Intelligence Examples would be suburbs zip postal codes local government areas or police precincts Region Relationship layers can be given themes according to specified data rules associated with the points that fall within that region An example of such a theme could be color coding precincts according to the number of crimes that have taken place within their boundaries or applying different hatches to suburbs baseq on the total value of house sales that have occurred in each one Map Intelligence works out in which region a point eg a sale or an accident physically belongs to by doing a spatial calculation AREA GROUP LAYER Area Group layers also correspond to existing areas on a map As for Region Relationship layers the displayed theme is based on data attribute values but in this case no spatial calculation is required Instead a column in yo
94. lligence automatically assigns a description Exclusion Zones Layer Name Exclusion Zones Number of Shot Points inside Exclusion Zone lt 0 00 lt 1 00 lt 6 00 gt 6 00 Number of Shot Points within a 20 0 kilometer radius of Platforms C lt 0 00 lt 1 00 Legend Description Generated B lt 4 00 C gt 5 00 Legend Description Custom Figure 62 Legend showing a Map Intelligence generated Figure 63 Legend showing a customized description description On the Popup Description field type a description to use for the information pop ups of this layer The Popup Description describes each region of the layer and may contain any of the following parameters S label Will be replaced with the label for the region S value Will be replaced with the value for the region determined by the column selected in the theme see Creating Themes for Relationship Layers S value items in S label If this field is left blank a description will be generated by Map Intelligence Map Intelligence Client 3 2 3 for Reporting Services Development Guide 83 Figure 64 Information popup displaying a Map Intelligence Figure 65 Customized Popup description In this example the generated Popup description following description was entered into the Popup Description text box S value illegal catches occurred within a 20 km radius of the S label platform Map Intelligence Client 3 2 3 for Reporting Services D
95. lor Theme Marine PEP De pilot De tence FE Nay Figure 95 Radius Relationship Layer Map View and Legend showing Manual Color Theme Map Intelligence Client 3 2 3 for Reporting Services Development Guide 103 SELECTING HATCHES 1 10 On the Visual Feature options click the Hatches radio button Theme Builder Visual Feature Colors Hatches Hatch Opacity Border Opacity Border Thickness Border Color Hatch Color Figure 96 Theme Builder Wizard Features Tab Numeric Manual Hatches Features Rendering Attributes On the Hatch Opacity field enter a number from 0 to 1 to indicate the opacity of the hatches On the Border Opacity field enter a number from 0 to 1 to indicate the opacity of region borders in the layer On the Border Thickness field enter a number from 0 to 1 to indicate the thickness in points or pixels depending on the GIS provider of the region borders in the layer On the Border Color field enter the hexadecimal color value or select a color from the color picker for the region border color The default color is black 000000 On the Hatch Color field enter a hexadecimal color value or select a color from the color picker for the hatch color The default color is black HOOOOOO P Examples of using various Feature Attributes can be seen in Appendix B Features Rendering Attributes on Note page 162 Click the Configure tab or the Next button the wizard will move to the Configure tab
96. lor from the color picker for the hatch color The default color is black HOOOOOO Click the Configure tab or the Next button The Configure tab opens Tip You can shade a region by applying a hatch to a built in map layer or circle around a point On the top drop down list select a value from the specified fact column Any values not assigned a specific color will be colored according to the color assigned to Other Values Note See the following discussion Map Intelligence Client 3 2 3 for Reporting Services Development Guide 114 10 11 12 13 14 15 16 Click the rectangle next to the top drop down list Select a hatch from the picker that you want to associate with the selected value The selected value and associated hatch displays in the preview window list Configure any other values that you wish to associate with a hatch Any values not assigned a specific hatch will be hatched according to the hatch assigned to Other Values Mote See the following discussion Click the Empty Values rectangle and select a hatch from the picker to represent any value less region or circle Click the Conflict Values rectangle and select a hatch from the picker to represent any region or circle that does not meet any specified condition e g a conflict condition will be returned if the Uniform function has been set and there is more than one type of value present in the region Click the Other
97. m Click here to learn how Figure 6 Report Properties on Report Menu 3 Click Code Map Intelligence Client 3 2 3 for Reporting Services User Manual 12 4 Write the custom code for the report Note that the first four 4 lines of code depend on the MI server configuration See sample code Report Properties Page Set oe Write custom code for this report Delimiter of parameters used to generate the report References Custom code A Variables Public Const PARAM_DELIMITER As String Public Const SERVER As String http mirs Server host Public Const PORT NUMBER As String 39090 Public Const MI CLIENT PATH As String miclien Wiap documenth Client port Private Function CreateMapIntelligenceURL Byval formattesParameters As f tring As lien P Dim reportFolder As String String Empty Dim reportName As String String Empty Dim temp As String String Empty Dim sb As New System Text StringBuilder MI Client path Try reportFolder Report Globals ReportFolder reportName Report Globals ReportName temp String Format 0 1key reportFolder reportName formattedParameters sb Append javascriptivoidfwindow open sb Append SERVER sb Append PORT_NUMBER sb Append ML CLIENT PATH sb Append temp sb Append blank Return sb TosString Figure 7 Report Custom Code 5 Click OK The Report Properties window closes Map Intelligence Client 3 2
98. mage Icon Column Name lt Back Save amp Close Next gt gt Figure 51 Theme Builder Wizard 1 Theme Type Multiple Image Icon 4 Click the Configure tab or the Next button The Configure tab opens 5 Select a value from the value list box on the right Mote In some instances only a sub set of values will be displayed in the value list box Click Sho display all values Be aware that large datasets may take some time to process 6 Select an image from the Image list box on the left and click the E on The chosen image displays next to the value in the value list Using the Selection Arrow Button Select a value and an image then click this button to associate the image with the value Repeated clicks of this button will automatically select the next image from left to right Select a value and an image then click this button to automatically associate all values with an image All values below the selected value will be automatically associated with images starting with the selected image followed by the next image from left to right lt Removes associated image from selected value Removes all associated images from all values Map Intelligence Client 3 2 3 for Reporting Services Development Guide 72 Theme Builder 5 Configure lt Back Save amp Close Next gt gt Figure 52 Theme Builder Wizard 5 Configure Multiple Image An icon may not be assigned for ev
99. md exe 2 Type resetuser and then press the Enter key I QIKIGI gt gt p rune ee 4 yee cv C WINDOWS system32 cmd exe 3 To replace the SQL Reporting username and password type Resetuser lt User Name gt lt Password gt lt Path of the Property File this parameter is optional gt Note the path of the property file is defined during the installation of the MI Client for Reporting Services Map Intelligence Client 3 2 3 for Reporting Services User Manual 44 c C WINDOWS system32 cmd exe 4 Verify if the password reset has been successfully executed as shown above 5 Restartthe MIC Client e From Start gt All Programs gt Pitney Bowes gt MI Client for MS Reporting Services 3 2 2 select Stop MI Client for MS Reporting Services 3 2 2 e From Start gt All Programs gt Pitney Bowes gt MI Client for MS Reporting Services 3 2 2 select Start MI Client for MS Reporting Services 3 2 2 Map Intelligence Client 3 2 3 for Reporting Services User Manual 45 REPORTING SERVICES 2008 WINDOWS AUTHENTICATION NTLM Windows Authentication NTLM is now supported and the configuration of the Basic Authentication for RS 2008 is no longer required to successfully access the MI Client Configuration application Map Intelligence Client 3 2 3 for Reporting Services User Manual 46 ACCESSING THE MIRS CONFIGURATION APPLICATION 1 Launch an IE6 browser and access the following http lt machine name g
100. n borders in radius relationship layer 137 Introduction Opacity of colored circular regions in radius layers Audience 5 136 Conventions 6 Prerequisites 7 Opacity of colored regions 136 Purpose 5 Opacity of hatches on layers 136 Layer Designers 5 Opacity of region borders 138 Layer Directory 34 Point 145 Layers 145 Point Layer Area Group 93 144 Configuration 35 Definition 9 Description 10 Layer Directory 34 Point Layer Configuration Layer Types 10 Copy Layer 56 Area Group Layers 11 6 Delete Layer 5 Point Layers 10 Edit Layer 55 Radius Relationship Layers 10 Save Layer 55 Region Relationship Layers 11 Test Settings 55 Overview 34 Point Layers Point 35 145 Radius Relationship 146 Auto ClassificationTheme 50 Relationship 57 146 Creating a Theme 40 Data Columns Section 39 Main Menu 25 Deleting a Theme 54 Map Intelligence Editing a Theme 54 Definition 8 Layer Properties Section 36 Map Intelligence Client Multiple Image Icon Theme 47 Definition 8 Multiple Shape Icon Theme 43 Map Intelligence Layer 145 Opening the Configuration screen 35 Point Properties Section 37 Map Intelligence Server 145 Single Image Icon Theme 45 Definition 8 Single Shape Icon Theme 40 Mapping Viewer 145 Themes Section 40 Definition 11 Prerequisites 7 Purpose 5 Relationship Layer Configuration String Aggregation 83 Copy Layer 93 Server Administrators 5
