Home

AWK-4131 User`s Manual

1. Advance Encryption System is enabled Mixed Provides TKIP broadcast key and TKIP AES unicast key for some legacy AP clients This option is rarely used This option is available in AP Master mode only and does not support AES enabled clients This option is only available with 802 11a b g standard Passphrase 8 to 63 characters Master key to generate keys for encryption and decryption Key renewal for AP Master mode only 60 to 86400 seconds Specifies the time period of group key renewal 3600 seconds 1 minute to 1 day NOTE The key renewal value dictates how often the wireless AP encryption keys should be changed The security level is generally higher if you set the key renewal value to a shorter number which forces the encryption keys to be changed more frequently The default value is 3600 seconds 6 minutes Longer time periods can be considered if the line is not very busy WPA WPA2 Enterprise for AP Master mode By setting WPA type to Enterprise you can use EAP Extensible Authentication Protocol a framework authentication protocol used by 802 1X to provide network authentication In these Enterprise level security modes a back end RADIUS Remote Authentication Dial In User Service server is needed if IEEE 802 1X 3 12 AWK 4131 Web Console Configuration functionality is enabled in WPA WPA2 The IEEE 802 1X protocol also offers the possibility of carrying out an efficient connection authenti
2. After you click Submit to apply changes the web page will refresh Updated will appear on the page anda blinking reminder will be shown on the upper right corner of the web page Click Restart to activate new settings Total Solution for Industrial Wireless Networking J Main Menu KT System Info Settings Updated To activate the changes click Restart and then Save and Restart after you change the settings About 30 seconds are needed for the AWK 4131 to complete the reboot procedure e Step 5 Select the AWK 4131 operation mode By default the AWK 4131 s operation mode is set to AP You can change to Client mode in Wireless Settings gt Basic Wireless Settings Detailed information about configuring the AWK 4131 s operation can be found in Chapter 3 e Step 6 Test communications In the following sections we describe two test methods that can be used to ensure that a network connection has been established Communication Testing After installing the AWK 4131 you can run a sample test to make sure the AWK 4131 and wireless connection are functioning normally Two testing methods are described below Use the first method if you are using only one AWK 4131 device and use the second method if you are using two or more AWK 4131 units How to Test One AWK 4131 If you are only using one AWK 4131 you will need a second notebook computer equipped with a WLAN card Configure the WLAN card to connect to the AWK 4131 NO
3. 2 Change the network settings Enter your selection IP address of AWE 4131 IP address of TETP server Update RedBoot non volatile configuration continue yn y AWK 4131 restarts and the Press Ctrl C to enter Firmware Recovery Process 0 0 0 0 0 0 0 0 192 168 1 2 1 2 enter for abort 2 192 168 1 1 message will reappear Press Ctrl C to enter the menu and select 1 to start the firmware upgrade process Press Ctrl C to enter Firmware Recoverying Process BERBER RR RBRB ERR RRR REE RB ERE RRR RR RRR RRR RRR RRB ERE RRR ERR RRR RRB RRR ERE RRR RB ERR RRR RE REE EEE ES IP address of AWK 4131 IP address of TETP server 192 168 1 2 132 168 1 1 1 Start to firmvare upgrade using the above IretioerrE setting madael 2 Change the network settings Enter your selection 1 2 enter for abort 1 Select 0 in the sub menu to load the firmware image via LAN and then enter the file name of the firmware to start the firmware recovery 7 4 AWK 4131 Supporting I nformation O Load from L N 1 Losd trom serial with Anodem Please select iten 0 Please input load image name Default file name AWK 4131 rom User Input file name AWK 4131 1 0 rom Technical Support Contact I nformation Customer satisfaction is our number one concern and to ensure that customers receive the full benefit of our products Moxa Internet Services has been set up to provide technical support driver up
4. Microsoft Internet Explorer O xj Site Survey MAC address Channel Mode Home 00 18 84 81 CD 9A BSS WEP Z o ow O 1 Ww h FON_AP 00 18 84 81 CD 99 BSS OPEN default 00 15 F2 A2 07 6A BSS OPEN BLW 54PM 00 90 CC D6 B5 20 BSS WEP BLW 54PM HHE5H GG DbB RC E BSS OPEN ZyXEL D0 19 CB 41 48 94 BSS WEP DG 26 02 86 22 7F BSS OPEN HJ Wireless 00 16 01 ED DO 61 BSS WEP default 00 40 05 56 93D B1 BSS WEP o hpsetup 52 BC 90 E2 84 14 Ad Hog OPEN Refresh Close E Done Internet RF type Only supports the IEEE 802 11b standard B G N Mixed Only supports the IEEE 802 11g standard B G Mixed Supports IEEE 802 11b g standards but 802 11g may operate at a slower speed if when 802 116 clients are on the network G N Mixed Supports IEEE 802 11g n standards but 802 11n may operate at a slower speed if 802 11g clients are on the network B G N Mixed Supports IEEE 802 11b g n standards but 802 11g n may operate at a slower speed if 802 11b clients are on the network N Only 2 4GHz Only supports the 2 4 GHz IEEE 802 11n standard A Only supports the IEEE 802 11a standard A N Mixed Supports IEEE 802 11a n standards but 802 11n may operate at a slower speed if 802 11a clients are on the network N Only 5GHz Only supports the 5 GHz IEEE 802 11n standard Channel for AP mode only Available channels vary The AWK 4131 plays the role of wireless AP 6 in B G N Mixed with RF type meee 3
5. Web Console Configuration The AWK 4131 has one relay output which consists of 2 terminal block contacts on the AWK 4131 s top panel These relay contacts are used to indicate user configured events and system failure The two wires attached to the relay contacts form an open circuit when a user configured event is triggered If a user configured event does not occur the relay circuit will remain closed For safety reasons the relay circuit is kept open when the AWK 4131 is not powered Relay Event Types You can check the box for Active to enable the event items All default values are deactivated unchecked Details for each event item can be found in the System log Event Types table on page 3 31 Relay Event Types Event Power 1 transition On gt Off Power 2 transition On gt Off PoE transition On gt Off DI 1 transition On gt Off DI 1 transition Off gt On DI 2 transition On gt Off DI 2 transition Off gt On LAN link On LAN link Off Active LB CI Le 010 0 108 O Traps can be used to signal abnormal conditions notifications to a management station This trap driven notification can make your network more efficient Because a management station usually takes care of a large number of devices that have a large number of objects it will be overloading for the management station to poll or send requests to query every object on every device It would be better if the managed de
6. 9 AWK 4131 Web Console Configuration Channel Width for any 11N RF type only 20 MHz elect your channel width If you are not sure which option to 20 MHz 20 40 MHz use select 20 40MHz Auto Channel bonding If 20 40 MHz only is the Channel Width setting this channel bonding will auto set the channel based on your channel setting SSID Max of 31 characters The SSID of a client and the SSID of the AP must be identical for MOXA the client and AP to be able to communicate with each other SSID broadcast for AP mode only Enable Disable SSID can be broadcast or not NOTE The AWK 4131 P for Japanese frequency bands only connects SSID hidden APs for I EEE 802 11a channels and IEEE 802 11g n channels 1 to 11 The AWK 4131 EU for European frequency bands only connects SSID hidden APs for IEEE 802 11b g n channels WLAN Security Settings The AWK 4131 provides four standardized wireless security modes Open WEP Wired Equivalent Privacy WPA Wi Fi Protected Access and WPA2 Several security modes are available in the AWK 4131 by selecting Security mode and WPA type e Open No authentication no data encryption e WEP Static WEP Wired Equivalent Privacy keys must be configured manually WPA WPA2 Personal Also known as WPA WPA2 PSK You will need to specify the Pre Shared Key in the Passphrase field which will be used by the TKIP or AES engine as a master key to generate keys that actually en
7. Assign IP to change the IP setting AWK Search Utility Set File Edit Function Tools Help Sa bh x E nw lt ny F Search Search Ex Locate Web Telnet Assign IP Upgrade Export Import Refresh Refresh All Exit No Modelname IP address Device MAC address Overview a eS 1 AWK 4131 US 192 168 127 253 00 90 E8 22 B6 CA4 255 255 255 0 1 0 Build 11041314 System Info Device Info 802 11 Info Model name AWK 4131 LI5 Device name AWK 4131_0357 IP configuration z Device location Padia 192 168 127 253 Device description Serial No 357 Subnet mask a O E System up time O days 00h 01m 03s Gateway Firmware version 1 0 Build 11041314 Primary DNS server Secondary DNS server Jf OK Cancel The three advanced options Search Connection and Miscellaneous are explained below Search Retry count default 5 Indicates how many times the search will be retried automatically e Retry interval ms The time lapsed between retries 4 6 AWK 4131 Software I nstallation Configuration Advanced Options search Connection Misc Retry count l5 Retry interval mz 1 O00 yf 0K 3 Cancel Connection e Connection timeout secs Use this option to set the waiting time for the Default Login Locate Assign IP Upload Firmware and Unlock to complete e Upgrade timeout secs Use this option to set the waiting time for the connection to disconnect while the firmware is upgrading Use this option to s
8. F 4 4 AWK 4131 Software I nstallation Configuration 3 The Searching window indicates the progress of the search When the search is complete all AWKs that were located will be displayed in the AWK Search Utility window AWK Search Utility aja File Edit Function Tools Help 2 E A E ES l a 4 E FL Search Search Ex Locate Web Telnet Assign IP Upgrade Export Import Refresh Refresh All Exit No Modelname IP address Device MAC address Overview a al AWK 4131 US 192 168 127 253 00 90 E8 22 B6 C4 255 255 255 0 1 0 Build 11041314 System Info Device Info 802 11 Info Model name AWK 4131 US Device name AWK 4131_0357 Device location Device description Serial No 357 System up time 0 days 00h 01m 03s Firmware version 1 0 Build 11041314 4 Click Locate to cause the selected device to beep AWK Search Utility Fie Edit Function Tools Help 2 a df S A LA ES a oa F Search Search Ex Locate Web Telnet Assign IP Upgrade Export Import Refresh Refresh All Exit Overview a E 1 AWK 4131 US 192 168 127 253 00 90 E8 22 B6 C4 System Info Device Info 802 11 Info Model name AWK 4131 US Device name AWK 4131_0357 Locating Device location Model AWK 4131 US Device description IP 192 168 127 253 Serial No 357 00 30 E8 22 B6 CA System up time 0 days 00h 01m 03s Netmask 255 255 255 Firmware version 1 0 Build 11041314 5 Make sure your
9. Once the AWK has booted up successfully it will emit the normal two beeps and the ready LED will turn to solid green Load Factory Default Use this function to reset the AWK 4131 and roll all settings back to the factory default values You can also reset the hardware by pressing the reset button on the top panel of the AWK 4131 Load Factory Default Reset to Factory Default Click Activate to reset all settings including the console password to the factory default values The system will be restarted immediately Activate Password You can change the administration password for each of the AWK 4131 s console managers by using the Password function Before you set up a new password you must input the current password and reenter the new password for confirmation For your security do not use the default password root and remember to change the administration password regularly Password Current password le New password ssesese Confirm password seeesesl Misc Settings Additional settings to help you manage your AWK 4131 are available on this page Misc Settings Reset button Always enable Disable after 60 sec 3 39 AWK 4131 Web Console Configuration Reset button Always enable The AWK 4131 s Reset button works normally Always enable Disable after 60 sec The AWK 4131 s reset to default function will be inactive 60 seconds after the AWK 4131 finishes booting up Save Configuration The
10. Provides authentication based on HMAC MD5 or n based on HMAC SHA algorithms 8 character passwords are the MD5 or SHA minimum requirement for authentication MD5 or SHA Authenticatio Data Provides authentication based on HMAC MD5 or n based on encryption HMAC SHA algorithms and data encryption key MD5 or SHA key 8 character passwords and a data encryption key are the minimum requirements for authentication and encryption The following parameters can be configured on the SNMP Agent page A more detailed explanation of each parameter is given below the following figure SNMP Agent Enable Disable Remote management Read community Write commnuity SNMP agent version Admin authentication type Admin privacy type Privacy key Po Private MIB information Device object ID enterprise 6691 15 7 Enable Enables SNMP Agent Disable Remote Management Allow remote management via SNMP agent Disable Disallow remote management via SNMP agent Read community for V1 V2c V1 V2c Read Use a community string match with a maximum of 31 public Community characters for authentication This means that the SNMP agent can access all objects with read only permissions using this community string Write community for V1 V2c V1 V2c Read Write Use a community string match with a maximum of 31 private Community characters for authentication This means that the SNMP agent can accesses all objects wit
11. RSTP Status gt WLAN Security Settings O Maintenance gt Advanced Wireless Settings Console Settings gt WLAN Certification Settings for EAP TLS in gt Ping Client Slave mode only gt Firmware Upgrade O Advanced Settings gt Config Import Export Using a Virtual LAN gt Load Factory Default gt Configuring a Virtual LAN gt Password gt DHCP Server for AP mode only gt Misc Settings gt Packet Filters O Save Configuration gt RSTP Settings for AP mode only O Restart gt SNMP Agent O Logout gt Link Fault Pass Through for Client Slave mode only O Auto Warning Settings gt System Log Syslog E mail Relay V VY WV Trap AWK 4131 Web Console Configuration Web Browser Configuration Moxa AWK 4131 s web browser interface provides a convenient way to modify its configuration and access the built in monitoring and network administration functions The recommended web browser is Microsoft Internet Explorer 7 0 or 8 0 with JVM Java Virtual Machine installed NOTE To use the AWK 4131 s management and monitoring functions from a PC host connected to the same LAN as the AWK 4131 you must make sure that the PC host and the AWK 4131 are on the same logical subnet Similarly if the AWK 4131 is configured for other VLAN settings you must make sure your PC host is on the management VLAN The Moxa AWK 4131 s default IP is 192 168 127 253 Follow these steps to access the AWK 4131 s web based console management
12. a ae coe TT 3 39 Save COnMQUPALION rss etica lll altea la A O DL A CO 3 40 A ti fv ee er rr errr ree 3 40 e ER 3 41 4 Software nstallation Configuration 122222 221222222222222222212212222151112551558551 AR anna 4 1 A NN O NGA DA An 0011010740001 TY Ti TT EEE 9 1v 0 0 OEA 07v i0 4 2 l a 0 P 1 10 200 1 21 1211 1112 1112112112111 4 2 ASTAMAD AWK SOC Lis ara aet aa aa aek Ar s46 66a sineilpssesseedesgridiensS86800609628681000 0106 8006 au ee 0g u gu a 018 0x4 de DoAnid 4 2 CONTIGUFING AWK gearen Uli AS A 4 4 5 Other Console CGOHHIQUFGUIONHS 27121112222122211 22211722222662101 u 620611162526612nnun 0si0wsgwssussggsvsiaEsgsfsesssiivks sEslSsssssssvvEi 5 1 RS 232 Console Configuration 115200 None 8 1 VT10 HH rr 5 2 Configuration by Telnetand SSH Consoles vai tak ars tira ee deardeae dea a Dash 5 3 Configuration by Web Browser with HTTPS SSL eee eee eee esse deen ee rr 5 4 Disabling Telnet and BrOWSECr ACCESS ae di eter einstein ica 5 5 O FREIGTGHCCS 2 xrrcrrrrcrrcisrcrrrrrrrrsersrrraenrsdrrnisrriexsrsntxexrrseszreXisiswasaissitsasisisaasixsississigaa xsiaissiasaisixaissaiaisaxissisiafs aaa 6 1 MIIFCIGSS 1IISLI H00IOTT GV SE WDS J i i dt ee ee ee eer rrr rr rr ee cre 6 2 BE en ee ee ee ee ee ee ee a eee eer er eer ted as 6 3 A AR A 6 3 E RN 6 4 RT ios 6 4 A A A A A O rer ee rere ene 6 4 THE 9 171 TP 2C OIICE DU ti OOO 6 4 Diffe