101. n screen Hatch Theme Fact Layer Shot Points Fact Column Whole Ra Function SUM H lt 1000 lt 3000 lt 5000 lt 10000 Outside Threshold Empty Figure 145 Hatch Theme Section Numeric Manual Hatch Map Intelligence Client 3 2 3 for Reporting Services Development Guide 141 Legend z 1 000 00 lt 3 000 00 z 5 000 00 lt 10 000 00 gt 10 000 00 Figure 146 Area Group Layer Map View and Legend showing Manual Hatch Theme UNSHADED AND TRANSPARENT COLORS The Theme Builder Wizard color picker includes the option to select an unshaded color or transparent color For an Area Group layer selecting either the unshaded color or transparent color makes the regions on the map transparent so that the underlying areas can still be seen STRING AGGREGATION Map Intelligence allows the application of function on string values from a specified fact column String aggregations require the specification of a color hatch condition for a specific value instead of a threshold The string functions available are Most Common this function applies the condition if the nominated value is the most common value in the region Uniform this function applies the condition if the nominated value is the only value from the specified column in the region Majority this function applies the condition if the nominated value makes up more than half of the values in the region 2 Creating
102. n the layer Applying a label for each point in the layer is optional 2 On the Url Column drop down list select a column that contains URLs associated with the points in the layer Applying a URL for points in the layer is optional Mote Multiple URLs can be assigned to a point using semi colons to separate names and values The following format is required for the column that is used as a url column lt Name gt lt Url gt space lt Name gt lt Url gt For example Pitney Bowes Web Site http www pitneybowes com Report report pdf From Mapping Viewer the Active Points tool can be used for points that have been assigned to a single URL If a point has been assigned to multiple URLs the active links can be viewed from the Information Panel For further information on the Active Points and Information sections refer to the Mapping Viewer User Manual Map Intelligence Client 3 2 3 for Reporting Services Development Guide 61 3 On the Id Column drop down list select a column that contains unique values Point Properties ube Gom Url Column Url ld Column Figure 36 Point Properties section Label URL and Id Columns 4 Select the radio button of the method to use in plotting points on the map by Coordinates or by Street Address f Coordinates radio button you must specify the columns that contain the Y Latitude and X Mote Longitude values for each point must be specified The coordinate systems t
103. nce Client 3 2 3 for Reporting Services Development Guide 101 10 11 12 13 Configure all other threshold conditions that you wish to associate with a color Click the Values Outside Threshold rectangle then select a color from the color picker to represent any other values that have not been assigned a specific color Click the Empty Values rectangle then select a color from the color picker to represent any region or circle that does not contain any values To delete values assigned to a specific color in the Preview window list click the check box next to the value and click Remove Selected fx Theme Builder r 5 Configure values Outside Threshhold Empty values lt lt Back Save amp Close Next gt gt Figure 92 Theme Builder Wizard Configure Tab Numeric Manual Colors Map Intelligence Client 3 2 3 for Reporting Services Development Guide 102 Save amp Cin 14 Click H Save amp close The Theme Builder Wizard closes The created theme displays in the Theme Section of the Relationship Layer configuration screen Color Theme Fact Laver Shot Points Fact Column Whole Kg Function SUM lt 1000 lt 3000 lt 5000 lt 10000 Outside Threshold Empty Figure 93 Color Themes Section Numeric Manual Colors am 1 000 00 lt 3 000 00 lt 5 000 00 lt 10 000 00 gt 10 000 00 Figure 94 Region Relationship Layer Map View and Legend showing Manual Co
104. nfigure the Layer Properties section 1 On the Layer Name field type the title for the layer Spaces can be used but must not be used at the beginning or end of the layer name For Map Intelligence Wote Servers 3 1 or below only letters numbers and spaces may be used 2 Onthe Data Source Name drop down list select the data source that contains the data to be used as points for this layer 3 Specify a range in which the layer will be visible on the map by entering a Minimum Zoom and Maximum Zoom value The layer will only be visible if the current map width is within the specified minimum and maximum zoom values 4 Select the Set Layer as Visible in Map checkbox to make the layer visible on initial access of the Mapping Viewer Map Intelligence Client 3 2 3 for Reporting Services Development Guide 60 5 Select the Enable Popups checkbox to enable information pop ups on initial access of the Mapping Viewer i Information Pop ups provide further information about a point when you move your mouse over the point on Mote the map See Display Information below Layer Properties Layer Name Shot Points Data Source Name ShotPoirts Maximum Zoom km Set layer as visible in map Enable Popups Figure 35 Layer Properties Section POINT PROPERTIES SECTION To configure the Point Properties section 1 On the Label Column drop down list select a column that contains the values to appear on the labels for each point i
105. ng Empty int paramCount 0 foreach ReportParameterInfo paramInfo in parameters List lt string gt defaults new List lt string gt foreach ValidValue value in paramInfo ValidValues defaults Add value Value parm paramCount new ReportParameter paramInfo Name defaults ToArray paramCount 1 RenderReport reportViewerlID parm return GetMapURL reportViewerID userID foreach string layerName in layerList string selections GetSelectedItems layerName reportViewerID userID for int i 0 i lt selections Length i if i 0 filterCol selections i else if values Contains selections i values selections i int startPos values LastIndexOf values values Remove startPos 1 tblFilter Add filterCol values filterCol string Empty values string Empty J int parameterCount 0 foreach ReportParameterInfo paramlnfo in parameters if tblFilter Contains paramInfo Name List lt string gt filterList new List lt string gt Map Intelligence Client 3 2 3 for Reporting Services User Manual 27 string filters tblFilter paramlnfo Name ToString string tilterArray filters Split foreach string filter in filterArray if filter string Empty filterList Add filter parm parameterCount new ReportParameter paramInfo Name filterList ToArray
106. ntelligence Client 3 2 3 for Reporting Services Development Guide 100 SELECTING COLORS 1 On the Visual Feature options click the Colors radio button Theme Builder a Features Visual Feature Colors Hatches Fil Opacy Border Opacity Border Thickness lt lt Back Save amp Close Next gt gt Figure 91 Theme Builder Wizard Features Tab Numeric Manual Colors Features Rendering Attributes 2 On the Fill Opacity field enter a number from 0 to 1 to indicate the opacity of the colored regions inthe layer 3 On the Border Opacity field enter a number from 0 to 1 to indicate the opacity of region borders in the layer 4 Onthe Border Thickness field enter a number from 0 to 1 to indicate the thickness in points or pixels depending on the GIS provider of the region borders in the layer 5 On the Border Color field enter a hexadecimal color value or select a color from the color picker for the region border color The default color is black 000000 Examples of using various Feature Attributes can be seen in Appendix B Features Rendering Attributes on Note Page 162 6 Click the Configure tab or the Next button The Configure tab opens 7 Enter a threshold value in the top field 8 Click the rectangle next to the field 9 Select a color from the color picker to represent the threshold value The selected threshold value and associated color displays in the preview window list Map Intellige
107. o 1 to indicate the thickness in points or pixels depending on the GIS provider of the region borders in the layer 5 On the Border Color field enter the hexadecimal color value or select a color from the color picker for the region border color The default color is black 000000 6 On the Hatch Color field enter a hexadecimal color value or select a color from the color picker for the hatch color The default color is black HOOOOOO 7 Click the Configure tab or the Next button The Configure tab opens 8 Click the Class 1 hatched rectangle 9 Select a hatch from the picker 10 Repeat the above steps for each class 11 Click the Empty Hatch hatched rectangle Map Intelligence Client 3 2 3 for Reporting Services Development Guide 134 12 Selecta hatch to indicate value less region and click OK Fr Mote The hatched rectangles change to the new hatch after each selection Theme Builder 5 Configure Class 1 Class 2 Class 3 Class 4 Empty Hatch lt lt Back Save amp Close Next gt gt Figure 135 Theme Builder Wizard Configure Tab Numeric Automatic Hatches 5 amp Clo 13 Click FH save amp close The Theme Builder Wizard closes The created theme displays in the Hatch Theme Section of the Area Group Layer configuration screen Hatch Theme Fact Column Function Scheme Class 1 Hatch Class 2 Hatch Class 3 Hatch Class 4 Hatch Empty Hatch Figure 1
108. o indicate the opacity of region borders in the layer 4 On the Border Thickness field enter a number from 0 to 1 to indicate the thickness in points or pixels depending on the GIS provider of the region borders in the layer 5 On the Border Color field enter a hexadecimal color value or select a color from the color picker for the region border color The default color is black 000000 6 Click the Configure tab or the Next button The Configure tab opens 7 Enter a threshold value in the top field 8 Click the rectangle next to the field Map Intelligence Client 3 2 3 for Reporting Services Development Guide 137 9 Selecta color from the color picker to represent the threshold value The selected threshold value and associated color displays in the preview window list 10 Configure all other threshold conditions to associate with a color 11 Click the Values Outside Threshold rectangle then select a color from the color picker to represent any other values that have not been assigned a specific color 12 Click the Empty Values rectangle then select a hatch from the picker to represent any value less region or circle 13 To delete values assigned to a specific color in the Preview window list click the check box next to the value and click Remove Selected Theme Builder Values Outside Threshhald Empty values lt lt Back Save amp Close Next gt gt Figure 140 Theme Builder Wizard C
109. o use for the layer can also be specified if the inherent coordinate system of the selected map is not intended for use If Street Address is selected the columns that contain the Street Address City State and Post Code Zip Code values for each point must be specified A coordinate system provides a frame of reference for measuring locations on the surface of the earth A full list of acceptable coordinate systems is available in the Coordinate Systems document This field is optional For maps with projected coordinate systems when setting Center Point properties the Y coordinate or Northing is set in the latitude field and the X coordinate or Easting in the longitude field These settings are in the units of the underlying map usually meters rather than degrees For maps with projected coordinate systems the longitude is set to the column of the X coordinate and the latitude is set to the column of the Y coordinate in Point layers Coordinates Street Address x Longitude Longitude Y Lattitude Latitude Figure 37 Point Properties Section Coordinates Option t Coordinates G Street Address Street Street Address suburb Subuh state Stat Post Code Post Code Figure 38 Point Properties Section Street Address option The Street Address option will only work if a geocoder has been installed or in ArcIMS if the map layer is Wote 8eocoded Map Intelligence Client 3 2 3 for Reporting Services
110. of region borders in the layer On the Border Thickness field enter a number from 0 to 1 to indicate the thickness in points or pixels depending on the GIS provider of the region borders in the layer On the Border Color field enter the hexadecimal color value or select a color from the color picker for the region border color The default color is black H000000 On the Hatch Color field enter a hexadecimal color value or select a color from the color picker for the hatch color The default color is black HOOOOOO P Examples of using various Feature Attributes can be seen in Appendix B Features Rendering Attributes on Mote page 162 Click the Configure tab or the Next button The Configure tab opens Click the Class 1 hatched rectangle Select a hatch from the picker Repeat the above steps for each class Map Intelligence Client 3 2 3 for Reporting Services Development Guide 96 11 Click the Empty Hatch hatched rectangle 12 Selecta hatch to indicate value less regions and click OK Mote The hatched rectangles will change to the new hatch after each selection Theme Builder 5 Configure Class 1 Class 2 Class 3 Class 4 Empty Hatch a lt Back Save amp Close Next gt gt Figure 86 Visual Theme Properties Section showing Hatches Selected Map Intelligence Client 3 2 3 for Reporting Services Development Guide 97 Save amp Close 13 Click FH save amp close The Theme B
111. olumns 4 On the Icon Shape drop down list select the shape that you want to use to represent each point in the layer Theme Builder 1 Theme Type Theme Type Multi Shape Icon Column Name Icon Shape lt lt Back OH Save amp Close Next gt gt Figure 62 Theme Builder Wizard Theme Type Tab 5 Click the Configure tab or the Next button The Configure tab opens Map Intelligence Client 3 2 3 for Reporting Services Development Guide TA 6 Selecta value from the value list box on the right Mote n some instances only a sub set of values will be displayed in the value list box Click Bho display all values Be aware that large datasets may take some time to process 7 From the color swatch click the color to represent the selected value The chosen color displays next to the value in the value list Using the Selection Arrow Buttons Associates a color randomly to the selected value Pe a4 If a particular color to use is not shown on the color swatch type the hexadecimal value directly into the Tip field below the color swatch Theme Builder 5 Configure Arrow squid Cuttlefishes Flathead Jackass Morwong Latchet Ocean Perch lt Back Save amp Close Next gt gt Figure 44 Theme Builder Wizard 5 Configure Multiple Shapes 8 Repeat the steps above if you want to assign themes to other columns Save amp Close 9 Click The Theme Builder
112. on 1 On the Name drop down list select the data source to be used for this layer Area Group layers require a join between a column in the data source and a column in the built in map layer Wate tO shade Matching values are required from these two columns for the Area Group layer to work 2 On the ID Column drop down list select the column from the data source that corresponds to the column in the built in map layer Region ID Column 3 On the Fact Column drop down list select the column that contains the values to be measured for this layer Map Intelligence Client 3 2 3 for Reporting Services Development Guide 120 F For numeric aggregation you do not need to specify a fact column when using the Count function Mote 4 Onthe Reference Region Layer drop down list select the built in map layer to shade or apply a color to Mote Torefresh the Reference Region Layer drop down list click 2 Only layers containing regions can be used as reference layers Built in layers are arranged in a particular order on the map When selecting a built in layer to shade all map layers that sit under the selected layer are covered by the selected color or hatch 5 On the Region ID Column field specify the built in map layer column that contains values that match the ones in the specified ID Column 6 On the Label Column drop down list select the column in the map layer that contains the values to be used as labels for the re
113. on Server even though there are existing reports in the server For Reporting Services 2005 and 2008 check through Home gt Properties gt Security GLOBAL SETTINGS ISSUES Problem Description Solution s Failed to read maps from server Check if the server and port settings entered on the Map Intelligence Server field are correct This message displays when retrieving available map from the gt Map Intelligence Server Check if the Map Intelligence Server and included GIS gt servers is already running LAYER ISSUES Map Intelligence Client 3 2 3 for Reporting Services Development Guide 153 Problem Description Failed to extract data from lt DataSource name gt data source No data was returned This message displays when the Multiple Shape Image Icon theme type is selected The Theme Builder data is insufficient incomplete when the Multiple Image Shape Icon theme type is selected gt gt Solution s Check the reporting services version property in the client properties file Refer to the client oroperties section for more information Check the permissions granted for the logged in user Make sure that the user is included in the Reporting Services Security Group User For Reporting Services 2005 check through Site Settings gt Security gt Configure Site Wide Security For Reporting Services 2008 check through Site Settings gt Security If the query command type of the
114. on the Area Group Layer configuration screen NUMERIC AGGREGATION LAYERS Map Intelligence allows the application of function on values from a specified column The specified built in map layer is shaded according to the resulting values The available numeric functions are Count Sum Min Max Mean and Median 2 Creating a theme based on a Numeric Aggregation Them 1 Click 9 Theme The Theme Builder Wizard displays with the Theme Type tab open by default 2 The Fact Column drop down list displays the previously selected column on the Area Group Layer configuration screen To change the column select another column from the Fact Column drop down list Any changes to the Fact Column through the Theme Builder Wizard are reflected on the Fact Column field of Mote the Area Group Layer configuration screen 3 On the Data Type options select the Numeric radio button Theme Builder 1 Theme Type Fact Column Data Type Numeric String lt lt Back Save amp Close Next gt gt Figure 124 Theme Builder Wizard Theme Type Tab Numeric 4 Click the Data tab or the Next button The Data tab opens 5 On the Aggregation Function drop down list select the function to use for the layer The available numeric functions are Count Sum Min Max Mean and Median 6 For the Calculation option click either the by Value or by Percentage radio button Map Intelligence Client 3 2 3 for Reporting Services
115. onfigure Tab Numeric Manual Colors 8 amp Clo 14 Click FH save amp close The Theme Builder Wizard closes The created theme displays in the Theme Section of the Area Group Layer configuration screen Map Intelligence Client 3 2 3 for Reporting Services Development Guide 138 Color Theme Fact Laver Shot Points Fact Column Whole Kg Function SUMI E 1000 lt 3000 lt 5000 lt 10000 Outside Threshold Empty Figure 141 Color Themes Section Numeric Manual Colors lt 1 000 00 lt 3 000 00 lt 5 000 00 lt 10 000 00 gt 10 000 00 Figure 142 Area Group Layer Map View and Legend showing Manual Color Theme Map Intelligence Client 3 2 3 for Reporting Services Development Guide 139 SELECTING HATCHES 1 10 11 On the Visual Feature options click the Hatches radio button Theme Builder 4 Features Visual Feature C Colors Hatches Hatch Color a lt lt Back Save amp Close Next gt gt Figure 143 Theme Builder Wizard Features Tab Numeric Manual Hatches Features Rendering Attributes On the Hatch Opacity field enter a number from 0 to 1 to indicate the opacity of the hatches On the Border Opacity field enter a number from 0 to 1 to indicate the opacity of region borders in the layer On the Border Thickness field enter a number from 0 to 1 to indicate the thickness in points or pixels depending on the GIS provider of the region border
116. oordinate Systems document Data Columns Data Columns are columns in a report that are sent to the Map Intelligence Server and have their values available in the Mapping Viewer Data column values are displayed in the map data screen and popups that appear when you move your mouse over a point in the map Data columns can also be used as fact or theme columns Fact Columns A fact column is a data column that can have a string or numeric aggregation applied to it by a Relationship layer Hatching Hatching is overlaying a pattern on top of a polygon allowing it to be distinguished visually rather than by using color Map Intelligence Client 3 2 3 for Reporting Services Development Guide 170 Image Icons Icons are used to visually represent points on a map Icons can be symbols image files selected by the user or colored shapes Layers A layer is a set of spatial features displayed on a map Objects in a layer are usually grouped logically e g capital cities or parks Each feature in a layer has the same set of data attributes so a layer is in many ways like a relation table in a relational database Map Intelligence Layer A Map Intelligence Layer is a layer defined in the Map Intelligence Client These layers display data in a report geographic features on a map Map Intelligence Server The Map Intelligence Server is the engine that takes requests from the Map Intelligence Client and Mapping Viewer and responds by di