13. and Syslog server UDP port numbers When an event occurs the event will be sent as a Syslog UDP packet to the specified Syslog servers 3 30 AWK 4131 Web Console Configuration Syslog Event Types Detail information for the grouped events is shown in the following table You can check the box for Enable log to enable the grouped events All default values are enabled checked Details for each event group can be found on the System log Event Types table on page 3 31 Syslog Event Types Event group Enable log System related events Iv Network related events M Config related events M Power events M DI events M Syslog Server Settings You can configure the parameters for your Syslog servers in this page Syslog Server Settings Syslog server 1 FO Syslog port 514 Syslog server 2 FT Syslog port 514 Syslog server 3 CO Syslog port 514 Syslog server 1 2 3 IP address Enter the IP address of the 1st 2nd 3rd Syslog Server Syslog port Port destination Enter the UDP port of the corresponding Syslog server 514 1 to 65535 E mail E mail Event Types Check the box for Active to enable the event items All default values are deactivated unchecked Details for each event item can be found on the System log Event Types table on page 3 31 3 31 AWK 4131 Web Console Configuration E mail Event Types O gt lt Event Cold start Warm start Power 1 transition On gt Off Power 1
14. before checking to see if it 15 seconds by user should change to a different topology 4 30 seconds Max age Numerical value input As a non root role if the device has not received a hello 20 seconds by user message from the root longer than Max age it will reconfigure 6 40 seconds itself as a root Once two or more devices on the network are recognized as a root the devices will renegotiate to set up a 3 26 AWK 4131 Web Console Configuration Enable RSTP NOTE Enable disable Enables or disables the port as a node on the Spanning Tree Disable topology unchecked Port priority Numerical value Increase this port s priority as a node on the Spanning Tree 128 selected by user topology by inputting a lower number Port cost Enable Disable Input a higher cost to indicate that this port is less suitable as a 2000000 node for the Spanning Tree topology Edge port Checked unchecked Sets a port which no BPDU expectedly goes through as an unchecked except edge port AP port We recommend you set an edge port for the port which is connected to a non STP RSTP sub network or an end device PLC RTU etc aS opposed to network equipment This can prevent unnecessary waiting and negotiation of STP RSTP protocol and accelerate system initialization When an edge port receives BPDUs it can still function as an STP RSTP port and start negotiation Setting an edge port is different from
15. choose the desired formatting options ATTENTION If you unplug the RS 232 cable or trigger DTR a disconnection event will be evoked to enforce logout for network security You will need to log in again to resume operation Configuration by Telnet and SSH Consoles You may use Telnet or SSH client to access the AWK 4131 and manage the console over a network To access the AWK 4131 s functions over the network from a PC host that is connected to the same LAN as the AWK 4131 you need to make sure that the PC host and the AWK 4131 are on the same logical subnet To do this check your PC host s IP address and subnet mask 5 3 AWK 4131 Other Console Configurations NOTE The AWK 4131 s default I P address is 192 168 127 253 and the default subnet mask is 255 255 255 0 for a Class C network If you do not set these values properly please check the network settings of your PC host and then change the IP address to 192 168 127 xxx and subnet mask to 255 255 255 0 Follow the steps below to access the console utility via Telnet or SSH client 1 From Windows Desktop run Start gt Run and then use Telnet to access the AWK 4131 s IP address from the Windows Run window you may also issue the telnet command from the MS DOS prompt Run FAR resource and Windows will open it for you Oper telnet 192 168 127 253 371 Type the name of a program folder document or Intemet Cancel Browse 2 When using SSH c
16. create the program s shortcut files to the default directory or click Browse to select an alternate location T Setup AWE Search Utility ale EJ Select Start Menu Folder Where should Setup place the program s shortcuts nue l m Setup will create the program s shortcuts in the following Start Menu folder To continue click Next IF you would like to select a different folder click Browse EWK Search Utility 4 Click Next to select additional tasks 0 Setup AWE Search Utility Select Additional Tasks Which additional tasks should be performed Select the additional tasks you would like Setup to perform while installing AWK Search Utility then click Mest Additional icons L Create a Quick Launch icon 5 Click Next to proceed with the installation The installer then displays a summary of the installation options iG Setup AWE Search Utility al Xx Ready to Install Setup is now ready to begin installing AWE Search Utility on your computer Click Install to continue with the installation or click Back if pon want to review or change any settings Destination location C Program Files Morava VAWE Search Utility Start Menu folder AWE Search Utility Install Cancel 6 Click Install to begin the installation The setup window will report the progress of the installation To change the installation settings click Back and navigate to the previous screen 4 3
17. disabling STP RSTP on a port If you disable STP RSTP a port will not deal with STP RSTP BPDUs at all Port Status Port Status indicates the current Spanning Tree status of this port Use Forwarding for normal transmission or Blocking to block transmission SNMP Agent The AWK 4131 supports SNMP V1 V2c V3 SNMP V1 and SNMP V2c use a community string match for authentication which means that SNMP servers access all objects with read only or read write permissions using the community string public private default value SNMP V3 which requires you to select an authentication level of MD5 or SHA is the most secure protocol You can also enable data encryption to enhance data security The AWK 4131 s MIB can be found in the software CD and supports reading the attributes via SNMP Only get method is supported SNMP security modes and security levels supported by the AWK 4131 are shown in the following table Select the security mode and level that will be used to communicate between the SNMP agent and manager Protocol Setting on Authenticati Data Version UI web on Type Encryption page V1 V2c Community Use a community string match for authentication Read string Community 3 27 AWK 4131 Web Console Configuration V1 V2c Community Use a community string match for authentication Write Read string Community SNMP V3 No Auth No N Use account with admin or user to access objects MD5 or SHA Authenticatio
18. following figure shows how the AWK 4131 stores the setting changes into volatile and non volatile memory All data stored in volatile memory will disappear when the AWK 4131 is shutdown or rebooted unless they are y Because the AWK 4131 starts up and initializes with the settings stored in flash memory all new changes must be saved to flash memory before restarting the AWK 4131 This also means the new changes will not work unless you run either the Save Configuration function or the Restart function Configuration l setting changes Restart without saving configuration volatile non volatile The system reboots and memory memory Restart initialize with the settings flash memory _ gt infalsh memory Save and Restart After you click on Save Configuration in the left menu box the following screen will appear Click Save if you wish to update the configuration settings in the flash memory at this time Alternatively you may choose to run other functions and put off saving the configuration until later However the new setting changes will remain in the non volatile memory until you save the configurations Save Configuration If you have submitted any configuration changes you must save the changes and restart the system before they take effect Click Save to save the changes in AWE 3131 US s memory Click Restart to activate new settings In the navigation panel Restart If you submitted configuration chang
19. nstallation Configuration To modify the configuration of the highlighted AWK click on the Web icon to open the web console This will take you to the web console where you can make all configuration changes Refer to Chapter 3 Using the Web Console for information on how to use the web console AWK Search Utility PEx File Edit Function Tools Help 2 x A E E 2 a va F Search Search Ex Locate We Telnet Assign IP Upgrade Export Import Refresh Refresh All Exit Overview a Pal AWK 4131 US 192 168 127 253 00 90 E9 22 B6 CA 255 255 255 0 System Info Device Info 802 11 Info Model name AWK 4131 US Device name AWK 4131_0357 Device location Device description Serial No 357 System up time 0 days 00h 01m 03s Firmware version 1 0 Build 11041314 Click on Telnet if you would like to use telnet to configure your AWKs 0 AWK Search Utility File Edit Function Tools Help 2 a Z R P n 8 2 qu a Search Search Ex Locate Web Telnet Assign IP Upgrade Export Import Refresh Refresh All Exit No Modelname IP address Device MAC address Overview Poy AWK 4131 US 192 168 127 253 00 90 E9 22 B6 CA 255 255 255 0 1 0 Build 11041314 System Info Device Info 802 11 Info Model name AWK 4131 US Device name AWK 4131_0357 Device location Device description Serial No 357 System up time 0 days 00h 01m 03s Firmware version 1 0 Build 11041314 Click
20. port can be left empty if only a single port is specified Of course the end port cannot be larger then the start port The Application name is a text string that describes the corresponding entity with up to 31 characters Remember to check the Active check box for each entity to activate the setting TCP UDP Port Filters Enable Disable Policy Drop No nrtive Source port Destination port Protocol Application name 2 Pot JJ l eA 2 HL e o TJ fred Enables TCP UDP port filter Disable Disables TCP UDP port filter Policy Only the packets fitting the entities on list can be allowed Drop Any packet fitting the entities on list will be denied ATTENTION Be careful when you enable the filter function Drop no entity on list is activated all packets are allowed Accept no entity on list is activated all packets are denied 3 25 AWK 4131 Web Console Configuration RSTP Settings for AP mode only AWK 4131 supports EEE802 1D Spanning Tree Protocol and IEEE802 1w Rapid STP standards In addition to eliminating unexpected path looping STP RSTP can provide a backup path recovery if a wired wireless path fails accidentally The reliability and availability can increase because this fail over function AWK 4131 s STP RSTP feature is disabled by default To be completely effective you must enable RSTP STP on every AWK 4131 connected to your network If AWK 4131 plays a Cl
21. transition Off gt On Power 2 transition On gt Off Power 2 transition Off gt On PoE transition On gt Off PoE transition Off gt On Configuration changed Console authentication failure DI 1 transition On gt Off DI 1 transition Off gt On DI 2 transition On gt Off DI 2 transition Off gt On LAN link on LAN link off EAREREREARARARARAS E mail Server Settings You can set up to 4 e mail addresses to receive alarm emails from the AWK 4131 The following parameters can be configured on the E mail Server Settings page In addition a Send Test Mail button can be used to test whether the Mail server and e mail addresses work well More detailed explanations about these parameters are given after the following figure E mail Server Settings Mail server SMTP PO User name FO Password PO From e mail address To e mail address 1 To e mail address 2 FO SOSY To e mail address 3 To e mail address 4 Submit Send Test Mail Mail server SMTP Factory Default IP address The IP Address of your email server None User name amp Password Factory Default User name and password used in the SMTP server None From e mail address Max 63 characters Enter the administrator s e mail address which will be shown in None the From field of a warning e mail To E mail address 1 2 3 4 Max 63 characters Enter the receivers e mail addresses AWK 4131 Relay Trap
22. used to connect to Ethernet enabled devices Below we show pinouts for both MDI NIC type ports and MDI X HUB Switch type ports Pinouts for the 10 100 1000BaseT X M12 8 pin Port PIN Con TRD 3 TRD 4 2 TRD 4 VAN TRDI1L Tie e3 ENE o F s 000000 Al Po o ATTENTION To ensure the P68 rated connectivity you must use a waterproof housing during any communication activities An P68 rated field installable plug which is attached in the AWK 4131 s accessory pack may be needed in this case The installation procedure is shown below 1 8 AWK 4131 Introduction Ethernet M12 Plug Dimensions unit mm 41 8 REF Installation EB p ah aR pa T Z M 4 Y 1 Refer to the pin assignment and solder wires with 2 Then assemble and in order 3 Test the plug to ensure the quality RS 232 Connection The AWK 4131 has one RS 232 8 pin RJ 45 console port located on the bottom panel Use either an RJ 45 to DB9 or RJ 45 to DB25 cable to connect the Moxa AWK 4131 s console port to your PC s COM port You may then use a console terminal program to access the AWK 4131 for console configuration Console Pinouts for 10 pin or 8 pin RJ 45 10 Pin Description 8 Pin _ 1 NOTE 1 The pin numbers for male DB9 and DB25 connectors and hole numbers for female DB9 and DB25 connectors are labeled on the connector However the numbers are typically
23. 00 13 CE E1 EE EF joined 133 2008 06 18 21h 28m 51s Client 00 13 CE E1 EE EF joined Export Log Clear Log Refresh Relay Status The status of user configurable events can be found under Relay Status The status will refresh every 5 seconds if the Auto refresh box is checked If an event is triggered it will be noted on this list System administrators can click Acknowledge Event when he has acknowledged the event and addressed it Relay Status Y Auto refresh Relay Status Powerl transition On gt Off Power2 transition On gt Off PoE transition On gt Off DI1 transition On gt Off DI1 transition Off gt On DI2 transition On gt Off DI2 transition Off gt On LAN link On LAN link Off DI and Power Status The status of power inputs and digital inputs is shown on this web page The status will refresh every 5 seconds if the Auto refresh box is checked 3 36 AWK 4131 Din and Power status Y Auto refresh Input status Power 1 status Power 2 status PoE status DI 1 status DI 2 status RSTP Status On Off Off Off Off Web Console Configuration On Off The following figures indicate the status which Spanning Tree Protocol parameters have been configured RSTP Status RSTP status Bridge priority Hello time Forwarding delay Max age M 1z B8 2 seconds 15 seconds 20 seconds Enable RSTP Port Priorit
24. 09 00 Signal strength HA Transmission rate Auto Transmission power Full NOTE The 802 11 info that is displayed may be different for different operation modes For example Current BSSID is not available in Client mode and Signal strength is not available in AP mode Basic Settings The Basic Settings group includes the most commonly used settings required by administrators to maintain and control the AWK 4131 System I nfo Settings The System Info items especially Device name and Device description are displayed and included on the Overview page in SNMP information and in alarm emails Setting System Info items makes it easier to identify the different AWK 4131 units connected to your network System Info Settings Device name lap_011 Device location area 32 5th Floor Device description Ino 11 of ABC supporting system Device contact a TRE John Davis sysop abc com Device name Max 31 of characters This option is useful for specifying the role or application of different AWK 4131 units AWK 4131 lt Serial No of this AWK 4131 gt Device location Max of 31 characters Specifies the location of different AWK 4131 units Device description AWK 4131 Web Console Configuration Max of 31 characters Use this space to record a more detailed description of the None AWK 4131 Device contact information Max of 31 characters Provides information about whom to contact in order to resol
25. 5 AWK 4131 Web Console Configuration Time Settings The AWK 4131 has a time calibration function based on information from an NTP server or user specified Date and Time information Functions such as Auto warning can add real time information to the message Time Settings Date YYYY MM DD Time HH MM SS Current local time 2009 oi 23 16 58 19 Set Time Time zone GMT 06 00 Central Time US Canada v Daylight saving time V Enable Starts at lApr y jist y Sun y loo oo HH MM Stops at loct x last y Sun y loo oo HH MM Time offset 01 00 v Time server 1 time nist gov Time server 2 Query period 600 600 9999 seconds The Current local time shows the AWK 4131 s system time when you open this web page You can click on the Set Time button to activate the updated date and time parameters An Updated string will appear to indicate that the change is complete Local time settings will be immediately activated in the system without running Save and Restart NOTE The AWK 4131 has a built in real time clock RTC We strongly recommend that users update the Local time for the AWK 4131 after the initial setup or a long term shutdown especially when the network does not have an Internet connection for accessing the NTP server or there is no NTP server on the LAN Current local time User adjustable time The date and time parameters allow configuration of the local time with
26. AWK 4131 Software I nstallation Configuration 7 Click Finish to complete the installation of AWK Search Utility ie Setup AWE Search Utility Ea X Completing the AWK Search Utility Setup Wizard Setup has finished installing AWE Search Utility on your computer The application may be launched by selecting the installed icons Click Finish to exit Setup Configuring AWK Search Utility The Broadcast Search function is used to locate all AWK 4131 APs that are connected to the same LAN as your computer After locating an AWK 4131 you will be able to change its IP address Since the Broadcast Search function searches by TCP packet and not IP address it doesn t matter if the AWK 4131 is configured as an AP or Client In either case APs and Clients connected to the LAN will be located regardless of whether or not they are part of the same subnet as the host 1 Start the AWK Search Utility program When the Login page appears select the Search AWK only option to search for AWKs and to view each AWK s configuration Select the AWK management option to assign IPs upgrade firmware and locate devices AWE Search Utility Login C AWE management Cr y OK 2 Cancel 2 Open the AWK Search Utility and then click the Search icon AWK Search Utility SEE File Edit Function Tools Help a d xy A a E a Search Search Ex Exit No Modelname IP address Device MAC address A
27. AWK 4131 User s Manual First Edition May 2011 www moxa com product O 2011 Moxa Inc All rights reserved AWK 4131 User s Manual The software described in this manual is furnished under a license agreement and may be used only in accordance with the terms of that agreement Copyright Notice 2011 Moxa Inc All rights reserved Trademarks The MOXA logo is a registered trademark of Moxa Inc All other trademarks or registered marks in this manual belong to their respective manufacturers Disclaimer Information in this document is subject to change without notice and does not represent a commitment on the part of Moxa Moxa provides this document as is without warranty of any kind either expressed or implied including but not limited to its particular purpose Moxa reserves the right to make improvements and or changes to this manual or to the products and or the programs described in this manual at any time Information provided in this manual is intended to be accurate and reliable However Moxa assumes no responsibility for its use or for any infringements on the rights of third parties that may result from its use This product might include unintentional technical or typographical errors Changes are periodically made to the information herein to correct such errors and these changes are incorporated into new editions of the publication Technical Support Contact I nformation Moxa Americas T
28. AWK is unlocked before using the search utility s icons setting The AWK will unlock automatically if the password is set to the default Otherwise you must enter the new password manually 6 Go to Tools gt AWK login Options to manage and unlock additional AWKs 0 AWK Search Utility File Edit Function Tools Help a Utility Login Options E 2 ES a TL Search Search 5 z Telnet Assign IP Upgrade Export Import Refresh Refresh All Exit AWK Login Options No Modelname Advanced Options evice MAC address Overview a Ey AWK 4131 Customize List View 3 90 E8 22 B6 C4 255 255 255 0 1 0 Build 11041314 System Info Device Info 802 11 Info Model name AWK 4131 US Device name AWK 4131_0357 Device location Device description Serial No 357 System up time 0 days 00h 01m 03s Firmware version 1 0 Build 11041314 7 Use the scroll down list to select the MAC addresses of those AWKs you would like to manage and then click Add Key in the password for the AWK device and then click OK to save If you return to the search page and search for the AWK again you will find that the AWK will unlock automatically ATTENTI ON For security purposes we suggest you can change the AWK search utility login password instead of using the default AWK Login Options Found AWK device s 192 168 127 253 00 30 E8 00 40 01 M Add Last IP Device MAC address Username 4 5 AWK 4131 Software I
29. Federal Communication Commission Interference Statement This equipment has been tested and found to comply with the limits for a Class B digital device pursuant to Part 15 of the FCC Rules These limits are designed to provide reasonable protection against harmful interference in 7 2 AWK 4131 Supporting I nformation NOTE a residential installation This equipment generates uses and can radiate radio frequency energy and if not installed and used in accordance with the instructions may cause harmful interference to radio communications However there is no guarantee that interference will not occur in a particular installation If this equipment does cause harmful interference to radio or television reception which can be determined by turning the equipment off and on the user is encouraged to try to correct the interference by one of the following measures e Reorient or relocate the receiving antenna e Increase the separation between the equipment and receiver e Connect the equipment into an outlet on a circuit different from that to which the receiver is connected e Consult the dealer or an experienced radio TV technician for help FCC Caution To assure continued compliance example use only shielded interface cables when connecting to computer or peripheral devices Any changes or modifications not expressly approved by the party responsible for compliance could void the user s authority to operate this equipment This trans
30. S 232 console management e 2DI 1DO for on site monitoring and warming e Operating temperature range from 40 to 75C e Power input via PoE Power over Ethernet or redundant 24 VDC power inputs e Wall mounting ability e P68 rated metal housing 1 2 AWK 4131 Introduction e Waterproof RJ45 connectors and M12 connectors Product Specifications WLAN Interface Standards IEEE 802 11a b g n for Wireless LAN IEEE 802 11i for Wireless Security IEEE 802 3 for 10BaseT EEE802 3u 100BaseTX IEEE 802 3ab for 1000BaseT IEEE 802 3af for Power over Ethernet IEEE 802 1D for Spanning Tree Protocol IEEE 802 1w for Rapid STP IEEE 802 1Q VLAN Spread Spectrum and Modulation typical e DSSS with DBPSK DQPSK CCK e OFDM with BPSK QPSK 16QAM 64QAM e 802 11b CCK O 11 5 5 Mbps DOPSK 2 Mbps DBPSK 11 Mbps e 802 11a g 64QAM 54 48 Mbps 16QAM E 36 24 Mbps QPSK 18 12 Mbps BPSK 9 6 Mbps e 802 11n 64QAM O 300 Mbps to BPSK 6 5 Mbps multiple rates supported Operating Channels central frequency US 2 412 to 2 462 GHz 11 channels 5 18 to 5 24 GHz 4 channels EU 2 412 to 2 472 GHz 13 channels 5 18 to 5 24 GHz 4 channels JP 2 412 to 2 472 GHz 13 channels OFDM 2 412 to 2 484 GHz 14 channels DSSS 5 18 to 5 24 GHz 4 channels for W52 Security e SSID broadcast enable disable e Firewall for MAC IP Protocol Port based filtering e 64 bit and 128 bit WEP encryption WPA WPA2 Personal a
31. SNMP notification po CJ E mail Server Settings 2a Relay Note These functions are all optional 2 HCJ Relay Event Types 2 Ay Trap OQ Trap Event Types D SNMP Trap Receiver Settings 7a Status wireless Status Associated Client List DHCP Client List System Log Current status information for monitoring wired wireless network performance advanced services and device management functions Relay Status DI and Power Status Rol P Status alntenance Console Settings Pina iiaa Functions for maintaining the AWK 4131 and Contig Import Export Load Factory Default Password for diagnosing the network LH Misc Settings mm Save Configuration On demand functions to support the web based C Festart console management operation 23 Logout 2 5 3 Web Console Configuration In this chapter we explain all aspects of web based console configuration Moxa s easy to use management functions help you set up your AWK 4131 and make it easy to establish and maintain your wireless network The following topics are covered in this chapter O Web Browser Configuration O Status O Overview gt Wireless Status O Basic Settings gt Associated Client List for AP Master mode gt System Info Settings only gt Network Settings gt DHCP Client List for AP mode only gt Time Settings gt System Log O Wireless Settings gt Relay Status O Operation Mode gt DI and Power Status O Basic Wireless Settings gt
32. Slave mode only ch kh h 3 29 PANO Coma Akela A O e ET eee t aher Tem mee TT 3 29 SV SLOW LO Oat ronson arctan aren aton ys anne enor eyes CC Ca a E C C c 3 30 A RRA nie Reena ROR n0 A ARO RAR Rees Se NCTE Smee mre nT Tne een mT aC Cnn Tm c 3 30 E5 T alll av eveceveder eects tr Robot lo A E EoelyaoRal oxi este tee eden a aa uae edna a 3 31 BE E N 8 eeepc liura icu eect 3 33 o III 3 33 O aris ses ea a eas 1654 esse ee ew tay te tron n bgb0 40 0 0020000100150460100806310021010 0001806 10012 40600008900u896000 4000 4s 3 34 MY TTS S otat Sn eT AA EE td ai 3 34 Associated Client List for AP Master mode only HT HH HH nh kh r 3 35 DHCP Client EISt TOr AP 4110016 01RV Ji e 12205 xua are R RT AERE ERE EE AEA E EEO EAEE gio kieeceitbcagtetofeeiarssaie sen 3 35 A A 4x2 sao c da 3 36 Relay Sta tUs c 12 2 g oct an RT 20 89 2 8 0A6 cee 086 01 A A A E 3 36 Dand POWCT Sta tU s4 x2 v x n 1216 t b X v S4 so x s Sd raha OUEN cd 3 36 A II a4 4 4 a 3 37 Manten anciano maaan emma MA AA A A aaa 3 37 Ali SENOS A 3 37 PIRO ses eae E A S dacs enc nc sa E E EEEO MA 3 37 Frare UD Grad Cie acct sao rota s26 5ad6 q46 4684465066 i04614 06 444650446 to4616i50 1tnii02003 26040 80 3 808 6 0 64090 3 080098 0 g0 08 03608 3140 8 8050 3 38 COn Meg s1o E00 is 3 38 said eds DEE eaaa ee re er AO 3 39 PASSW ON 1002 D0 RO 3 39 MISC SUES e cei
33. TE the default SSID is MOXA and change the IP address of the second notebook Notebook B so that it is on the same subnet as the first notebook Notebook A which is connected to the AWK 4131 After configuring the WLAN card establish a wireless connection with the AWK 4131 and open a DOS window on Notebook B At the prompt type ping lt IP address of notebook A gt and then press Enter see the figure below A Reply from IP address response means the communication was successful A Request timed out response means the communication failed In this case recheck the configuration to make sure the connections are correct SSID MOXA IP 192 168 127 253 a mm H an a Re e _ PING E ei Notebook B Notebook A IP 192 168 127 1 IP 192 168 127 2 2 3 AWK 4131 Getting Started How to Test Two or More AWK 4131 Units If you have two or more AWK 4131 units you will need a second notebook computer Notebook B equipped with an Ethernet port Use the default settings for the first AWK 4131 connected to notebook A and change the second or third AWK 4131 connected to notebook B to Client mode and then configure the notebooks and AWK 4131 units properly Client AP IP 192 168 127 252 o oro RP 192 168 127 253 a PING Wes SSID MOXA 7 7 Notebook B Notebook A e IP 192 168 127 1 IP 192 168 127 2 After setting up the testing environment open a DOS window on noteboo
34. acon frames It is used to indicate that broadcast and multicast frames buffered by the AP will be delivered shortly Lower settings result in more efficient networking while preventing your PC from dropping into power saving sleep mode Higher settings allow your PC to enter sleep mode thus saving power 6 3 AWK 4131 References Fragment A lower setting means smaller packets which will create more packets for each transmission If you have decreased this value and experience high packet error rates you can increase it again but it will likely decrease overall network performance Only minor modifications of this value are recommended RTS Threshold RTS Threshold 256 2346 This setting determines how large a packet can be before the Access Point coordinates transmission and reception to ensure efficient communication This value should remain at its default setting of 2 346 When you encounter inconsistent data flow only minor modifications are recommended STP and RSTP The STP RSTP Concept Spanning Tree Protocol STP was designed to help reduce link failures in a network and provide protection from loops Networks that have a complicated architecture are prone to broadcast storms caused by unintended loops in the network The STP protocol is part of the IEEE802 1D standard 1998 Edition bridge specification Rapid Spanning Tree Protocol RSTP implements the Spanning Tree Algorithm and Protocol defined by EEE802 1w 2001 s
35. amage and resume system operation rapidly You can refer to the following instructions to recover the firmware Connect to the AWK 4131 s ES 232 console with 115200bps and N 8 1 You will see the following message shown on the terminal emulator every one second Section userdi k Ck um error Press Press Press Press Press Press Press Press Press Ctrl Ctrl C Chale Ctrl C Ctrl C Ctrl C Chela Ctrl C Ctrl C to enter enter enter enter enter enter enter enter Firmware Firmware Firmware Firmware Firmware Firmware Firmware Firmware lzabfieadde gt Oxb58c5051 Recoverying Recoverying Recoverying Recoverying Recoverying Recoverying Recoverying Recoverying Proces Proces Proces Proces Proces Proces Proces Proces C and the following message will appear Press Ctrl a to enter Firmware Recoverying Process IP address of AWE 4131 IP address of TFTP server 0 0 0 0 0 0 0 0 1 Start to flrmware upgrade using the ene network mare nc innediately 2 Change the network settings Enter your selection 1 2 enter for abort Enter 2 to change the network setting Specify where the AWK 4131 s firmware file on the TFTP server and press y to write the settings into flash memory IP addres of AWE 4131 IP address of TFTP server 1 Start to firmyvare upgrade using the above network setting immediately
36. an check the IP assignment status under Status gt DHCP Client List 3 22 AWK 4131 Web Console Configuration DHCP Server AP only DHCP server Disable Default gateway Subnet mask Primary DNS server Secondary DNS server Start IP address Maximum number of users Client lease time 10 1 10 days Static DHCP mapping No lActive IP Address MAC Address 1 Ol mp 00 N L pp DHCP server Factory Default Enables AWK 4131 as a DHCP server Disable DHCP server function Default gateway IP address of a default The IP address of the router that connects to an outside None gateway network Subnet mask Setting Description Factory Default subnet mask Identifies the type of sub network e g 255 255 0 0 for a None Class B network or 255 255 255 0 for a Class C network Primary Secondary DNS server IP address of Primary The IP address of the DNS Server used by your network After None Secondary DNS server entering the DNS Server s IP address you can use URL as well The Secondary DNS server will be used if the Primary DNS server fails to connect Start I P address IP address Indicates the IP address which AWK 4131 can start assigning Maximum number of users 1 999 Specifies how many IP address can be assigned continuously Client lease time 1 10 days The lease time for which an IP address is assigned The IP 10 days address may go expired after the lease ti