117. opacity of the colored regions in the layer 3 On the Border Opacity field enter a number from 0 to 1 to indicate the opacity of region borders in the layer 4 On the Border Thickness field enter a number from 0 to 1 to indicate the thickness in points or pixels depending on the GIS provider of the region borders in the layer 5 On the Border Color field enter a hexadecimal color value or select a color from the color picker for the region border color The default color is black 000000 Examples of using various Feature Attributes can be seen in Appendix B Features Rendering Attributes on Note Page 162 6 Click the Configure tab or the Next button The Configure tab opens 7 Click the Start Color colored rectangle 8 Select the start color from the color picker and click OK 9 Click the End Color colored rectangle 10 Select the end color from the color window and click OK Map Intelligence Client 3 2 3 for Reporting Services Development Guide 93 11 Click the Empty Color colored rectangle 12 Selecta color to indicate value less region and click OK P Mote The colored rectangles will change to the new color chosen after each selection If the color picker does not have the exact color you wish to use you can right Click the colored rectangle and Tip manually enter the hexadecimal color value Theme Builder 5 Configure Start Color End Color Empty Color lt lt Back HH Save
118. or for each class Color Range use to choose a start and end color Hatches use to specify a particular hatch for each class SELECTING SPECIFIC COLORS 1 On the Visual Feature click the Specific Colors radio button Theme Builder 4 Features S visual Feature Specific Colors Color Range Hatches Fill Opacity Border Opacity Border Thickness 1 lt lt Back Save amp Close Next gt gt Figure 127 Theme Builder Wizard Features Tab Numeric Automatic Specific Colors Features Rendering Attributes 2 On the Fill Opacity field enter a number from 0 to 1 to indicate the opacity of the colored regions inthe layer 3 On the Border Opacity field enter a number from 0 to 1 to indicate the opacity of region borders in the layer GIS provider of the region borders in the layer Map Intelligence Client 3 2 3 for Reporting Services Development Guide On the Border Thickness field enter a number from 0 to 1 to indicate the thickness in points or pixels depending on the 5 On the Border Color field enter a hexadecimal color value or select a color from the color picker for the region border color The default color is black 000000 6 Click the Configure tab or the Next button The Configure tab opens 7 Click the Class 1 colored rectangle 8 Select a color from the color picker 9 Repeat the above steps for each class 10 Click the Empty Color colored rectangle 11
119. our analysis layers CONFIGURATION SCREENS There are four configuration screens Global Settings m Point Layers Global Settings Relationship Layers Lal slwe f l Test Report Crime Analysis 2 Area Group Layers Server Settings Map intelligence Ser I imperil Matric This tab re displays the report explorer login details and the layer directory Figure 20 Configuration Tabs Each configuration screen can be accessed by clicking the relevant tab at the top of the screen i AURA NE TTT The Main Menu appears at the top of each configuration screen Point Layers Cd hew copy Save Q Delete fr Test Layer Properties Display information Layer Name Main Menu area Selected Report indicator Figure 21 Main Menu Map Intelligence Client 3 2 3 for Reporting Services User Manual 49 The following table explains the features of the Main Menu a w 5585 To test your configuration settings click the Test button a new browser window will open displaying your layer configuration To clear all fields and set the properties for a new layer click the New button This button does not feature on the Global Settings Main Menu To make a copy of a layer click the Copy button This button does not feature on the Global Settings Main Menu To save your configuration screen settings click the Save button Note This button is global and will save all changes made to all configura
120. p Intelligence server and port to use Previously entered servers are available from the drop down list 2 On the Map Name drop down list select the map to display the analysis layers e TheMap Name drop down list contains all the maps that have been added during the Map Intelligence server Note configuration Consult your Map Intelligence Server Administrator if the map you wish to use is not available in the drop down list Map Intelligence Client 3 2 3 for Reporting Services Development Guide 51 e Torefreshthe Map Name drop down list click 3 On the Title field type the title of the map The indicated title appears at the top panel of the Mapping Viewer This field is optional See the following figure Fish Catch Analysis Map Title Map Logo Figure 23 Mapping Viewer Top Panel showing the title Fish Catch Analysis and Fisheries Logo 4 On the Logo field type the file name of the image to use as a map logo This image appears at the top panel of the Mapping Viewer This field is optional See the preceding figure The specified file for the logo must be located in the Images folder of the Map Intelligence directory on the server Mote machine The recommended size for the image is 70 x 70 pixels Larger images may cover some elements or change the format of the Mapping Viewer Server Settings SEMEL cases pam ea Title Fish Catch Analysis Logo fishenes_ gi Figure 24 Server Settings Section
121. r f lt ItemTemplate gt lt HeaderStyle Width 5 gt lt asp TemplateField gt lt asp TemplateField gt lt HeaderTemplate gt amp nbsp lt asp Label ID Labell1 runat server Text DAY OF WEEK gt lt asp Label gt lt HeaderTemplate gt lt ItemTemplate gt lt asp Label ID lblDayOfWeek runat server Text Eval Day Of Week gt gt lt asp Label gt lt ItemTemplate gt lt HeaderStyle Width 65 gt lt asp TemplateField gt lt Columns gt lt RowStyle Font Size Smaller gt lt HeaderStyle BackColor DarkOrange Font Size Small ForeColor White gt lt AlternatingRowStyle BackColor EQOEOEO BorderColor Black BorderStyle Solid BorderWidth 1px gt lt asp GridView gt 7 O lt tr gt CL lt td width 205 gt lt asp GridView ID grdCrimeType runat server AutoGenerateColumns False Width 70 Font Names Calibri gt lt Columns gt lt asp TemplateField gt lt HeaderTemplate gt lt asp CheckBox ID chkAll runat server J gt lt HeaderTemplate gt lt ItemTemplate gt lt asp CheckBox ID chkItem runat server gt lt ItemTemplate gt lt HeaderStyle Width 5 gt lt asp TemplateField gt Map Intelligence Client 3 2 3 for Reporting Services User Manual 33 lt asp TemplateField gt lt HeaderTemplate gt lt asp Label ID Label3 runat server Text CRIME TYPE gt lt asp Label gt lt HeaderTemplate gt lt ItemTemplate gt lt asp Lab
122. rd Tip Placing your cursor over an image will display the actual image size in the Preview box above gt Theme Builder x 5 Configure Choose an image Lid ddd Current E E E F Selection K K KE Indicator 6806060 hhh ha wm 7 lt lt Back Save amp Close Next gt gt Figure 48 Theme Builder Wizard 5 Configure Single Image In this example the image selected represents ocean platforms Map Intelligence Client 3 2 3 for Reporting Services Development Guide 70 Save amp Close 5 Click FH Save 8 Close The Theme Builder Wizard closes The created theme displays on the Theme Section of the Point Layer configuration screen Themes Single Image Icon Theme Image l Figure 49 Themes Section showing Single Image Icon Theme Theme 3 Man aik les a areh D e ptiot Eeten ce t Hay Figure 50 Map View and Legend showing the Single Image Icon Theme we can see here the position of ocean platforms are themed using the platform image Creating q Multiple Image Icon Theme 1 Click The Theme Builder Wizard displays with the Theme Type tab open by default 2 Onthe Theme Type drop down list select Multiple Image Icon Map Intelligence Client 3 2 3 for Reporting Services Development Guide 71 3 On the Column Name drop down list select a column to configure this list contains all selected data columns Theme Builder 1 Theme Type Theme Type Multiple I
123. rdValueOfCrime Rows CheckBox chk CheckBox rowItem FindControl chkItem if chk Checked true amp amp rowltem RowType DataControlRowType DataRow Label lbl Label rowItem FindControl lblValueOfCrime valueOfCrime Add lbl Text parm 3 new ReportParameter Band valueOfCrime ToArray rptvw ServerReport ReportPath reportPath ReportingObject RenderReport rptVw parm MapFrame Attributes Add src ReportingObject GetMapURL rptVw MapFrame Visible true lt summary gt This Method is used to refresh the report based on the selection made on the map lt summary gt lt param name sender gt lt param gt lt param name e gt lt param gt Protected vold btnGetMapFrilter Click object sender EventArgs e string reportPath Integeo Demo Reports SG Crime Analysis rptvVvw ServerReport ReportPath reportPath MapFrame Attributes Add srce ReportingObject GetMapFilter rptVw Page User Identity Name MapFrame Visible true Map Intelligence Client 3 2 3 for Reporting Services User Manual 39 b 22 To view the web page click on the toolbar area as shown below gl J Go x Sa amp 9 Z E DP sbus NET BR 95 Q wesw ov Figure 31 The Debug Run Button 23 On the web page you should be able to see the following screen Integeo Demo Crime Analysis E CRIME STATUS I Apprehended At large I Unkno
124. require you to specify a color hatch condition for a specific value instead of a threshold The available string functions include Most Common this function applies the condition if the nominated value is the most common value in the region Uniform this function applies the condition if the nominated value is the only value from the specified column in the region Majority this function applies the condition if the nominated value makes up more than half of the values in the region Creating a theme based on a String Aggregation Them 1 Click 39 Theme the Theme Builder Wizard displays with the Theme Type tab open by default 2 On the Point Layer drop down list select the Point Layer containing the points to geographically relate to the reference layer F When related to a built in region layer the points are grouped according to the regions they are contained in Wote When related to another Point Layer the points are grouped according to which points in the reference layer they fall within the given radius of Map Intelligence Client 3 2 3 for Reporting Services Development Guide 107 3 On the Column drop down list select the column to use to color the regions The data for this column are extracted from the points and aggregated according to the geographical group of the points Map Intelligence Client 3 2 3 for Reporting Services Development Guide 108 4 Selectthe String radio button fx Theme Buil
125. rimeStatus Rows CheckBox chk CheckBox rowltem FindControl chkItem Map Intelligence Client 3 2 3 for Reporting Services User Manual 38 Page User Identity Name Eri oe if chk Checked true amp amp rowltem RowType DataControlRowType DataRow Label lbl Label rowItem FindControl lblCrimeStatus crimeStatus Add lbl1 Text parm 0 new ReportParameter CrimeStatus crimeStatus ToArray Iterate through the Day of Week Grid and get the value of the selected item foreach GridViewRow rowlItem in grdDayOfWeek Rows CheckBox chk CheckBox rowItem FindControl chkItem if chk Checked true amp amp rowltem RowType DataControlRowType DataRow Label lbl Label rowltem FindControl lblDayOfWeek dayOfWeek Add lb1l Text parm 1 new ReportParameter DayOfWeek dayOfWweek ToArray TIterate through the Crime Type Grid and get the value of the selected item foreach GridViewRow rowItem in grdCrimeType Rows CheckBox chk CheckBox rowItem FindControl chkItem if chk Checked true amp amp rowltem RowType DataControlRowType DataRow Label lbl Label rowItem FindControl lb1lCrimeType crimeType Add lbl Text parm 2 new ReportParameter CrimeType crimeType ToArray TIterate through the Value Of Crime Grid and get the value of the selected item foreach GridViewRow rowltem in g
126. rol 19 On the Properties window change the ID of the ReportViewer to rptVw 20 On the Solution Explorer select CrimeAnalysis aspx then switch to Code View By click the View Code button as shown below Solution Explorer Solution Demo 1 project gt H x 2 2 235 5 F Solution Demo 1 project E C RSIntegeo Demo App_Code Gop Data gee CrimeAnalysis aspx Figure 30 Solution Explorer Map Intelligence Client 3 2 3 for Reporting Services User Manual 36 21 Replace all codes from the code view with the following codes using System using System Data using System Data Sq1Client using System Configuration using System Collections using System Collections Generic using System Web using System Web Security using System Web UI using System Web UI WebControls using System Web UI WebControls WebParts using System Web UI HtmlControls using Microsoft Reporting WebForms public partial class CrimeAnalysis System Web UI Page protected void Page load object sender EventArgs if IsPostBack DisplayCrimeStatus DisplayCrimeType DisplayDayOfWeek DisplayCrimeValue lt summary gt This method is in charge for displaying the Crime Status lt summary gt private void DisplayCrimeStatus string query SELECT DISTINCT Statusotcriminal FROM 6G CRIME grdCrimeStatus DataSource GetList query grdCrimeStatus Da
127. rs in the layer On the Border Color field enter the hexadecimal color value or select a color from the color picker for the region border color The default color is black 000000 On the Hatch Color field enter a hexadecimal color value or select a color from the color picker for the hatch color The default color is black HOOOOOO Click the Configure tab or the Next button The Configure tab opens On the top drop down list select a value from the specified fact column Mote In some instances only a sub set of values displays in the value list box Click Slo display all values Be aware that large datasets may take sometime to process On the top drop down list select a value from the specified fact column Map Intelligence Client 3 2 3 for Reporting Services Development Guide 148 10 11 12 15 14 15 16 17 Click the rectangle next to the drop down list Select a hatch from the picker to associate with the selected value The selected value and associated hatch displays in the preview window list Configure any other values that you wish to associate with a hatch Any values not assigned a specific hatch will be hatched according to the hatch assigned to Other Values See Mote the following discussion Click the Empty Values rectangle and select a hatch from the picker to represent any value less region Click the Conflict Values rectangle and select a hatch from the picker to repre
128. runat server AutoGenerateColumns False Width 70 Font Names Calibri gt sC O T mirus gt lt asp TemplateField gt lt HeaderTemplate gt lt asp CheckBox ID chkAll runat server lt HeaderTemplate gt lt ItemTemplate gt lt asp CheckBox ID chkIitem runat server lt ItemTemplate gt lt HeaderStyle Width 5 gt lt asp TemplateField gt lt asp TemplateField gt lt HeaderTemplate gt Map Intelligence Client 3 2 3 for Reporting Services User Manual 32 lt asp Label ID Label2 runat server Text CRIME STATUS gt lt asp Label gt lt HeaderTemplate gt lt ItemTemplate gt lt asp Label ID l1b1CrimeStatus runat server Text KS Eval Statusorcriminal H gt lt asp Label gt lt ItemTemplate gt lt HeaderStyle Width 65 gt lt asp TemplateField gt lt Columns gt lt RowStyle Font Size Smaller gt lt HeaderStyle BackColor DarkOrange Font Size Small ForeColor White gt lt AlternatingRowStyle BackColor EQOEOEO BorderColor Black BorderStyle Solid BorderWidth 1px gt lt asp GridView gt st r lt tr gt SEES lt td width 20 gt lt asp GridView ID grdDayOfWeek runat server AutoGenerateColumns False Width 70 Font Names Calibri gt lt Columns gt lt asp TemplateField gt lt HeaderTemplate gt lt asp CheckBox ID chkAll runat server To lt HeaderTemplate gt lt ItemTemplate gt lt asp CheckBox ID chkItem runat serve
129. rvice type System Web Configuration ScriptingProfilesServicesSection System Web Extensions Version 1 0 61025 lt section name authenticationsService type System Web Configuration Scripting uthenticationServiceSection System Web Extensions Vers H lt sectionGroup gt lt sectionGroup gt lt sectionGroup gt lt configSections gt m lt system web gt lt pages gt lt controls gt lt add tagPrefix asp namespace System Web UI assembly System Web Extensions Version 1 0 61025 0 Culture neutral PublicKeyToken 31bf lt controls gt lt pages gt lt set compilation debug true to insert debugging symbols into the compiled page Because this Figure 20 Adding MI Configuration Settings 11 Copy the following configuration settings and paste it after the lt configSections gt element lt appSettings gt Map Intelligence Client 3 2 3 for Reporting Services User Manual 24 lt add key MI SERVER value http server gt lt add key MI CLIENT value miclient renderMap documentId gt lt add key PORT NUMBER value 59092 gt lt add key PARAM DELIMITER value gt lt add key REPORT SERVER value http server ReportServer gt lt appSettings gt Figure 215 MI Configuration Settings Below are the sections of the lt appSettings gt KEY DESCRIPTION SAMPLE VALUE MI SERVER The Server name where the MI Client is
130. s aspect ratio The default value is the width of the main map default value is the height of the main map map image not Set to true if you do not want the map image to be interactive The default value clickable is false i e interactive As an interactive map it will use the last foreground tool selected or the zoom to marquee navigation setting map image border You can set a border around the map as a number of pixels The default value is O or no border map image height The height in pixels of the map NOTE that the height will be coerced to the aspect No ratio of the main map if it turns out that the suggested height is greater than the height derived from the scaling of the main map maintaining its aspect ratio The Map Intelligence Client 3 2 3 for Reporting Services Development Guide 157 Here is an example in an iframe lt html gt lt head gt lt meta http equiv Content Type content text html charset utf 8 gt lt head gt lt body onload javascript document forms0O submit document formsl submit return true gt lt iframe name mapImage width 400 height 300 frameborder 0 gt lt iframe gt lt form action http localhost 11090 mapIntelligence componentServlet method post target mapImage gt lt input type hidden name frontendComponent value map image component gt lt input name userid type hidden value 5294334027507255954526495945 gt lt input name m
131. s in the layer On the Border Color field enter the hexadecimal color value or select a color from the color picker for the region border color The default color is black HOOOOOO On the Hatch Color field enter a hexadecimal color value or select a color from the color picker for the hatch color The default color is black 4000000 Click the Configure tab or the Next button The Configure tab opens Enter a threshold value in the top field Click the rectangle next to the field Select a hatch from the picker to represent the threshold value The selected threshold value and associated hatch displays in the preview window list Configure all other threshold conditions to associate with a hatch Map Intelligence Client 3 2 3 for Reporting Services Development Guide 140 12 Click the Values Outside Threshold rectangle then select a hatch from the picker to represent any other values that have not been assigned a specific hatch 13 Click the Empty Values rectangle then select a hatch from the picker to represent any value less region or circle 14 To delete values assigned to a specific color in the Preview window list click the check box next to the value and click Remove Selected Theme Builder Values Outside Threshhald Empty Save amp Close 15 Click the FH Save amp close The Theme Builder Wizard will close The theme will now be displayed in the Theme Section of the Area Group Layer configuratio
132. sb Append reportPath foreach ReportParameterInfo info in parameterCollection foreach string value in info Values if info Values Count gt 1 temp string Format 0 1 value PARAM DELIMITER else temp value sb Append string Format amp 0 1 info Name temp url sb ToString url connToken return url REPORT CREDENTIALS using System using System Data using System Configuration using System Web using System Web Security using System Web UI using System Web UI WebControls using System Web UI WebControls WebParts using System Web UI HtmlControls lt summary gt Summary description for ReportCredentials lt summary gt public class ReportCredentials Microsoft Reporting WebForms ITReportServerCredentials Map Intelligence Client 3 2 3 for Reporting Services Development Guide 168 string userName password domain public ReportCredentials string userName string password string domain _userName userName _password password _domain domain public System Security Principal WindowsIdentity ImpersonationUser get return null public System Net ICredentials NetworkCredentials get return new System Net NetworkCredential _ userName password domain public bool GetFormsCredentials out System Net Cookie authCoki out string userName out string password ou
133. script security issues with the browser use splash screen true limits the number of rows returned when creating theme th max rows to colors i nows 26 colors to use when using the auto shape theme for point layers 4uto theme o ors FFO000 S0OD0FF 400FFOD FFFFOO 4FFCC33 009900 AFFOCOC OSFFFF 9999FF CCIICT FFEFFF 2000000 COCOCO FFEGO0 0999900 acc S9CK 19339999 000099 OF FCCFF 4666666 990000 CC6600 OCC 993 9006600 PEEFFFF 6666CC filter serviet for DO implementation efilter serviet Http mapsyri 42000 bus i nessobjects enterprise1ls desktop aurich vi ewer s cdr_advs vI i This directory 15 used by the C VClieont It points to the location of that will be usted jdata file dir D Tengp OO Reporting Trying not t Suk aportinguser lt rylntegeo amie report generation delimiter To Indicate If the default va arameter will be use This ts applicable only if the report has a4 get default value false default value for data type If not specifie String Boolean True DateTime lt 19850101 Integer 0 Float 0 limits the number of rows returned when doing 4 testing and actual map rendering a value of zero or less than means unlimited number of rows to be retrieved Testetax row 500 render ax roOws Q reporting service version rd12005 a rs version 2005 iii Nl Figure 16 cl