37. ance transmission or countering environmental interference The user must carefully evaluate and measure the transmission power of the entire system to ensure it stays below the regulative limit In addition that RF type 802 11a mode cannot be used if this function is enabled NOTE Make sure the same Transmission distance parameters are set in both AP and Client When this parameter is greater than 500 an optimal algorithm will be enabled to support long distance transmission Note that Transmission enhancement only supports 802 11b g n mode 802 1la mode is not supported Transmission enhancement is also recommended to enable communication at both ends when long distance transmission is required A high gain antenna installed at a fixed antenna connector can also improve performance EAPOL Version Factory Default 1 EAPOL version 1 was standardized in the 2001 version of 1 802 1X which is much more commonly implemented fi EAPOL version 2 was specified in 802 1X 2004 WMM Enable Disable WMM is a QoS standard for WLAN traffic Voice and video data 3 18 AWK 4131 Web Console Configuration will be given priority bandwidth when enabled with WMM Supported wireless clients Full 11a channel support Enable Disable Full 11a channel support allows users to select one channel Disable from 802 11a including channels in licensed and unlicensed bands Turbo Roaming for Client mode only Enable Disab
38. andards and Certifications 1 4 AWK 4131 Introduction Safety UL 60950 1 EN 60950 1 EMC EN 301 489 1 17 FCC Part 15 Subpart B Class B EN 55022 55024 Radio EN 300 328 EN 301 893 DSPR Japan Rail Traffic EN 50155 EN 50121 1 4 Note Please check Moxa s website for the most up to date certification status Warranty Warranty Period 5 years Details See www moxa com warranty ATTENTION 1 The AWK 4131 is NOT a portable mobile device and should be located at least 20 cm away from the human body 2 The AWK 4131 is NOT designed for the general public To deploy AWK 4131 units and establish a wireless network safely a well trained technician is required for installation Functional Design LAN Port The AWK 4131 comes standard with 1 combo Gigabit port Ethernet M12 or Fiber SFP The LAN LED will light up when the 1st LAN cable is inserted M12 8 pin Ethernet Port SFP Fiber Port ATTENTION Do not use the PoE Injector Instead use an IEEE 802 3af or IEEE 802 3at compliant PSE Power Sourcing Equipment for the PoE Power over Ethernet device Recommended SFP Accessories SFP 1G series e SFP 1GSXLC Small form factor pluggable transceiver with 1000BaseSX LC 0 5 km 0 to 60 C e SFP 1GSXLC T Small form factor pluggable transceiver with 1000BaseSX LC 0 5 km 20 to 75 C e SFP 1GLSXLC Small form factor pluggable transceiver with 1000BaseLSX LC 2 km O to 60 C e SFP 1GLSXLC T Small form factor pluggabl
39. can use either a straight through cable or crossover cable to connect the AWK 4131 to a computer The LED indicator on the AWK 4131 s LAN port will light up when a connection is established e Step 3 Set up the computer s IP address Choose an IP address on the same subnet as the AWK 4131 Since the AWK 4131 s default IP address is 192 168 127 253 and the subnet mask is 255 255 255 0 you should set the IP address of the computer to 192 168 127 xxx NOTE After you select Maintenance gt Load Factory Default and click the Submit button the AWK 4131 will be reset to factory default settings and the IP address will be reset to 192 168 127 253 Step 4 Use the web based manager to configure the AWK 4131 Open your computer s web browser and type http 192 168 127 253 in the address field to access the homepage of the web based Network Manager Before the homepage opens you will need to enter the user name and password as shown in the following figure For first time configuration enter the default user name and password and then click on the Login button Web Console Login Username admin Password Login goahead WEBSERVER NOTE Default user name and password User Name admin Password root For security reasons we strongly recommend changing the default password To do so select Maintenance gt Password and then follow the on screen instructions to change the password 2 2 AWK 4131 Getting Started NOTE
40. cation Commission Interference Statement gt R amp TTE Compliance Statement O Firmware Recovery O Technical Support Contact Information AWK 4131 Supporting I nformation About This User s Manual This manual is mainly designed for but no limited to the following hardware and firmware for the AWK 4131 e Hardware Rev 1 0 e Firmware Ver 1 1 You are strongly recommended to visit Moxa s website http www moxa com and find the latest product datasheet firmware QIG Quick Installation Guide UM User s Manual and related information NOTE You can find out the hardware revision number of AWK 4131 on the side label ITE samba CIR t banna LP 12 4nVLX 8 XeA POE UP 48VDC 250m4 e Made in Taiwan S PIN 1201041310010 The firmware version number can be seen on the Overview page as follow E Main Menu Overview LL Overview FQ Basic Settings All information on this page are active values FI Wireless Settings System Info FQ Advanced Settings Model name AWK 4131 JP HE Auto Warning Settings re name AWK 4131_ 0000 a Serial No o me System up time O days OOh 00m 455 BI Maintenance Firmware version Ci Duid 11061403 J Save Configuration Device Info rE Restart Device MAC address 00 290 E8 00 03 10 E Logout IP address 192 168 127 253 Subnet mask daa aaa all Gateway 807 11 Info Country code JP Operation mode AP Channel 6 RF type B G M Mixed SSID Moma DoC Declaration of Conformity
41. cation on a large scale network It is not necessary to exchange keys or passphrases WLAN Security Settings Security mode WPA WPA type Enterprise Encryption method Primary RADIUS server IP Primary RADIUS server port Primary RADIUS shared key Secondary RADIUS server IP Secondary RADIUS server port 1812 Secondary RADIUS shared key Key renewal 3600 60 86400 seconds WPA type Provides Pre Shared Key enabled WPA and WPA2 Personal Provides enterprise level security for WPA and WPA2 Encryption method TKIP S Provides TKIP broadcast key and TKIP AES unicast key for some legacy AP clients This option is rarely used This option is available in AP Master mode only and cannot support AES enabled clients This option is only available with 802 11a b g standard Primary Secondary RADIUS server IP Description Factory Default The IP address of Specifies the delegated RADIUS server for EAP None RADIUS server Primary Secondary RADIUS port Factory Default Port number Specifies the port number of the delegated RADIUS server 1812 Primary Secondary RADIUS shared key Factory Default Max of 31 characters The secret key shared between AP and RADIUS server None Key renewal 60 to 86400 seconds Specifies the time period of group key renewal 3600 seconds 1 minute to 1 year 3 13 AWK 4131 Web Console Configuration WPA WPA2 Enterprise for Client Slave mode When used a
42. cription Factory Default The AWK 4131 senses and adjusts the data rate automatically Available rates Users can manually select a target transmission data rate Multicast Rate Multicast Rate Users can configure a fixed multicast rate for the transmission 54 M of broadcast and multicast packets on a per radio basis This 3 16 AWK 4131 Web Console Configuration parameter can be useful in an environment where multicast video streaming is occurring in the wireless medium Guard Interval Guard Interval Guard interval is used to ensure that distinct transmissions do 800ns not interfere with one another You can select the guarding interval manually for Wireless N connections The two options are Short 400ns and Long 800ns Transmission Power RF type 2 4 GHz Factory Default Auto Specifies wireless signal coverage by automatically selecting Full the strength of Tx power NOTE Each antenna port s Tx power at Full e US model 18 dBm e EU model 16 dBm e JP model 18 dBm RF type 5 GHz Auto Specifies wireless signal coverage by automatically selecting Full the strength of Tx power Equivalent to full Tx power NOTE Each antenna port s Tx power at Full e US model 14 dBm e EU model 16 dBm e JP model 14 dBm Beacon Interval for AP Master mode only Beacon Interval Indicates the frequency interval of the beacon 100 ms 40 to 1000 ms DTI M Interval for AP Maste
43. crypt outgoing packets and decrypt incoming packets e WPA WPA2 Enterprise Also called WPA WPA2 EAP Extensible Authentication Protocol In addition to device based authentication WPA WPA2 Enterprise enables user based authentication via IEEE802 1X The AWK 4131 can support three EAP methods EAP TLS EAP TTLS and EAP PEAP WLAN Security Settings Security mode Security mode Setting Description Faactory Default No authentication Open WEP Static WEP is used WPA2 Fully supports EEE802 11i with TKIP AES 802 1X Open For security reasons you should NOT set security mode to Open System since authentication and data encryption are NOT performed in Open System mode 3 10 AWK 4131 Web Console Configuration WEP According to the IEEE802 11 standard WEP can be used for authentication and data encryption to maintain confidentiality Shared or Shared Key authentication type is used if WEP authentication and data encryption are both needed Normally Open or Open System authentication type is used when WEP data encryption is run with authentication When WEP is enabled as a security mode the length of a key So called WEP seed can be specified as 64 128 bits which is actually a 40 104 bit secret key with a 24 bit initialization vector The AWK 4131 provides 4 entities of WEP key settings that can be selected to use with Key index The selected key setting specifies the key to be used as a send key for encrypt
44. d wirelessly As illustrated in the above figure a pair of wireless LAN to LAN bridges is used to connect two LAN segments Since the AP is WDS enabled it can be used as a wireless bridge Bridge Bridged It is a good idea to plan your wireless network by drawing a diagram so that you know how each AWK 4131 is connected to other peer APs or wireless bridges by WDS and how bridges are connected to other peer bridges by WDS See the following figure for an example of a network planning diagram 6 2 AWK 4131 References LAN Segment 2 A AS WDS link we j LAN LAN Segment3 lo Segment 1 SS AN I ATTENTI ON Be sure to eliminate loops from networks that consist of wireless bridges Ethernet switches Ethernet links and WDS links If any loops exist packets will circle around the loops and network performance will be seriously degraded The following figure shows a network topology containing a loop Seg WDS link Bridge 1 Ethernet Link A N ah wae Bridge 2 Ethernet Switch Beacon A beacon is a packet broadcast by the AP to keep the network synchronized A beacon includes the wireless LAN service area the AP address the Broadcast destination address a time stamp Delivery Traffic Indicator Maps DTIM and the Traffic Indicator Message TIM Beacon Interval indicates the frequency interval of AP DTIM Delivery Traffic Indication Map DTIM is contained in be
45. da dd do d da 2 3 HOW C TesuOne AWIS4d Slits r n Haat iy2g IA O Aa RANES 2 3 How to Test Two or More AWK 4131 UnifS ng HH TT HE Ki nh ki K 2 4 PONCHON E 2 5 3 Web Console C HHGUFQLION AAA AAA 3 1 WED BTOWSEr A A c A c na T Ca S 3 2 OVE OW raa 2504102 A E o O O O O A be 3 3 O 141 1 14 1 1 144 44 4 1a 3 4 SV SUSI IPOS A O O O E ERE EEEREN 3 4 NetWork Sed roda 3 5 HME SENOS 219085 Sane Ge ty it eee Ty Thi n i n aren A8 anes aivfAU ae ont MUNG UV M AE Me Soeoteaa tenet aah ae her uner hear ANARA 3 6 Wireless CLUINGS 2101106102 0110020062 A O Kia POC AO OT A O 3 7 Operation Mode ici A A E AA ARA AAA Ai fdlafrAma tdnafiarafranastaramsieadldsoglaee 3 7 Basic Wireless SUNN SEARS RA AENA REE aaa 3 8 WLAN SUS e e 3 10 Advanced Wireless Settings siii s 3 16 WLAN Certification Settings for EAP TLS in Client Slave mode Only c c 3 19 Adv anced O 3 20 SIRO VIE CU al EAN n4 s20 s 070 d6 t6 ng 0h ao nai Sunt tai seam 66168408 penne Sean 461266616 486 32008 0014 8018 98401A0 84002 8408 ane seae saeo amet 3 20 Configuring a Virtual LAN nr cnn 3 21 DHCP Server for AP mode only isaac dd 3 22 Packet FINETO c 1x2 A E eet rr a eet er ee ree err err Te 3 24 RS TP Settings TO AP MOUE ONIY xa 16a ac 0 ti n cece eae ce case AA AAAA 3 26 SNMP AJEN acess sition det imply c A ados 3 27 Link Fault Pass Through for Client
46. dates product information certification status installation guide and user s manual updates The following services are provided e E mail for technical support Support moxa com Worldwide Support usa moxa com The Americas e World Wide Web WWW Site for product information http www moxa com 7 5
47. e 1 to 4094 port can be a LAN port or WLAN ports VLAN Tagged A comma seperated list Specify which VLANs can communicate with this specific VLAN Empty of VLAN IDs Each of the VLAN IDs range from 1 to 4094 The VLAN feature can allow wireless clients to manage the AP If the VLAN Management ID matches a VLAN ID then those wireless clients who are members of that VLAN will have AP management access CAUTION Once a VLAN Management ID is configured and is equivalent to one of the VLAN IDs on the AP all members of that User VLAN will have management access to the AP Be careful to restrict VLAN membership to those with legitimate access to the AP DHCP Server for AP mode only DHCP Dynamic Host Configuration Protocol is a networking protocol that allows administrators to assign temporary IP addresses to network computers by leasing an IP address to a user for a limited amount of time instead of assigning permanent IP addresses The AWK 4131 can act as a simplified DHCP server and easily assign IP addresses to your wireless clients by responding to the DHCP requests from the client ends The P related parameters you set on this page will also be sent to the client You can also assign a static IP address to a specific client by entering its MAC address The AWK 4131 provides a Static DHCP mapping list with up to 16 entities Be reminded to check the Active check box for each entity to activate the setting You c
48. e transceiver with 1000BaseLSX LC 2 km 40 to 85 C 1 5 AWK 4131 Introduction e SFP 1GLXLC Small form factor pluggable transceiver with 1000BaseLX LC 10 km 0 to 60 C e SFP 1GLXLC T Small form factor pluggable transceiver with 1000BaseLX LC 10 km 40 to 85 C e SFP 1GLHLC Small form factor pluggable transceiver with 1000BaseLH LC 30 km O to 60 C e SFP 1GLHLC T Small form factor pluggable transceiver with 1000BaseLH LC 30 km 40 to 85 C e SFP 1GLHXLC Small form factor pluggable transceiver with 1000BaseLHX LC 40 km O to 60 C e SFP 1GLHXLC T Small form factor pluggable transceiver with 1000BaseLHX LC 40 km 40 to 85 C e SFP 1GZXLC Small form factor pluggable transceiver with 1000BaseZX LC 80 km 0 to 60 C e SFP 1GZXLC T Small form factor pluggable transceiver with 1000BaseZX LC 80 km 40 to 85 C e SFP 1GEZXLC Small form factor pluggable transceiver with 1000BaseEZX LC 110 km O to 60 C e SFP 1GEZXLC 120 Small form factor pluggable transceiver with 1000BaseEZX LC 120 km O to 60 C LED Indicators The LEDs on the front panel of AWK 4131 allow you to identity the status and wireless settings quickly The LED for FAULT indicates the system failure and user configured events If the AWK 4131 cannot retrieve the IP address from a DHCP server the FAULT LED will blink at an interval of one second MOXA AWK 4121 The following table is a Summary for the wireless settings and LED disp
49. erial console configurations when you cannot access the AWK 4131 over Ethernet LAN such as in the case of LAN cable disconnections or broadcast storming over the LAN ATTENTION Do not use the RS 232 console manager when the AWK 4131 is powered at reversed voltage ex 48VDC even though reverse voltage protection is supported If you need to connect the RS 232 console at reversed voltage Moxa s TCC 82 isolator is your best solution NOTE We recommend using Moxa PComm Lite Terminal Emulator which can be downloaded free of charge from Moxa s website Before running PComm Terminal Emulator use an RJ 45 to DB9 F or RJ 45 to DB25 F cable to connect the AWK 4131 s RS 232 console port to your PC s COM port generally COM1 or COM2 depending on how your system is set up After installing PComm Terminal Emulator take the following steps to access the RS 232 console utility 1 From the Windows desktop open the Start menu and start PComm Terminal Emulator in the PComm Lite group 2 Select Open under Port Manager to open a new connection FComm Terminal Emulator Profile 3 The Communication Parameter page of the Property window opens Select the appropriate COM port for Console Connection 115200 for Baud Rate 8 for Data Bits None for Parity and 1 for Stop Bits Click on the Terminal tab and select VT100 or ANSI for Terminal Type Click on OK to continue Property A Property Communication Parameter Termi
50. erms before starting the configuration process AP In a wireless local area network WLAN an access point is a station that transmits and receives data Client When the AWK 4131 is configured for Client mode it can be used as an Ethernet to wireless or LAN to WLAN network adaptor For example a notebook computer equipped with an Ethernet adaptor but no wireless card can be connected to this device with an Ethernet cable to provide wireless connectivity to another AP Operation Mode The AWK 4131 supports four main operation modes AP Client Master and Slave each of which plays a distinct role on the wireless network Operation Mode Wireless enable Enable Disable Operation mode Submit Wireless Enable Setting ss Description Factory Default Enable Disable The RF Radio Frequency module can be manually turned on or Enable off This function is available in AP operation mode only Operation Mode Description The AWK 4131 plays the role of wireless AP Bridge AP The AWK 4131 plays the role of wireless AP Client Master This mode collocates with AWK 5232 6232 s Wireless bridge mode The AWK 4131 plays the role of wireless Master Slave This mode collocates with AWK 5232 6232 s Wireless bridge mode The AWK 4131 plays the role of wireless Slave 3 7 AWK 4131 Web Console Configuration Basic Wireless Settings The WLAN Basic Setting Selection panel is used to add and edit SSIDs An SSID is a
51. es you will find a blinking string in the upper right corner of the screen After making all your changes click the Restart function in the left menu box One of two different screens will appear If you made changes recently but did not save you will be given two options Clicking the Restart button here will reboot the AWK 4131 directly and all setting changes will be ignored Clicking the Save and Restart button will apply all setting changes and then reboot the AWK 4131 3 40 AWK 4131 Web Console Configuration Restart 1 Warning Click Restart to discard changes and reboot AWK 4131 US directly Click Save and Restart to apply all setting changes and reboot AWK 4131 US Save and Restart If you run the Restart function without changing any configurations or saving all your changes you will see just one Restart button on your screen Restart Clicking Restart will disconnect all Ethernet connections and reboot AWK 4131 US You will not be able to run any of the AWK 4131 s functions while the system is rebooting Logout Logout helps users disconnect the current HTTP or HTTPS session and go to the Login page For security reasons we recommend you logout before quitting the console manager Logout Click Logout button to defalut Login page Logout 3 41 4 Software I nstallation Configuration The following topics are covered in this chapter O Overview O AWK Search Utility gt Installi
52. et the waiting time for the Firmware to write to flash Advanced Options Search Connection Misc Connection timeout secs 1 Upgrade timeout secs 500 _w XK Cancel Misc Search on start Checkmark this box if you would like the search function to start searching for devices after you log in to the AWK search Utility Advanced Optons Search Connection Misc Search on start e HE C Cancel 4 7 5 Other Console Configurations This chapter explains how to access the AWK 4131 for the first time In addition to HTTP access there are four ways to access AWK 4131 serial console Telnet console SSH console and HTTPS console The serial console connection method which requires using a short serial cable to connect the AWK 4131 to a PC s COM port can be used if you do not know the AWK 4131 s IP address The other consoles can be used to access the AWK 4131 over an Ethernet LAN or over the Internet The following topics are covered in this chapter O RS 232 Console Configuration 115200 None 8 1 VT100 O Configuration by Telnet and SSH Consoles O Disabling Telnet and Browser Access AWK 4131 Other Console Configurations RS 232 Console Configuration 115200 None 8 1 VT100 The serial console connection method which requires using a short serial cable to connect the AWK 4131 toa PC s COM port can be used if you do not know the AWK 4131 s IP address It is also convenient to use s
53. f contact e Define and monitor groups e Reduce broadcast and multicast traffic to unnecessary destinations e Improve network performance and reduce latency e Increase security e Secure network restricts members to resources on their own VLAN 3 20 AWK 4131 Web Console Configuration e Clients roam without compromising security VLAN Workgroups and Traffic Management The AP assigns clients to a VLAN based on a Network Name SSID The AP can support up to 9 SSIDs per radio interface with a unique VLAN configurable per SSID The AP matches packets transmitted or received to a network name with the associated VLAN Traffic received by a VLAN is only sent on the wireless interface associated with that same VLAN This eliminates unnecessary traffic on the wireless LAN conserving bandwidth and maximizing throughput In addition to enhancing wireless traffic management the VLAN capable AP supports easy assignment of wireless users to workgroups In a typical scenario each user VLAN represents a department workgroup for example one VLAN could be used for a marketing department and the other for a human resource department In this scenario the AP would assign every packet it accepted to a VLAN Each packet would then be identified as marketing or human resource depending on which wireless client received it The AP would insert VLAN headers or tags with identifiers into the packets transmitted on the wired backbone to a network switc
54. ficates are still needed for outer authentication in a simplified form Only a small number of certificates are required which can be generated by a small certificate authority Certificate reduction makes TTLS and PEAP much more popular than EAP TLS The AWK 4131 provides some non cryptographic EAP methods including PAP CHAP MS CHAP and MS CHAP V2 These EAP methods are not recommended for direct use on wireless networks However they may be useful as inner authentication methods with TTLS and PEAP Because the inner and outer authentications can use distinct user names in TTLS and PEAP you can use an anonymous user name for the outer authentication with the true user name only shown through the encrypted channel Keep in mind that not all client software supports anonymous alteration Confirm this with the network administrator before you enable identity hiding in TTLS and PEAP WLAN Security Settings Security mode wPa2z y WPA type Enterprise Encryption method TKIP EAP Protocol TLS TTLS Inner Authentication MS CHAP V2 7 Anonymous User name Password TTL Inner Authentication Password Authentication Protocol is used MS CHAP V2 CHAP Challenge Handshake Authentication Protocol is used MS CHAP Microsoft CHAP is used MS CHAP V2 Microsoft CHAP version 2 is used Anonymous Factory Default Max of 31 characters A distinct name used for outer authentication None User name amp Password Factory Defau
55. h Finally the switch would be configured to route packets from the marketing department to the appropriate corporate resources such as printers and servers Packets from the human resource department could be restricted to a gateway that allowed access to only the Internet A member of the human resource department could send and receive e mail and access the Internet but would be prevented from accessing servers or hosts on the local corporate network vLAN S VLAN 2 s rloor 3 1 VLAN 3 ggi0 3 Y TL 510 rior 2 g i won ill E poor 1 l t gt l 6 2 Configuring a Virtual LAN To configure the AWK s VLAN use the VLAN Setting page to configure the ports VLAN Settings for AP Master Slave mode only Management LAN ID 1 Port PVID LAN Tagged Please use comma to separate multiple VLAN tags LAN 1 MOXA 1 SSID2 1 SSID3 1 SS5ID4 1 SSIDS 1 SSID6 1 SSID7 1 SSID8 1 SSID9 1 Management VLAN ID 3 21 AWK 4131 Web Console Configuration NOTE VLAN ID Set the management VLAN of this AWK ranges from 1 to 4094 Trunk Port LANs This port is the LAN port on the AWK This is a wireless port for the specific SSID This field will refer to the SSID that you have created If more SSIDs have been created new rows will be added Port PVID VLAN ID ranging from 1 Set the port s VLAN ID for devices that connect to the port Th
56. h read write permissions using this community string 3 28 AWK 4131 Web Console Configuration SNMP agent version V1 V2c V3 or Select the SNMP protocol version used to manage the switch V1 V2c V1 V2c or V3 only Admin auth type for V1 V2c V3 and V3 only Use admin account to access objects No authentication No Auth MD5 Provide authentication based on the HMAC MD5 algorithms 8 character passwords are the minimum requirement for authentication SHA Provides authentication based on HMAC SHA algorithms 8 character passwords are the minimum requirement for authentication Admin private key for V1 V2c V3 and V3 only DES based data encryption AES based data encryption Private key A data encryption key is the minimum requirement for data encryption maximum of 63 characters Private MIB Information Device Object ID Also know as OID This is the AWK 4131 s enterprise value It is fixed Link Fault Pass Through for Client Slave mode only This function means if Ethernet port is link down wireless connection will be forced to disconnect Once Ethernet link is recovered AWK will try to connect to AP If wireless is disconnected AWK restarts auto negotiation on Ethernet port but always stays in the link failure state Once the wireless connection is recovered AWK will try to recover the Ethernet link System log will indicate the link fault pass through events in addition to the original lin
57. ient role which is connected to a device PLC RTU etc as opposed to network switch equipment it is not necessary to enable STP RSTP The reason is that it will cause unnecessary negotiation AWK 4131s support STP RSTP in AP mode including WDS only The following figures indicate which Spanning Tree Protocol parameters can be configured A more detailed explanation of each parameter is given below the figure RSTP Settings for Master or Slave mode only Bridge priority 32768 w Hello time 1 10 seconds Forwarding delay 4230 seconds Max age 6 40 seconds No L lEnahle RSTP Pnrt Prinrity Pnrt Cnst Edge Port 1 LAN O 200000 O RSTP status This field will appear only when selected to operate STP RSTP It indicates whether this AWK 4131 is the Root of the Spanning Tree the root is determined automatically or not Bridge priority Numerical value You can increase the bridge priority by selecting a lower 32768 selected number A higher bridge priority brings a greater chance of by user being established as the root of the Spanning Tree topology Hello time Numerical value input The root of the Spanning Tree topology periodically sends out a 2 seconds by user hello message to other devices on the network to check if the 1 10 seconds topology is healthy Hello time indicates how often the root sends hello messages Forwarding delay Numerical value input The amount of time this device waits
58. immediate activation Use 24 hour format yyyy mm dd hh mm ss Time zone User selectable time The time zone setting allows conversion from GMT Greenwich GMT Greenwich zone Mean Time to local time Mean Time ATTENTION Changing the time zone will automatically adjust the Current local time You should configure the Time zone before setting the Current local time Daylight saving time Enable Disable Daylight saving time also know as DST or summer time Disable involves advancing clocks usually 1 hour during the summer time to provide an extra hour of daylight in the afternoon When Daylight saving time is enabled the following parameters will be shown e Starts at The date that daylight saving time begins e Stops at The date that daylight saving time ends e Time offset Indicates how many hours forward the clock should be advanced 3 6 AWK 4131 Web Console Configuration T me server 1 2 IP Name of Time IP or Domain name of the NTP time server The 2nd NTP server None Server 1 2 will be used if the 1st NTP server fails to connect Query period Query period time This parameter determines how often the time is updated from 600 seconds 1 to 9999 seconds the NTP server Wireless Settings The essential settings for wireless networks are presented in this function group Settings must be properly set before establishing your wireless network Familiarize yourself with the following t
59. ing traffic from the AP side to the wireless client side All 4 WEP keys are used as receive keys to decrypt traffic from the wireless client side to the AP side The WEP key can be presented in two Key types HEX and ASCII Each ASCII character has 8 bits so a 40 bit or 64 bit WEP key contains 5 characters and a 104 bit or 128 bit key has 13 characters In hex each character uses 4 bits so a 40 bit key has 10 hex characters and a 128 bit key has 26 characters WLAN Security Settings Security mode WEP Authentication type Open Key type HEX v Key length 64 bits v key index 11m WEP key 1 TETTETETT WEP key 2 WEP key 3 WEP key 4 o Authentication type Factory Default Data encryption is enabled but without authentication Open Data encryption and authentication are both enabled Factory Default Specifies WEP keys in hex decimal number form HEX Specifies WEP keys in ASCII form Key length 64 bits Uses 40 bit secret keys with 24 bit initialization vector 64 bits 128 bits Uses 104 bit secret key with 24 bit initialization vector Key index 1 4 Specifies which WEP key is used WEP key 1 4 ASCII type A string that can be used as a WEP seed for the RC4 encryption None 64 bits 5 chars engine 128 bits 13chars HEX type 64 bits 10 hex chars 128 bits 26 hex chars WPA WPA2 Personal WPA Wi Fi Protected Access and WPA2 represent significant improvements over the WEP encryption
60. interface 1 Open your web browser e g Internet Explorer and type the AWK 4131 s IP address in the address field Press Enter to establish the connection 3 about blank Microsoft Internet Explorer File Edit View Favorites Tools Help 2 The Web Console Login page will open Enter the password default Username admin default Password root and then click Login to continue Web Console Login Username admin Password Login goahead WEBSERVER 3 You may need to wait a few moments for the web page to download to your computer Note that the Model name and IP address of your AWK 4131 are both shown in the title bar of the web page This information can be used to help you identify multiple AWK 4131 units 3 2 AWK 4131 Web Console Configuration 4 Use the menu tree on the left side of the window to open the function pages to access each of the AWK 4131 s functions a en ren UY Overview HE Basic Settings HE Wireless Settings BI N Advanced Settings Model name AWK 4131 US EM Auto Warning Settings Device name AWK 4131_ 0357 HY Status Serial No 357 E ee re System up time O days ooh 05m 53s l Firmware version 1 0 Build 11041314 Save Configuration Overview All information on this page are active values System Info m ca Device Info Tu Resta E Device MAC address 00 90 E8 22 B6 CA ogen IP address 192 168 127 253 Subnet mask 255 255 255 0 Gateway In the follo