134. sent any region that does not meet any specified condition e g a conflict condition will be returned if the Uniform function has been set and there is more than one type of value present in the region Click the Other Values rectangle and select a hatch from the picker to represent any values that have not been assigned with a specific hatch Theme Builder C H soari r poate r HH seats Remove Selected Empty values III Conflicting values gt Other values SSS lt Back Save amp Close Next gt gt igure To delete values assigned to a specific hatch in the Preview window list click the check box next to the value and click Remove Selected 3 5 amp Clo Click E save amp ciose The Theme Builder wizard closes The created theme displays in the Theme Section of the Area Group Layer configuration screen Map Intelligence Client 3 2 3 for Reporting Services Development Guide 149 Hatch Theme Fact Column gt oF wy K Pe m co 7 3 a s Function Empty Hatch Conflict Hatch Other Values BOAT BOAT BOATS BOAT4d BOATS BOAT6 IANS s Figure 155 Hatch Theme String Hatch Figure 156 Area Group Layer Map View and Legend showing Hatch Theme String Hatch This completes all the theme options for area group layers Map Intelligence Client 3 2 3 for Reporting Services Development Guide 150 TO TEST YOUR SETTINGS To
135. site window select the ASP NET AJAX Enabled Web Site template On the Location drop down list select File System and click on the Browse button where you wish to save the ASP NET Website and click OK as shown below Map Intelligence Client 3 2 3 for Reporting Services User Manual 19 New Web Site Templates isual Studio installed templates ASP NET Web Service wh Empty Web Site Bun Web Site My Templates udSearch Online Templates ER Personal Web Site Starter Kit bASP NET Crystal Reports web Site ASP NET 434 enabled Web site Location File System ciRSIntegeo Demo Lanquage Visual C T Browse Figure 14 New Website window 4 Apa eds as shown on the following figure On the Solution Explorer right click on the Website go to Add ASP NET Folder and click on 39 Demo 3 Microsoft Yisual Studio ma la xj File Edit View Website Build Debug Tools Test Window Community Help H E gt 22 l 8 X Ba 8 Os SB ER Debug Y NET gt 89 substation SER BOs ig m l s amp g _ Default aspx Start Page Page x Se ee ee es gt Xx Client Objects amp Events io Events lt 3 Page Language C AutoEventWireup true CodeFile Default aspx cs Inherits _ Default lt DOCTYPE html PUBLIC W3C DTD XHTML 1 0 Transitional EN http www w3 org TR xhtmli DTD g lt html xmlns http uwww w3 org 1999 x
136. splaying maps and associated information Mapping Viewer The Mapping Viewer displays the layers configured by the Layer Designer on the specified map The Mapping Viewer is viewed in a browser and provides controls that allow the end user to manipulate the map to return the desired analysis Point A point is a geographic feature with a single pair of coordinates These are used to represent objects or events e g house or accident locations Point Layer Point layers are map layers where data is represented on the map as discrete point images or symbols For example a particular layer might represent the location of stores as push pin icons and another layer could represent accidents as colored dots where the color theme represents the severity of the accident Typically the rows in a table of data belong to a business concept such as people or address details where each column is an attribute of that concept Thus each row in your business data can be represented as an individual point in a point layer In Map Intelligence point layers form the foundation for relationship layers Radius Relationship Layer Radius relationship layers are circular regions with themes around certain points of interest that show information about other points that fall within that circular region These layers are generated by Map Intelligence They are based on calculations made by Map Intelligence on the specified data values as specified by the layer desi
137. sted below Most Recent The last viewed extent will be used No Lock The extent will be calculated on a bounding box around the visible data Disabled The extent lock will be based on the Extent Lock setting selected by the user in the Mapping Viewer If a center point is specified in the Center Point Section the view of the map adheres to this center point Subsequent requests in the session adhere to the lock specified by the client On the Map View Width field type the width of the Map View in pixels Map Intelligence Client 3 2 3 for Reporting Services Development Guide 54 i The Map View Width and Height settings override the default settings set by the Server Administrator Preferences Units C Imperial Metric Delimiters 1st and Extent Lock Map wiew width Map wiew Height Figure 28 Preferences Section Map Intelligence Client 3 2 3 for Reporting Services Development Guide STYLES SECTION The Styles section allows you to configure the look and feel of the Mapping Viewer The color of the following elements can be changed m Background Buttons m Header Background 7 Panel Background Header Text 7 Button Text To change the color of each element 1 Click the colored rectangle next to the element name A color picker displays 2 Select the new color The Style Preview displays the new color If the color picker does not have the exact color you wish to use you can right Cl
138. t lt port number gt miclient where the machine name and port number are those of the configuration server The MIRS 3 2 3 Login page displays MAF INTELLIGENCE Ho Report Selected J Layer Directory Login Details Lizer Mame Patiuanrd server tiga Uwiinqaq rpa E aparqa KORS Lagin Figure 18 MIRS Configuration Login P e The machine name refers the machine you are trying to open a connection to ex ip address or workstation Mote name To port number is the port number on which the server you are trying to connect to is running This is the same port number specified in the Server Settings upon MIRS installation 2 Type the User Name Password Server location and the Authentication type on the fields Map Intelligence Client 3 2 3 for Reporting Services User Manual 47 3 Click the Login button A successful login is indicated by the display of the reports folder on the right AAP PS TELL Mob ACI Ho Report Selected Layer Directory gt Reports Login Detaile Fa EB Integeo Reports mH Qa AD ata User Mame Peseta nd Serer Adthentication Figure 19 Reports Explorer 4 Expand the report folder to view the list of reports 5 Select a report The page loads to display the Global Settings for the selected report Map Intelligence Client 3 2 3 for Reporting Services User Manual 48 MIRS CONFIGURATION OVERVIEW This section looks at the steps required in configuring y
139. t string authority userName userName password password authority domain authCoki new System Net Cookie ASPXAUTH ASPXAUTH w Domain return true Map Intelligence Client 3 2 3 for Reporting Services Development Guide 169 GLOSSARY Areq Group Layer Area Group layers correspond to existing areas on a map The displayed theme is based on data attribute values no spatial calculation is required Instead a column in your business data is designated to have values that match a column in the map data For example an existing map layer of suburbs may correspond to a data column for suburbs where the values are the suburb names Then for transaction data that represents customer complaints and that also contains a suburb column it is possible to make a cross reference between the transaction and the map area using the suburb name An example that would use this correlation is displaying a theme on a suburb s area on the map that reflects the most common complaint type received from that suburb Built in Layer A built in layer is defined by the map on the mapping server rather than the Map Intelligence Client These layers may contain all types of feature such as lines points and regions e g cities rivers and parks Coordinate Systems A coordinate system provides a frame of reference for measuring locations on the surface of the earth A full list of acceptable coordinate systems is available in the C
140. taBind lt summary gt This method is in charge for displaying the Crime Types lt summary gt private void DisplayCrimeType string query SELECT DISTINCT Crimetype FROM SG CRIME grdCrimeType DataSource GetList query grdCrimeType DataBind lt summary gt This method is in charge for displaying the Value of Crime lt summary gt private void DisplayCrimeValue string query SELECT DISTINCT Band FROM SG CRIME grdValueOfCrime DataSource GetList query grdValueOfCrime DataBind lt summary gt This method is in charge of displaying the Days of Week lt summary gt private void DisplayDayOfWeek string query SELECT DISTINCT Day of Week AS Day Of Week FROM SG CRIME grdDayOfWeek DataSource GetList query grdDayOfWeek DataBind lt summary gt This is a function that will return records based on the query defined lt summary gt Map Intelligence Client 3 2 3 for Reporting Services User Manual a7 lt param name queryString gt A valid SQL Statement lt param gt lt returns gt lt returns gt private DataTable GetList string gqueryString Set the correct connections string here The following properties must have a correct value Data Source This is the server name of the database Initial Catalog This is the database name User Id Username used to connect to the database Pass
141. the Layer Properties section 1 On the Layer Name field type a title for the layer 2 Specify the range in which the layer will be visible on the map by entering a Minimum Zoom and Maximum Zoom value The layer is visible if the current map width is within the specified minimum and maximum value 3 Select the Set Layer as Visible in Map checkbox to make the layer visible on the initial access of the Mapping Viewer 4 Select the Enable Popups checkbox to enable information pop ups on the initial access of the Mapping Viewer Information Popup provides further information about a region when you move your mouse over the region Wote onthe map See the following figure Map Intelligence Client 3 2 3 for Reporting Services Development Guide 119 Layer Properties Layer Name Catch by half degree Minimum Zoom km 200 Maximum Zoom km S000 Set layer as visible in map Enable Popups Figure 114 Layer Properties section DATA SOURCE SECTION 2 To configure the Data Source section The Data Source section allows the configuration of the necessary data source settings for the layer Data Source Name ShotPoints Id Column Codehalf Fact Column Whole Kg Reference Region Layer halfdeg Region ID Column Code Label Column Halfdeg_ Legend Description Total kilograms of fish caught within half Popup Description value kg of fish caught in label Figure 115 Data Source secti