61. is a problem with the site s security certificate A The security certificate was issued by a company you have not chosen to trust View the certificate to determine whether you want to trust the certifying authority The security certificate date is valid The security certificate has a valid name matching the name of the page you are trying to view Do you want to proceed i View Certificate 5 4 AWK 4131 Other Console Configurations 3 Select Yes to accept the certificate issued by Moxa IW and then enter the AWK 4131 s web browser interface secured via HTTPS SSL You can see the protocol in URL is https Then you can use the menu tree on the left side of the window to open the function pages to access each of AWK 4131 s functions 3 MOXA AWK 3121 JP 192 168 127 253 Microsoft Internet Explorer El x File Edit View Favorites Tools Help back M x B A DO Search STe Favorites O 2 LJ Pr Address https 192 168 127 253 home asp Go Total Solution for Industrial Wireless Networking SJ Main Menu Overview Af Basic Settings Af Wireless Settings Flim Adusanead Cattinac Overview All information on this page are active values System info Disabling Telnet and Browser Access If you are connecting the AWK 4131 to a public network but do not intend to use its management functions over the network then we suggest disabling both Telnet Console and Web Configu
62. ist MAC IP 1 DO 15 ce el ee ef 192 168 127 2 Select all Refresh You can press Select all button to select all content in the list for further editing Copy Paste Select All Print Select all Refresh 3 35 AWK 4131 Web Console Configuration System Log Triggered events are recorded in System Log You can export the log contents to an available viewer by clicking Export Log You can use the Clear Log button to clear the log contents and the Refresh button to refresh the log System Log 116 2008 06 18 20h 46m 50s Power 1 transition Off gt On 117 2008 06 18 20h 46m 50s LAN link on 118 2008 06 18 21h 17m 01s System restart 119 2008 06 18 21h 17m 10s Power 1 transition Off gt On 120 2008 06 18 21h 17m 10s LAN link on 121 2008 06 18 21h 19m 55s System restart 122 2008 06 18 21h 20m 04s Power 1 transition Off gt On 123 2008 06 18 21h 20m 04s LAN link on 124 2008 06 18 21h 20m 21s Client 00 13 CE E1 EE EF joined 125 2008 06 18 21h 21m 31s Client 00 13 CE E1 EE EF joined 126 2008 06 18 21h 26m 05s System restart 127 2008 06 18 21h 26m 14s Power 1 transition Off gt On 128 2008 06 18 21h 26m 14s LAN link on 129 2008 O6 18 21h 26m 18s Client 00 13 CE E1 EE EF joined 130 2008 06 18 21h 26m 33s Client 00 13 CE E1 EE EF joined 131 2008 06 18 21h 27 m 22s Client 00 13 CE E1 EE EF leaved 132 2008 06 18 21h 28m 22s Client
63. k B At the prompt type ping lt IP address of notebook A gt and then press Enter A Reply from IP address response means the communication was successful A Request timed out response means the communication failed In this case recheck the configuration to make sure the connections are correct 2 4 AWK 4131 Getting Started Function Map ES usin ee overview of the AWK 4131 s status din Menu G Overview 29 Basic Settings A System Info Settings am Network Settings H Time Settings ag Wireless Settings E PC Operation Mode ES WLAN 2 0 Basic Wireless Settings 0 WLAN Security Settings T Advanced Wireless Settings ai WLAN Certificate Settings 29 Advanced Settings r LAN Settings 1 DHCP Server 2 aa Packet Filters o Mac Filters 1 IP Protocol Filters O TCP UDP Part Filters Note These advanced functions are all optional LO RSTP Settings 0 SNMP Agent i 0I Link Fault Pass Through Pa Auto Warning Settings aa System Log E da SN System Log Event Types Basic settings for administering the AWK 4131 Essential settings related to establishing a wireless network Advanced features to support additional network management and secure wired and wireless communication 3 Syslog h l Syslog Event Types hC Syslog Server Settings i E mail 7 gm E mail Event Types Application oriented device management functions to set up events traps and reactions via relay warning e mail and
64. k up down events Link Fault Pass Through for Client Slave mode only Link Fault Pass Through Enable Disable Submit Link Fault Pass Through Enables Link Fault Pass Through Disable Disables Link Fault Pass Through Auto Warning Settings Since industrial grade devices are often located at the endpoints of a system these devices will not always know what is happening elsewhere on the network This means that these devices including wireless APs or clients must provide system maintainers with real time alarm messages Even when system administrators 3 29 AWK 4131 Web Console Configuration are out of the control room for an extended period they can still be informed of the status of devices almost instantaneously when exceptions occur In addition to logging these events the AWK 4131 supports different approaches to warn engineers automatically such as SNMP trap e mail and relay output It also supports two digital inputs to integrate sensors into your system to automate alarms by email and relay output System Log System Log Event Types Detail information for grouped events is shown in the following table You can check the box for Enable log to enable the grouped events All default values are enabled checked The log for system events can be seen in Status gt System Log System log Event Types Event group Enable log x System related events xI Network related events x Config related e
65. l Protocols Proxy ARP DNS HTTP HTTPS IP ICMP SNTP TCP UDP RADIUS SNMP PPPoE DHCP AP only Protocols ARP BOOTP DHCP dynamic VLAN Tags for 802 1X Clients STP RSTP IEEE 802 1D w Interface Default Antennas 2 dual band omni directional antennas 5 dBi at 2 4 GHz 2 dBi at 5 GHz N type male Connector for External Antennas N type female LAN Ports 1 10 100 1000BaseT X auto negotiation speed M12 female type Fiber Ports 1 1000BaseSFP slot Console Port RS 232 waterproof RJ 45 type LED Indicators PWR FAULT STATE WLAN LAN Alarm Contact digital output M12 male connector 1 relay output with current carrying capacity of 1 A 24 VDC Digital Inputs M12 connector 2 electrically isolated inputs e 13 to 30 V for state 1 e 3 to 30 V for state 0 e Max input current 8 mA Physical Characteristics Housing Metal IP68 protection Weight 1 8 kg Dimensions 224 x 147 7 x 64 5 mm 8 82 x 5 82 x 2 54 in Installation Wall mounting standard DIN Rail mounting optional pole mounting optional Environmental Limits Operating Temperature 40 to 75 C 40 to 167 F Storage Temperature 40 to 85 C 40 to 185 F Ambient Relative Humidity 5 to 100 non condensing Power Requirements Input Voltage 12 to 48 VDC redundant dual DC power inputs or 48 VDC Power over Ethernet IEEE 802 3af compliant Connector M12 connector with A coding Reverse Polarity Protection Present St
66. lays You can check the status of the AWK 4131 by reading these LEDs More information about Basic Wireless Settings is presented in Chapter 3 Color State Description Green On Power is being supplied from power input 1 or 2 or PoE Off Power is not being supplied On Relay is event triggered Blink slow Cannot get an IP address from the DHCP server interval 1 sec Blink fast IP address conflict interval 0 5 sec Off Normal status Green Red Green Software Ready Green Blink The AWK Search Utility has located the AWK interval 1sec Booting or Error condition Green Amber Green On WLAN functions in Client mode Green Blink WLAN s data communication is run in Client mode Amber On WLAN functions in AP Bridge mode Amber Blink WLAN s data communication is run in AP Bridge mode 1 6 AWK 4131 Introduction ATTENTION When the LEDs for STATE Green FAULT and WLAN all light up simultaneously and blink at one second intervals it means the system failed to boot This may be due to improper operation or uncontrollable issues such as an unexpected shutdown during firmware update To recover the firmware refer to Firmware Recovery in Chapter 6 Beeper The beeper signals that the system is ready with two short beeps Reset Button The RESET button is located on the bottom panel of the AWK 4131 You can reboot the AWK 4131 or reset it to factory default settings by pressing the RESET butt
67. le Moxa s Turbo Roaming can enable rapid handover when the Disable AWK 4131 as a client roams among a group of APs When Turbo Roaming is enabled the RF type AP alive check and Scan channels will be shown as follows RF type shows the current RF type that this client is using AP alive check will check if the AP connection is still available When this function is enabled a check will be done every 10 ms You can set up Scan channels for the APs among which this client is going to roam There are three Scan channels available Note that the Scan channels may need to be modified when the RF type is changed For example channel 36 is not available in B G N or B G N Mix mode Turbo roaming Enable RF type h AP alive check Scan channels 3 h wt WLAN Certification Settings for EAP TLS in Client Slave mode only When EAP TLS is used a WLAN Certificate will be required at the client end to support WPA WPA2 Enterprise The AWK 4131 can support the PKCS 12 also known as Personal Information Exchange Syntax Standard certificate formats that define file formats commonly used to store private keys with accompanying public key certificates protected with a password based symmetric key WLAN Certificate Settings Current status Certificate issued to Certificate issued by Certificate expiration date Current Status displays information for the current WLAN certificate which has been imported into the AWK 4131 Nothing will be
68. lient ex PuTTY please run the client program ex putty exe and then input the AWK 4131 s IP address specifying 22 for the SSH connection port iS PuTTY Configuration x Category E Session Basic options tor your PuT TY session Terminal specify the destination you wantto connectto Keyboard Host Mame or IF address gt Bell fisz 168 127 253 m i a Connection type aa C Baw Telnet Rlogin SSH Serial Appearance 3 The Console login screen will appear Please refer to the previous paragraph RS 232 Console Configuration and for login and administration Configuration by Web Browser with HTTPS SSL To secure your HTTP access the AWK 4131 supports HTTPS SSL encryption for all HTTP traffic Perform the following steps to access the AWK 4131 s web browser interface via HTTPS SSL 1 Open your web browser and type https lt AWK 4131 s IP address gt in the address field Press Enter to establish the connection 3 https 7 192 168 127 253 home asp Microsoft Internet Explorer File Edit View Favorites Tools Help Back gt O 2 Y GQSearch Favortes Media c4 D 3 El Address ES https 192 168 127 253 home asp 2 Warning messages will pop out to warn users that the security certificate was issued by a company they have not chosen to trust Security Alert X Information you exchange with this site cannot be viewed or Y changed by others However there
69. lt User name and password used in inner authentication None PEAP There are a few differences in the TTLS and PEAP inner authentication procedures TTLS uses the encrypted channel to exchange attribute value pairs AVPs while PEAP uses the encrypted channel to start a second EAP exchange inside of the tunnel The AWK 4131 provides MS CHAP V2 merely as an EAP method for inner 3 15 AWK 4131 Web Console Configuration authentication WLAN Security Settings Security mode wpaz WPA type Enterprise Encryption method TKIP EAP Protocol PEAP y Inner E amp P protocol MS CHAP V2 7 Anonymous User name FO Password Inner EAP protocol Factory Default MS CHAP V2 Microsoft CHAP version 2 is used MS CHAP V2 Anonymous Factory Default Max of 31 characters A distinct name used for outer authentication None User name amp Password User name and password used in inner authentication None Advanced Wireless Settings Additional wireless related parameters are presented in this section to help you set up your wireless network in detail Advanced Wireless Settings Transmission rate Auto Multicast Rate Guard interval 800r Transmission power Beacon interval 100 40 1000ms DTIM interval 1 1 15 Fragmentation threshold 256 2346 RTS threshold 256 2346 Transmission distance 500 11000m Noise protection Transmission enhancement WMM Full 11a channel support Transmission Rate Des
70. mains in a layer 2 network The DHCP server helps you deploy wireless clients efficiently Packet filters provide security mechanisms such as firewalls in different network layers Moreover the AWK 4131 can Support STP RSTP protocol to increase reliability across the entire network and SNMP support can make network management easier Using a Virtual LAN Setting up Virtual LANs VLANs on your AWK series increases the efficiency of your network by dividing the LAN into logical segments as opposed to physical segments In general VLANs are easier to manage What is a VLAN A virtual LAN commonly known as a VLAN is a group of hosts with a common set of requirements that communicate as if they were attached to the same broadcast domain regardless of their physical location A VLAN has the same attributes as a physical LAN but it allows for end stations to be grouped together even if they are not located on the same network switch Network reconfiguration can be done through software instead of physically relocating devices VLANs now extend as far as the reach of the access point signal Clients can be segmented into wireless sub networks via SSID and VLAN assignment A Client can access the network by connecting to an AP configured to support its assigned SSID VLAN Benefits of VLANs VLANs are used to conveniently efficiently and easily manage your network in the following ways e Manage adds moves and changes from a single point o
71. me is reached 3 23 AWK 4131 Web Console Configuration Packet Filters The AWK 4131 includes various filters for IP based packets going through LAN and WLAN interfaces You can set these filters as a firewall to help enhance network security MAC Filter The AWK 4131 s MAC filter is a policy based filter that can allow or filter out IP based packets with specified MAC addresses The AWK 4131 provides 8 entities for setting MAC addresses in your filtering policy Remember to check the Active check box for each entity to activate the setting MAC Filters Enable Disable Policy Drop No Active Name MAC address Enables MAC filter Disable Policy Only the packets fitting the entities on list can be allowed Any packet fitting the entities on list will be denied ATTENTION Be careful when you enable the filter function Drop no entity on list is activated all packets are allowed Accept no entity on list is activated all packets are denied IP Protocol Filter The AWK 4131 s IP protocol filter is a policy based filter that can allow or filter out IP based packets with specified IP protocol and source destination IP addresses The AWK 4131 provides 8 entities for setting IP protocol and source destination IP addresses in your filtering policy Four IP protocols are available All ICMP TCP and UDP You must specify either the Source IP or the Destination IP By combining IP addresses a
72. method WPA is a security standard based on 802 11i draft 3 while WPA2 is based on the fully ratified version of 802 11i 3 11 AWK 4131 Web Console Configuration A The initial vector is transmitted encrypted and enhanced with its 48 bits twice as long as WEP The key is regularly changed so that true session is secured Even though AES encryption is only included in the WPA2 standard it is widely available in the WPA security mode of some wireless APs and clients as well The AWK 4131 also supports AES algorithms in WPA and WPA2 for better compatibility Personal versions of WPA WPA2 also know as WPA WPA PSK Pre Shared Key provide a simple way of encrypting a wireless connection for high confidentiality A Passphrase is used as a basis for encryption methods or cipher types in a WLAN connection The passphrases should be complicated and as long as possible There must be at least 8 ASCII characters in the Passphrase and it could go up to 63 For security reasons this passphrase should only be disclosed to users who need it and it should be changed regularly WLAN Security Settings Security mode WPA WPA type Personal r Encryption method Passphrase Key renewal 60 86400 second WPA type Setting Description Factory Default Provides Pre Shared Key enabled WPA and WPA2 Provides enterprise level security for WPA and WPA2 Encryption method TKI P Temporal Key Integrity Protocol is enabled TKIP
73. mitter must not be co located or operated in conjunction with any other antenna or transmitter FCC Radiation Exposure Statement This equipment complies with FCC radiation exposure limits set forth for an uncontrolled environment This equipment should be installed and operated with a minimum distance of 20 cm between the radiator amp your body This device complies with Part 15 of the FCC Rules Operation is subject to the following two conditions 1 This device may not cause harmful interference and 2 this device must accept any interference received including interference that may cause undesired operation FCC 15 407 e Within the 5 15 5 25 GHz band U NII devices are restricted to indoor operations to reduce any potentially harmful interference to co channel MSS operations The availability of some specific channels and or operational frequency bands are country dependent and are firmware programmed at the factory to match the intended destination The firmware setting is not accessible by the end user R amp TTE Compliance Statement Moxa declares that the apparatus AWK 4131 complies with the essential requirements and other relevant provisions of Directive 1999 5 EC This equipment complies with all the requirements of DIRECTIVE 1999 5 CE OF THE EUROPEAN PARLIAMENT AND THE COUNCIL OF 9 March 1999 on radio equipment and telecommunication terminal equipment and the mutual recognition of their conformity R amp TTE The R a
74. mp TTE Directive repeals and replaces in the directive 98 13 EEC Telecommunications Terminal Equipment and Satellite Earth Station Equipment as of April 8 2000 Safety This equipment is designed with the utmost care for the safety of those who install and use it However special attention must be paid to the dangers of electric shock and static electricity when working with electrical equipment All guidelines of this and of the computer manufacturer must therefore be allowed at all times to ensure the safe use of the equipment EU Countries Intended for Use The ETSI version of this device is intended for home and office use in Austria Belgium Denmark Finland France with Frequency channel restrictions Germany Greece Ireland Italy Luxembourg Portugal Spain Sweden The Netherlands and United Kingdom The ETSI version of this device is also authorized for use in EFTA member states Norway and Switzerland 7 3 AWK 4131 EU Countries Not I ntended for Use None Potential Restrictive Use France only channels 10 11 12 and 13 Firmware Recovery When the LEDs of FAULT Signal Strength CLIENT BRIDGE and WLAN all light up simultaneously and blink at one second interval it means the system booting has failed It may result from some wrong operation Supporting Information or uncontrollable issues such as an unexpected shutdown during firmware update The AWK 4131 is designed to help administrators recover such d
75. nal File Transfer Capturing COM Options Terminal Type Parts Baud Rate Dumb Terminal Option Data Bits Transmit Parity T Local Echo Stop Bits Send Enter Ley As Flow Control Hutrut State Recelve P RTS CTS DTA ON OFF CR Translation M ON OFF ATS ON Col LF Translation 5 2 AWK 4131 Other Console Configurations 4 The Console login screen will appear Log into the RS 232 console with the login name default admin and password default root if no new password is set En FComm Terminal Emulator COM8 115200 None 8 1 AN5I Profile Edit PortManager Window Help 4 GIA ellae Slap En COM8 115200 None 8 1 AN51 WH 4131 U5 TR WE 4131_0357 login admin RTS Password 5 The AWK 4131 s device information and Main Menu will be displayed Please follow the description on screen and select the administration option you wish to perform 1 PComm Terminal Emulator COMS 115200 None 8 1 AN51 Profile Edit PortManager Window Help 4 ala alale 5 28 EY COMS 115200 Hone 3 1 AHSI AWK 4131 U5 LAN MAC Address O0O 390 E5 22 B6 0C4 Serial Ho 357 Firmware Version 1 0 Build 11041314 11 System Info Settings 2 Metwork Settings 31 Time Settings 4 Maintenance 51 Pestart q1 Quit ey in your selection nn i CTs DSR RI cep Peady NOTE To modify the appearance of the PComm Terminal Emulator window select Edit gt Font and then
76. nd Enterprise IEEE 802 1X RADIUS TKIP and AES Transmission Rates 802 11b 1 2 5 5 11 Mbps 802 11a g 6 9 12 18 24 36 48 54 Mbps 802 11n 6 5 to 300 Mbps multiple rates supported TX Transmit Power 802 11b 1 to 11 Mbps Typ 18 dBm 1 5 dBm 802 119 6 to 24 Mbps Typ 18 dBm 1 5 dBm 36 to 48 Mbps Typ 17 dBm 1 5 dBm 54 Mbps Typ 15 dBm 1 5 dBm 802 11a 6 to 24 Mbps Typ 17 dBm 1 5 dBm 36 to 48 Mbps Typ 16 dBm 1 5 dBm 54 Mbps Typ 14 dBm 1 5 dBm 1 3 AWK 4131 Introduction TX Transmit Power MI MO 802 11a n 20 40 MHz MCS15 20 MHz Typ 13 dBm 1 5 dBm MCS15 40 MHz Typ 12 dBm 1 5 dBm 802 11g n 20 40 MHz MCS15 20 MHz Typ 14 dBm 1 5 dBm MCS15 40 MHz Typ 13 dBm 1 5 dBm RX Sensitivity 802 11b 92 dBm 1 Mbps 90 dBm 2 Mbps 88 dBm 5 5 Mbps 84 dBm 11 Mbps 802 119 87 dBm 6 Mbps 86 dBm 9 Mbps 85 dBm 12 Mbps 82 dBm 18 Mbps 80 dBm 24 Mbps 76 dBm 36 Mbps 72 dBm 48 Mbps 70 dBm 54 Mbps 802 11a 87 dBm 6 Mbps 86 dBm 9 Mbps 85 dBm 12 Mbps 82 dBm 18 Mbps 80 dBm 24 Mbps 76 dBm 36 Mbps 72 dBm 48 Mbps 70 dBm 54 Mbps RX Sensitivity MI MO 802 11a n 68 dBm MCS15 40 MHz 70 dBm MCS7 40 MHz 69 dBm MCS15 20 MHz 71 dBm MCS7 20 MHz 802 11g n 68 dBm MCS15 40 MHz 70 dBm MCS7 40 MHz 69 dBm MCS15 20 MHz 71 dBm MCS7 20 MHz Protocol Support Genera
77. nd netmasks you can specify a single IP address or a range of IP addresses to accept or drop For example IP address 192 168 1 1 and netmask 255 255 255 255 refers to the sole IP address 192 168 1 1 IP address 192 168 1 1 and netmask 255 255 255 0 refers to the range of IP addresses from 192 168 1 1 to 192 168 255 Remember to check the Active check box for each entity to activate the setting IP Protocol Filters Enable Disable Policy Drop No active Protocol Source IP Source netmask Destination IP Destination netmask Aa A 2 Ala a To 3 la at JT S S 3 24 AWK 4131 Web Console Configuration Enable Enables IP protocol filter Disable Disables IP protocol filter Policy Only the packets fitting the entities on the list can be allowed Drop Any packet fitting the entities on the list will be denied ATTENTION Be careful when you enable the filter function Drop no entity on list is activated all packets are allowed Accept no entity on list is activated all packets are denied TCP UDP Port Filter The AWK 4131 s TCP UDP port filter is a policy based filter that can allow or filter out TCP UDP based packets with a specified source or destination port The AWK 4131 provides 8 entities for setting the range of source destination ports of a specific protocol In addition to selecting TCP or UDP protocol you can set either the source port destination port or both The end
78. ng AWK Search Utility gt Configuring AWK Search Utility AWK 4131 Software I nstallation Configuration Overview The Documentation amp Software CD included with your AWK 4131 is designed to make the installation and configuration procedure easy and straightforward This auto run CD includes AWK Search Utility to broadcast search for all AWK s accessible over the network the AWK 4131 User s Manual and Quick Installation Guide AWK Search Utility Installing AWK Search Utility Click the INSTALL UTILITY button in the AWK Installation CD auto run window to install AWK Search Utility Once the program starts running click Yes to proceed 1 Click Next when the Welcome screen opens to proceed with the installation 5 Setup AWE Search Utility Welcome to the AWK Search Utility Setup Wizard This will install AWE Search Utility on your computer Ik is recommended that you close all other applications before continuing Click Next to continue or Cancel to exit Setup ie Setup AWE Search Utility Select Destination Location Where should AWE Search Utility be installed O Setup will install 44K Search Utility into the following folder To continue click Next IF you would like to select a different folder click Browse C Program Files Mona AWK AWk Search Utility Atleast 2 5 MB of free disk space is required 4 2 AWK 4131 Software I nstallation Configuration 3 Click Next to
79. ng a firmware upgrade make sure the AWK 4131 is off line Click the Browse button to specify the firmware image file and click Firmware Upgrade and Restart to start the firmware upgrade After the progress bar reaches 100 the AWK 4131 will reboot itself When upgrading your firmware the AWK 4131 s other functions are forbidden Firmware Upgrade Select update image Browse Firmware Upgrade and Restart ATTENTION Please make sure the power source is stable when you upgrade your firmware An unexpected power breakup may damage your AWK 4131 Config mport Export You can back up or restore the AWK 4131 s configuration with Config Import Export In the Config Import section click Browse to specify the configuration file and click Config Import button to begin importing the configuration Config Export Seng Export You can also back up or restore the ABC 01 HW Rev 1 1 support only configuration with Config Import Export ABC 01 Import Config Import 3 38 AWK 4131 Web Console Configuration ABC 01 Export Contig Esport To download the configuration to the AWK Turn off the AWK Plug in the ABC 01 to the AWK s RS 232 console Turn on AWK AWK will detect ABC 01 during bootup and download the configuration from the ABC 01 to the AWK automatically Once the configuration downloads and if configuration format is correct the AWK will emit W A three short beeps then continue the boot up 5
80. oll free 1 888 669 2872 Tel 1 714 528 6777 Fax 1 714 528 6778 Moxa Europe Tel 49 89 3 70 03 99 0 Fax 49 89 3 70 03 99 99 www moxa com su ort Moxa China Shanghai office Toll free 800 820 5036 Tel 86 21 5258 9955 Fax 86 21 5258 5505 Moxa Asia Pacific Tel 886 2 8919 1230 Fax 886 2 8919 1231 Table of Contents 1 THLFOOUCEIOTIriiriiocdiciiieriitcbioriicriieeticeCitetiueCeekSeeCetxttseeset lvkeeesetlessdustbevsgs bsa589 285 03230a0 0803s8220 0458949821u 94 1 1 OVER ggg AAaa 1 2 Package Enel cra ed 1 2 Product PCAUUIGS tii a A E E 1 2 PO UCSI oo EAA 1 3 Funcional DESIOM data tad ata 108614 0444140904414 rada dada daniela lada 1 5 PA A go 15606 S606 n h n h n N 6000 1 5 Recommended SFP ACCCSSOM CS e1 octal balas 1 5 PGE Gea OL Se eta stearate O e 1 6 A ee er ee nn err ner 1 7 PSS SB CO a II CC IT AO IA ae tet els te a i hd i a a e dee did 1 7 Bele yan DIJOU 515146200600 k c i A O 1 7 communication GCONAMECUONS ra sos sa sasasectidsavga9905954509050185 3010150101x0x10x9xiisxsxx e teogss 9066906094606 0963001809059 1 8 Ethemet a 1 9 Za Getting SOI LC 7 2 3 1412211st anirssnriassinnzsaasszs7fsxs s8iZs7sssxsslsxssssssnxxxYKVVHRYRRYVRVEYRREWWEVAYREYKMEWWEYEEWEWEYSYRWRWSNARERENR 2 1 First time tnstallatiomand UA 6x 8E0essgfestelteniefieseg 4 nisg as55 05 0826 05 0528 0206 0009 0041105 0g vn s 2 2 Communication Testa aaa ice ta dada sa u 0u da da sa o gu dada duy n dd
81. on with a pointed object such as an unfolded paper clip e System reboot Hold the RESET button down for under 5 seconds and then release e Reset to factory default Hold the RESET button down for over 5 seconds until the STATE LED starts blinking green Release the button to reset the AWK 4131 STEP 1 Remove the reset button cover STEP 2 Using a pointed object press and hold the reset button yi Relay Digital Output The AWK 4131 has one relay output which consists of the 2 contacts for the 8 pin M12 connector on the bottom panel as shown below These relay contacts forward system failure and user configured events The two wires attached to the relay contacts form an open circuit when a user configured event is triggered If a user configured event does not occur the relay circuit will remain closed For safety reason the relay circuit is kept open when the AWK 4131 is not powered The AWK 4131 s relay status is summarized as follows 1 7 AWK 4131 Introduction Power Status Event relay epee Dein Sig 5 Cert 40N oSo 1 Na ae 8 8 DI1 11 a on coma EE 7 EE Plug Connector DI2 COM 2 Reserved Communication Connections Connecting the Data Lines 10 100 1000BaseT X Ethernet Port Connection The AWK 4131 has 10 100 1000BaseT X Ethernet ports 8 pin shielded M12 connector with A coding The 10 100 1000BaseT X ports located on the AWK 4131 s bottom panel are
82. peratures ranging from 40 to 75 C and dust tight weatherproof P68 rated design the AWK 4131 allows you to extend existing wired networks to outdoor locations The AWK 4131 can operate on either the 2 4 or 5 GHz bands and is backward compatible with the existing 802 11a b g deployments which makes your wireless investments future proof Package Checklist Moxa s AWK 4131 is shipped with the following items If any of these items is missing or damaged please contact your customer service representative for assistance e AWK 4131 e Two omni directional antennas 5 2 dBi N type male 2 4 5 GHz e Wall mounting kit e Field installable power plug e Field installable RJ 45 plug e Metal cap to cover M12 female DI O connector e Metal cap to cover RJ45 connector e Documentation and software CD e Quick installation guide printed e Warranty card NOTE The above items come with the AWK 4131 standard version The package contents may vary in different customized versions Product Features e EEE802 11a b g n Compliant e Three in one design AP Bridge Client e Advanced Wireless Security gt 64 bit and 128 bit WEP WPA WPA2 gt SSID Hiding IEEE 802 1X RADIUS gt Packet access control amp filtering e STP RSTP support for redundancy of system networking e Long distance transmission support e Turbo Roaming enables rapid handover Client mode e ABC O1 for configuration import export e Customized antenna selection e R
83. quite small so you may need to use a magnifying glass to see the numbers clearly 2 The pin numbers for both 8 pin and 10 pin RJ 45 connectors and ports are typically not labeled on the connector or port Refer to the Pinout diagram above to see how RJ 45 pins are numbered 1 9 2 Getting Started In this chapter we explain how to install Moxa s AirWorks AWK 4131 for the first time and quickly set up your wireless network and test whether the connection is operating properly The Function Map discussed in the third section provides a convenient means of determining which functions you need to use The following topics are covered in this chapter O First time Installation and Configuration O Communication Testing gt How to Test One AWK 4131 gt How to Test Two or More AWK 4131 Units O Function Map AWK 4131 Getting Started First time Installation and Configuration Before installing the AWK 4131 make sure that all items in the Package Checklist are in the box You will need access to a notebook computer or PC equipped with an Ethernet port The AWK 4131 has a default IP address that must be used when connecting to the device for the first time e Step 1 Select the power source The AWK 4131 can be powered by a DC power input or PoE Power over Ethernet The AWK 4131 will use whichever power source you choose e Step 2 Connect the AWK 4131 to a notebook or PC Since the AWK 4131 supports MDI MDI X auto sensing you