142. the current map width is within the specified minimum and maximum values Select the Set Layer as Visible in Map checkbox to make the layer visible on initial access of the Mapping Viewer Select the Enable Popups checkbox to enable information pop ups on initial access the Mapping Viewer r Mote Information Pop ups provide further information about a region on the map Layer Properties Layer Name Maximum Zoom km 999999 Set layer as visible in map Enable Popups Figure 61 Layer Properties section Map Intelligence Client 3 2 3 for Reporting Services Development Guide 82 RELATIONSHIP TYPE SECTION The Relationship Type section allows you to specify the type of relationship to display on the map The Radius option displays the relationship between two 2 Point layers as color coded or hatched circles around a particular point The Region option displays the relationship between a Point layer and a built in map layer as color coded or hatched regions on the map layer Selecting the Radius option Select the Radius radio button On the Reference Point Layer drop down list select the point layer to base the relationship on Points in this layer become the center point of the shaded circles On the Radius Around Point field type the radius of the circle to display on the map On the Legend Description field type a description to use for the legend of this layer If this field is left blank Map Inte
143. tion screens To delete a layer click the Delete button Note To permanently remove the layer you must click the Save button This button does not feature on the Global Settings Main Menu The name of your report displays in the Main Menu bar To open the MIRS Help click the Help button Map Intelligence Client 3 2 3 for Reporting Services Development Guide 50 GLOBAL SETTINGS The Global Settings screen allows you to configure the settings for your Map Intelligence Server as well as the properties of the underlying map to be used for your analysis 2 To open the Global Settings screen Global Settings I 1 Click The Global Settings configuration screen displays MUR IS I ELLK ENC Global Settings Report Crime Analysis T Layer Directory E Om Server Settings 5 gl Port Layers Map Intebigence Server C ispari G Metric arsa L avers hep Name aen Fa wa gt _ gt N E Ares Group Layers Entant Lock bap view With bap vies Haight camiar Pojmi fe Demat Coordinates C Address Back ground atten Ben Button Buttars Header Background Pn Fock gu card ap appia Fark Header T xt Button Teact Send Styles Figure 22 Global Settings Screen SERVER SETTINGS SECTION The Server Settings section allows you to specify the Map Intelligence Server and underlying map to be used for the analysis 2 To configure the Server Settings 1 On the Map Intelligence Server field enter the Ma
144. titude Latitude Coordinate System Figure 32 Point Layers Tab Map Intelligence Client 3 2 3 for Reporting Services Development Guide 58 gt To open q layer 1 On the Layer Directory click the plus icon next to Layer Type to expand and view the list of created layers 2 Click the Layer to open Layer Directory Im Layers a a Point Layers Shot Points Relationship Layers Hrea Group Layers Figure 33 Layer Directory showing the expanded Point Layer section Layers display on the map in the order that they appear in the Layer Directory sections E g the first layer in Mote the Layer Directory Point Layer section of the will be the top most layer in the map CONFIGURE POINT LAYERS Mote For a description of Point layers see Concepts Layer Types Point Layers To open the Point Layer configuration screen 1 Click Point Layers The Point Layer configuration screen displays Map Intelligence Client 3 2 3 for Reporting Services Development Guide 59 2 Onthe Main Menu click r sis The fields are cleared for setting the properties of a new layer Point Layers ce Crew copy save 2 Oelie beh Test Layer Properties Layer Mame Minimum Zoom km Maximum Zom km Ed Set layer as visible in map Uri Column id Column Coordinates Street Address x Lore ede cooramatesystem S I Figure 34 Point Layer configuration screen LAYER PROPERTIES SECTION To co
145. to produce your application which you view and interact with in the browser Mapping Viewer The Map Intelligence Server is supplied with a number of administration tools that include license administration global default settings for the look and feel and customization of various applications features such as pop ups Map Intelligence Client 3 2 3 for Reporting Services User Manual 8 Business Intelligence MI Specific Application Plugin AS MI Specific GIS Figure 1 The Map Intelligence Platform WHAT IS A LAYER Maps are built with layers Each layer holds characteristics that may be of interest to End Users Layers contain features of the map such as streets parks postal districts cities radio towers rivers and so on Each map layer sits on top of another layer e g a country layer may sit all the way at the bottom with street layers sitting right at the top Layers can also be created dynamically from data found in external sources Map Intelligence is capable of generating a variety of layer types to aid analysis In this manual layers that reside as part of the mapping environment are referred to as built in layers Layers created dynamically from external data sources including your report data are known as Map Intelligence layers Map Intelligence Client 3 2 3 for Reporting Services User Manual 9 LAYER TYPES The following layers can be created and configured using Map Intelligence POINT LAYERS
146. ts In this case it is recommended that you select Default as your Center Point option 3 Inthe X Longitude and Y Latitude fields enter the coordinates for the center point at which you wish the map to be initially displayed Center Point f Default i Coordinates Address Map Width km 411 x Longitude 38 765 Y Latitude 149 07 Figure 25 Center Point Section Coordinates Option P For maps with projected coordinate systems when setting Center Point properties the Y coordinate or Northing is set in the latitude field and the X coordinate or Easting in the longitude field These settings are in the units of the underlying map usually meters rather than degrees For maps with projected coordinate systems the longitude is set to the column of the X coordinate and the latitude is set to the column of the Y coordinate in Point layers Moie 2 To set the Center Point using an Address 1 Click the Address radio button 2 Inthe Map Width field type in the width of the map to be initially displayed P This value is in kilometers or miles depending on the unit of measurement selected in the Units section see Mote Preferences below If you do not specify a map width Map Intelligence will apply a default width that will display all your points In this case it is recommended that you select Default as your Center Point option 3 Inthe Street City State and Post Zip Code fields type the address details for
147. tting for the border color as a six hexadecimal digit 3 byte number representing Red Green and Blue The default value is Black 000000 L DeptfotiDrelerce r MA L Deepti DetencetRNAJ L DeptfotiDeTercelrF Hz Figure 182 Border color set to Red Figure 183 Border color set to Green Figure 184 Border color set to Yellow FF0000 OOFFOO FFFFOO Map Intelligence Client 3 2 3 for Reporting Services Development Guide 164 i APPENDIX C SAMPLE CODES REPORT CUSTOM CODE Public Const PARAM DELIMITER As String Public Const SERVER As String http 192 168 3 31 Public Const PORT NUMBER As String 39091 Public Const MI CLIENT PATH As String miclient renderMap documentId Private Dim Dim Dim Dim Dim Try Function CreateMapIntelligenceURL ByVal formattedParameters As String As String connToken As String String Empty reportFolder As String String Empty reportName As String String Empty temp As String String Empty sb As New System Text StringBuilder connToken String Format S26connToken 0 1 reportName Report User UserID reportFolder Report Globals ReportFolder reportName Report Globals ReportName temp String Format 0 1 2 reportFolder reportName formattedParameters connToken sb Append Jjavascript void window open sb Append SERVER sb Append PORT NUMBER sb Append MI_ CLIENT PATH sb Append temp sb Append Integeo RSINTEGEOMAP blank
148. ty Figure 98 Hatch Theme Section Numeric Manual Hatch Legend P i AAA kunkana Ku g Region Catch by half degree i i r En HEF ewan alos lt 1 000 00 lt 3 000 00 lt 5 000 00 lt 10 000 00 gt 10 000 00 Figure 99 Region Relationship Layer Map View and Legend showing Manual Hatch Map Intelligence Client 3 2 3 for Reporting Services Development Guide 106 Eee pb tet Ct a sisa CP Ne TII NEIIZNE Figure 100 Radius Relationship Layer Map View and Legend showing Manual Hatch Theme UNSHADED AND TRANSPARENT COLORS The Theme Builder Wizard color picker includes the option to select an unshaded color or transparent color If the unshaded color is chosen for Radius Relationship layers the circles are removed completely so that they do not appear on the map nor can they be exported Hidden circles do not have popup information If the transparent color is applied to a Radius Relationship layer the circles appear transparent on the map except for a surrounding border It displays popup information For a Region Relationship layer selecting either the unshaded color or transparent color makes the regions on the map transparent so that the underlying areas can still be seen STRING AGGREGATION Map Intelligence allows you to perform a function on string values from a specified fact column String aggregations
149. ual C Future Focus II Call Hierarchy Connect with the Community Wed 19 Mar 2008 15 03 56 0700 The success of the first Future Focus post has made it easy For us to continue sharing our plans For Download Additional Content the future This month we switch our focus to the Visual Studio IDE as we investigate a new Feature named Call Hierarchy New and Updated Live API s for Web Developers Wed 19 Mar 2008 15 03 56 0700 series of new or updated API s that developers can use for building web applications are available From the Windows Live Dev site The new services and APT s are listed below Go to Dave Treadwell s post to read about them in more detail Hanselminutes Podcast 103 Quetzal Bradley on Testing after Unit Tests and the Myth of Code Coverage a a a Wed 19 Mar 2008 15 03 55 0700 Quetzal is a Developer in the Connected Systems Division and has some interesting ideas on testing Visual Studio Headlines after unit testing and code coverage Think 100 Code Coverage is enough ASP NET MYC Session at Mix08 TDD and MycMockHelpers MSDN isual Studio Pe Wed 19 Mar 2008 15 03 54 0700 Mocking is becoming more and more an important tool for developers Here is some mocking source that will get you started with ASP NET M C Lg Error List C web SPaustnet SPaustnet sin Figure 13 Recent Projects section The second approach steps are as follows Q web Site Go to File gt New and click on 3 Onthe New Web
150. ues assigned to a specific color in the Preview window list click the check box next to the value and click Remove Selected Map Intelligence Client 3 2 3 for Reporting Services Development Guide 146 mi amp Close 15 Click FH Save amp close The Theme Builder Wizard closes The created theme displays in the Theme Section of the Area Group Layer configuration screen Color Theme Fact Column Vessel Mame Function Most Common Empty Conflict Other Values BOAT BOAT BOATS BOAT BOATS BOATS Figure 151 Color Theme String Colors Figure 152 Area Group Layer Map View and Legend showing Color Theme String Colors Map Intelligence Client 393 for Reporting Services Development Guide 147 SELECTING HATCHES 1 9 Click the Hatches radio button Theme Builder Visual Feature Colors Hatches Hatch Opacity Border Opacity Border Thickness Border Color Hatch Color lt lt Back Save amp Close Next gt gt Figure 153 Theme Builder Wizard Features Tab String Hatches Features Rendering Attributes On the Hatch Opacity field enter a number from 0 to 1 to indicate the opacity of the hatches On the Border Opacity field enter a number from 0 to 1 to indicate the opacity of region borders in the layer On the Border Thickness field enter a number from 0 to 1 to indicate the thickness in points or pixels depending on the GIS provider of the region borde
151. uilder Wizard closes The created theme displays in the Hatch Theme Section of the Relationship Layer configuration screen Hatch Theme Fact Layer Shot Points Fact Column Whole Kg Function Sum Scheme Quantile Class 1 Hatch Class 2 Hatch Class 3 Hatch Class 4 Hatch Empty Hatch Figure 87 Themes Section showing Hatched Theme cm 155 00 c 196 00 lt 700 00 lt 2 085 00 lt 5 292 00 om 6 045 00 lt 11 046 00 gt 11 046 00 UI Z MAN IIIIII Figure 88 Region Relationship Layer Map View and Legend showing Hatched Map Intelligence Client 3 2 3 for Reporting Services Development Guide 98 MUDDA D SITWA POT RAN A Q ne Fa OV Ta PER ers Figure 89 Radius Relationship Layer Map View and Legend showing Hatched Theme Map Intelligence Client 3 2 3 for Reporting Services Development Guide Die pelot iEn tari cae NAI 99 MANUAL METHOD 1 Onthe Method tab select the Manual radio button Theme Builder Theme Method Automatic Manual lt Back Save amp Close Next gt gt Figure 90 Theme Builder Wizard Method Tab Numeric Manual 2 Click the Features tab or the Next button The Features tab opens 3 On the Visual Feature options select the color mode f There are two options for selecting the Visual Feature Mote Colors Allows you to specify a particular color Hatches Allows you to specify a particular hatch Map I
152. ur business data is designated to have values that match a column in the map data For example an existing map layer of suburbs may correspond to a data column for suburbs where the values are the suburb names Then for transaction data that represents customer complaints and that also contains a suburb column it is possible to make a cross reference between the transaction and the map area using the suburb name An example that would use this correlation is displaying a theme on a suburb s area on the map that reflects the most common complaint type received from that suburb Figure 4 The Mapping Viewer displaying a Region Relationship layer This half grid map of the ocean shows the amount of fish caught within each half grid square Figure 5 The Mapping Viewer displaying an Area Group layer This half grid map of the ocean shows the amount of fish caught within each half grid square Like built in map layers Map Intelligence layers also have a specific order in which they are placed on the map Point layers are placed on top of Radius Relationship layers which in turn sit on top of the built in map layers Region Relationship and Area Group layers shade existing built in layers WHAT IS A MAPPING VIEWER The Mapping Viewer displays the configured Map Intelligence layers overlaid on a specified map The Mapping Viewer also provides a number of controls and features that allow you to navigate around the map or to
153. ve layer settings Note that saved layers are automatically added on the layer list in the Layer Directory Mote Clicking the Save button saves the changes to all the configuration screens EDITING A LAYER gt gt To edit e Point L si 1 On the Layer Directory click expand Point Layers folder to view the layer list 2 Click the Point Layer to edit The Point Layer configuration screen displays for editing 3 Dothe necessary changes 4 Onthe Main Menu click ko Save i F Clicking the Save button saves all the changes made to all configuration screens Moie Map Intelligence Client 393 for Reporting Services Development Guide 79 COPYING A LAYER gt To copy a Point Layer On the Layer Directory expand Point Layers folder to view the layer list Click the Point Layer to copy The Point Layer configuration screen opens On the Main Menu click Copy The page displays to show the copied layer properties On the Layer Name field type a new name for the layer 5 i i Click a The created layer displays in the Layer Directory Mole Clicking the Save button saves all the changes made to all configuration screens DELETING A LAYER To delete a Point Layer On the Layer Directory expand Point Layers folder to view the layer list Click the Point Layer to delete The Point Layer configuration screen opens ae i Delete On the Main Menu click I On the Main Menu click e
154. w values is the same for every class So the classification of the data will be based on a set of equal splits For example if the lowest value is 0 and the highest value is 10 in the data and 5 classes are requested the range of each class will be 0 to 2 2 to 4 4 to 6 6 to 8 8 to 10 Quantile Each class contains an equal number of features In this case the points are sorted in ascending order for the chosen data field and each class is filled with total number of points number of classes points starting from the lowest value to the highest Standard Deviation Features are placed in classes based on how much their values vary from the mean First the mean and standard deviation of the data values are calculated The class breaks are found by successively adding or subtracting multiples of the standard deviation from the mean Map Intelligence Client 3 2 3 for Reporting Services Development Guide 127 4 On the Class Count drop down list select the number of colors to appear in the shading range F If Equal Interval scheme is selected on the Scale options click either the Linear or Note Logarithmic radio button If Standard Deviation scheme is selected type the multiplying factor on the Std Deviation Multiplier field 5 On the Visual Feature options select the color mode f There are three 3 options for selecting the Visual Feature Note Specific Colors use to specify a particular col
155. wn E DAY OF WEEK Fri IF Mon I Sat IF sun Thu Tue IM Wed m meree IT Assault Theft I Vandalism E VALUE OF CRIME lt 1K 10K 20K 1K 10K 20K View Report Get Map Filter Figure 32 Selection Screen Map Intelligence Client 3 2 3 for Reporting Services User Manual 40 24 Try to make some selections by checking a value from the available paramaters and click View Report This will show you the following screen Integeo Demo Crime Analysis id 4 fi ofi b bil Find Next Select a format gt Export IV Apprehended IV At large IF Unknown SG Crime Analysis View Crime Ma Crime Type By Day of Week Crime Type By Status Crime By Day of Week Sun 30 30 25 25 Sat Mon i 20 gt m Fri Tue 10 5 Thu 0 IV Assault Fi Sun Sst Wed Mon Tue Thu IV Theft E H Assault E 3 Theft EE Vandalism MME Apprehended IEE Atlarge MEE Unknown Assault Theft Vandalism IV Vandalism O lt 1k I 10K 20K 1K 10K VALUE OF CRIME Total Crimes 277 Total Value 782 467 83 Band Day of Week Apprehended At large Pal At large Unknown Apprehended At large Unknown 7 I 20K 5 6 5 4 View Report Get Map Filter Mon 6 1 4 1 4 Tue 5 1 2 3 1 4 lt 1K Wed 8 1 1 9 1 3 Thu 5 4 13 5 1 3 x sam or ae a TA 4 raman Crime Dstribution Crime Dstribution grouped by Crimetype A Assault Vandalism A Theft yn
156. word The Password of the user B string conn data source localhost initial catalog IntegeoDemo user x id sa password Password2011 SglConnection cnn new SgqlConnection conn SqlCommand cmd new SqlCommand queryString cnn SqliDataAdapter da DataTable tbl new DataTable try cnn Open catch SqlException ex throw ex da new SqlDataAdapter cmd cry da Fill tbl cnn Close catch SqlException ex throw ex finally cmd Dispose cnn Dispose return tbl lt summary gt il The DLnViewReport Click is in charge of rendering the SG Crime Analysis Report in the Web Page lt summary gt lt param name sender gt lt param gt lt param name e gt lt param gt protected mid binViewReport Click ob ect sender EventArgs e The value of the reportPath variable is the Path of the SG Crime Analysis Report in the Report Server string reportPath Integeo Demo Reports SG Crime Analysis List lt string gt crimeStatus new List lt string gt List lt string gt dayOfWeek new List lt string gt List lt string gt crimeType new List lt string gt List lt string gt valueOfCrime new List lt string gt ReportParameter parm new ReportParameter 4 Iterate through the Crime Status Grid and get the value of the selected item foreach GridViewRow rowlItem in grdC
157. y field enter a number from 0 to 1 to indicate the opacity of region borders in the layer 4 On the Border Thickness field enter a number from 0 to 1 to indicate the thickness in points or pixels depending on the GIS provider of the region borders in the layer 5 On the Border Color field enter a hexadecimal color value or select a color from the color picker for the region border color The default color is black 000000 6 Click the Configure tab or the Next button The Configure tab opens Map Intelligence Client 3 2 3 for Reporting Services Development Guide 110 10 11 12 You can shade a region by applying a color to a built in map layer or circle around a point Tip On the top drop down list select a value from the specified fact column Mote n some instances only a sub set of values displays in the value list box Click e display all values Be aware that large datasets may take sometime to process Click the rectangle next to the top drop down list Select a color from the color picker that you want to associate with the selected value The selected value and associated color displays in the preview window list If the color picker does not have the preferred color right Click the colored rectangle and manually type the Tip hexadecimal color value instead Configure any other values that you wish to associate with a color Any values not assigned a specific color is colored accord

Download Pdf Manuals

Related Search

Related Contents

SR-EN9001 User Manual - Sunricher Lighting Control  陽だまりの家通信vol.49-2015.8    iVision 3D User Manual for Barco  InLine 55374W  state of maine  SRT 5855 UM  the Data  Trust USB cardreader - mini  n°48 - octobre 2013 - automne - Communauté de Communes du  

Copyright © All rights reserved. Failed to retrieve file