84. r mode only Data Beacon Rate Indicates how often the AWK 4131 sends out a Delivery Traffic 1 1 to 15 Indication Message Fragmentation threshold Setting Description Faactory Default Fragment Length Specifies the maximum size a data packet before splitting and 2346 AWK 4131 Web Console Configuration 256 to 2346 creating another new packet RTS threshold RTS CTS Threshold Determines how large a packet can be before the Access Point 2346 256 to 2346 coordinates transmission and reception to ensure efficient communication NOTE You can refer to the related glossaries in Chapter 5 for detailed information about the above mentioned settings By setting these parameters properly you can better tune the performance of your wireless network Transmission distance Distance or max range Specifies the transmission distance or max range between two 500 for transmission AWK devices This parameter should be set properly especially 500 to 11000 m for long distance communication Noise protection Enable Disable Adjusts the interference coping capability of the wireless signal Enable This option should be enabled for communication distance under 500 meters and should be disabled for communication distances over 500 meters Transmission enhancement Enable Disable This setting can enhance communication by strengthening the Disable AWK 4131 s transmission power It is quite useful for long dist
85. ration Please run Maintenance gt Console Settings to disable them as shown in the following figure Console Settings HTTP console C Enable Disable HTTPS console Enable Disable Telnet console C Enable Disable SSH console Enable Disable Submit 5 5 6 References This chapter provides more detailed information about wireless related technologies The information in this chapter can help you administer your AWK 4131s and plan your industrial wireless network better The following topics are covered in this chapter O O O O O O Wireless Distribution System WDS Beacon DTI M Fragment RTS Threshold STP and RSTP gt The STP RSTP Concept gt Differences between RSTP and STP AWK 4131 References Wireless Distribution System WDS Traditionally APs are connected via Ethernet LAN ports By using a Wireless Distribution System WDS APs can communicate with one another wirelessly For example AP 2 acts as an access point for the notebook computers or other EEE802 11 enabled clients and forwards packets sent from the notebook computers to AP 1 through WDS Then AP 1 forwards the packets to the Ethernet LAN Packets destined for the notebook computers follow a reverse path from the Ethernet LAN through the APs to the notebook computers In this way AP 2 acts as an AP repeater Notebook Computer IEEE 802 11 enabled Client By using WDS two or more LAN segments can be connecte
86. rences between RSP and SUP T c ng a A ot 6 4 Ty SUDDORUINO Ito Mao 7 1 1 70711215001272 a E R 7 1 ADOUE This Users GHI escindida UE 101 b E 43044 230 x t 7 2 BOC ADeclara tion CORA A a tect a 0000 00 77 031017117 7 2 Federal Communication Commission Interference Statement nen 7 2 RGoh TE Compliance State Men neman re gees eet os A A OS 7 3 FUT IVAN AN E E 7 4 LOCH AI Cal SUDO ORE Contacte Into FUEL OU arica INIA 7 5 1 Introduction Moxa s AirWorks AWK 4131 enables wireless access to network resources The AWK 4131 is rated to operate at temperatures ranging from 40 to 75 C and is rugged enough for any harsh industrial environment The following topics are covered in this chapter O Overview Package Checklist Product Features Product Specifications n n Functional Design LAN Port Recommended SFP Accessories LED Indicators Beeper Reset Button Relay Digital Output Communication Connections Ethernet M12 Plug V Y VV VV V Y AWK 4131 Introduction Overview Moxa s new AWK 4131 3 in 1 industrial wireless AP bridge client meets the growing need for faster data transmission speed and wider coverage by supporting IEEE 802 11n technology with a net data rate of up to 300 Mbps The AWK 4131 combines two adjacent 20 MHz channels into a single 40 MHz channel to deliver a potent combination of greater reliability and larger bandwidth With wide operating tem
87. s gt WLAN Certificate Settings to import your WLAN certificate and enable EAP TLS on the client end WLAN Security Settings Security mode wPaz WPA type Enterprise Encryption method TKIP r EAP Protocol TLS Certificate issued to Certificate issued by Certificate expiration date You can check the current certificate status in Current Status if it is available e Certificate issued to Shows the certificate user e Certificate issued by Shows the certificate issuer e Certificate expiration date Indicates when the certificate has expired 3 14 AWK 4131 Web Console Configuration EAP TTLS It is usually much easier to re use existing authentication systems such as a Windows domain or Active Directory LDAP directory or Kerberos realm rather than creating a parallel authentication system As a result TTLS Tunneled TLS and PEAP Protected EAP are used to support the use of so called legacy authentication methods TTLS and PEAP work in a similar way First they establish a TLS tunnel EAP TLS for example and validate whether the network is trustworthy with digital certificates on the authentication server This step establishes a tunnel that protects the next step or inner authentication and consequently is sometimes referred to as outer authentication The TLS tunnel is then used to encrypt an older authentication protocol that authenticates the user for the network As you can see digital certi
88. s a client the AWK 4131 can support three EAP methods or EAP protocols EAP TLS EAP TTLS and EAP PEAP corresponding to WPA WPA Enterprise settings on the AP side WLAN Security Settings Security mode WRAP WPA type Enterprise Encryption method TKIP EAP Protocol Encryption method TKI P Temporal Key Integrity Protocol is enabled TKIP Advance Encryption System is enabled This option is only available with 802 11a b g standard EAP Protocol Te peee Tanseer layer seana pona ooo Specifies Transport Layer Security protocol TLS TLS SpecifiesTunneled Transport Layer Security Tunneled Transport Layer Security PEAP Specifies Protected Extensible Authentication Protocol or Protected EAP Before choosing the EAP protocol for your WPA WPA2 Enterpise settings on the client end please contact the network administrator to make sure the system supports the protocol on the AP end Detailed information on these three popular EAP protocols is presented in the following sections EAP TLS TLS is the standards based successor to Secure Socket Layer SSL It can establish a trusted communication channel over a distrusted network TLS provides mutual authentication through certificate exchange EAP TLS is also secure to use You are required to submit a digital certificate to the authentication server for validation but the authentication server must also supply a certificate You can use Basic Wireless Setting
89. shown if a certificate is not available Certificate issued to Shows the certificate user Certificate issued by Shows the certificate issuer Certificate expiration date Indicates when the certificate has expired You can import a new WLAN certificate in Import WLAN Certificate by following these steps in order 1 Input the corresponding password or key in the Certificate private password field and then click Submit to set the password 3 1 Ce AWK 4131 Web Console Configuration 2 The password will be displayed in the Certificate private password field Click on the Browse button in Select certificate key file and select the certificate file 3 Click Upload Certificate File to import the certificate file If the import succeeds you can see the information uploaded in Current Certificate If it fails you may need to return to step 1 to set the password correctly and then import the certificate file again Step 1 Certificate private password Submit Step 2 Select certificate key file Browse Upload Certificate File NOTE The WLAN certificate will remain after the AWK 4131 reboots Even though it is expired it can still be seen on the Current Certificate Advanced Settings Several advanced functions are available to increase the functionality of your AWK 4131 and wireless network system A VLAN is a collection of clients and hosts grouped together as if they were connected to the broadcast do
90. tandard RSTP provides the following benefits The topology of a bridged network will be determined much more quickly compared to STP RSTP is backward compatible with STP making it relatively easy to deploy For example Defaults to sending 802 1D style BPDUs if packets with this format are received STP 802 1D and RSTP 802 1w can operate on the LAN ports and WLAN ports AP and WDS1 WDS8 of the same AWK 4131 This feature is particularly helpful when the AWK 4131 connects to older equipment such as legacy switches Differences between RSTP and STP RSTP is similar to STP but includes additional information in the BPDUs that allow each bridge to confirm that it has taken action to prevent loops from forming when it decides to enable a link to a neighboring bridge Adjacent bridges connected via point to point links will be able to enable a link without waiting to ensure that all other bridges in the network have had time to react to the change The main benefit of RSTP is that the configuration decision is made locally rather than network wide allowing RSTP to carry out automatic configuration and restore a link faster than STP 6 4 7 Supporting Information This chapter presents additional information about this manual and product You can also learn how to contact Moxa for technical support The following topics are covered in this chapter O About This User s Manual O DoC Declaration of Conformity gt Federal Communi
91. tion Status Wireless Status The status for 802 11 info parameters such as Operation mode and Channel are shown on the Wireless Status page The status will refresh every 5 seconds if the Auto refresh box is checked Certain values for 802 11 info may not show up due to different operation modes As aresult Current BSSID and Signal strength are not available in AP mode It is helpful to use the continuously updated information on this page such as Signal strength to monitor the Signal strength of the AWK 4131 in Client mode 3 34 AWK 4131 Web Console Configuration Wireless Status Auto refresh Show status of WLAN SSID MOXA 802 11 Info Operation mode AP Channel 6 RF type B G N Mixed SSID MOXA MAC 06 90 E8 22 B0 CA Security mode OPEN Current BSSID 06 90 E8 22 B6 CA Signal strength N A Transmission rate Auto Transmission power Full Associated Client List for AP Master mode only Associated Client List shows all the clients that are currently associated to a particular AWK 4131 You can click Select all to select all the content in the list for further editing You can click Refresh to refresh the list Associated Client List 1 lt 00 13 ce el ee ef gt Select all Refresh DHCP Client List for AP mode only The DHCP Client List shows all the clients that require and have successfully received IP assignments You can click the Refresh button to refresh the list DHCP Client L
92. unique identifier that wireless networking devices use to establish and maintain wireless connectivity Multiple access points on a network or sub network can use the same SSIDs You can configure your AWK to use up to 9 SSIDs and configure each SSID differently All of the SSIDs are active at the same time that is client devices can use any of the SSIDs to associate with the access point Basic Wireless Settings Operation mode AP RF type B G N Mixed e Channel Channel width 20 MHz Channel bonding 10 SSID MOXA SSID broadcast Enable Disable Click on Add SSID to create more SSIDs Click on Edit to assign different configuration settings to each SSID The configuration panel appears as follows Basic Wireless Settings Operation mode AP RF type Channel SSID SSID broadcast Enable Disable AWK 4131 Web Console Configuration NOTE When you switch to Client mode a Site Survey button will be available on the Basic Wireless Settings panel Click the Site Survey button to view information about available APs as shown in the following figure You can click on the SSID of an entity and bring the value of its SSID onto the SSID field of the Basic Wireless Settings page Click the Refresh button to re scan and update the table Basic Wireless Settings Operation mode Chent Channel Channel width Channel bonding 10 SSID MOXA SSID broadcast Enable Disable S http 192 168 127 253 Site Survey
93. ve None problems Use this space to record contact information of the person responsible for maintaining this AWK 4131 Network Settings The Network Settings configuration panel allows you to modify the usual TCP IP network parameters An explanation of each configuration item is given below Network Settings Boles 27 233 IP address Star Suhnet mask Gateway Primary DNS server Secondary ONS server IP configuration IP configuration DHCP The AWK 4131 s IP address will be assigned automatically by Static the network s DHCP server Set up the AWK 4131 s IP address manually IP address AWK 4131 s IP Identifies the AWK 4131 on a TCP IP network 192 168 127 253 address Subnet mask AWK 4131 s subnet Identifies the type of network to which the AWK 4131 is 255 255 255 0 mask connected e g 255 255 0 0 for a Class B network or 255 255 255 0 for a Class C network Gateway AWK 4131 s default The IP address of the router that connects the LAN to an outside None gateway network Primary Secondary DNS server IP address of the The IP address of the DNS Server used by your network After None Primary Secondary entering the DNS Server s IP address you can input the DNS server AWK 4131 s URL e g http ap11 abc com in your browser s address field instead of entering the IP address The Secondary DNS server will be used if the Primary DNS server fails to connect 3
94. vents x Power events x DI events System related events Event is triggered when System restart warm start The AWK 4131 is rebooted such as when its settings are changed IP address subnet mask etc Network related events Event is triggered when LAN link on The LAN port is connected to a device or network LAN link off The port is disconnected e g the cable is pulled out or the l opposing device shuts down Client joined left A wireless client is associated or disassociated AP 73716 7esez0mmmH WLAN connected to AP The AWK 4131 is associated with an AP le cievasemal ee WLAN disconnected The AWK 4131 is disassociated from an AP PP SH UnnmO Configuration Changed A configuration item has been changed Configuration file import via Web Console The configuration file is imported to the AWK 4131 Console authentication failure An incorrect password is entered Firmware upgraded The AWK 4131 s firmware is updated Power 1 2 transition On gt Off The AWK 4131 is powered down in PWR1 2 PoE transition On gt Off The AWK 4131 is powered down in PoE Dr events Eventis triggered when lt Digital Input 1 2 is triggered by on to off transition Event is triggered when On Power 1 2 transition Off gt On The AWK 4131 is powered via PWR1 2 Syslog This function provides the event logs for the Syslog server The function supports up to three configurable Syslog servers
95. vice agent could notify the management station by sending a message known as a trap for the event Trap Event Types Trap Event Types Event Cold start Warm start Power 1 transition On gt 0ff Power 1 transition Off gt On Power 2 transition On gt 0ff Power 2 transition Off gt On PoE transition On gt Off PoE transition Off gt On Contiguration changed Console authentication failure DI 1 transition On gt Off DI 1 transition Off gt On DI 2 transition On gt Off DI 2 transition Off gt 0n LAN link on LAN link off L Active ki nh log fig Mode fp fig fp 3 33 AWK 4131 Web Console Configuration SNMP Trap Receiver Settings SNMP traps are defined in SMIv1 MIBs SNMPv1 and SMIv2 MIBs SNMPv2c The two styles are basically equivalent and it is possible to convert between the two You can set the parameters for SNMP trap receivers through the web page SNMP Trap Receiver Settings ist Trap version ist Trap server IP name ist Trap community 2nd Trap version 2nd Trap server IP name 2nd Trap community alert 1st 2nd Trap version SNMP trap defined in SNMPv1 V1 SNMP trap defined in SNMPv2 lst 2nd Trap server IP name IP address or host Enter the IP address or name of the trap server used by your None name network lst 2nd Trap community Max of 31 characters Use a community string match with a maximum of 31 alert characters for authentica
96. wing paragraphs we describe each AWK 4131 management function in detail A quick overview is available in this manual in the Function Map section of Chapter 2 NOTE The model name of the AWK 4131 is shown as AWK 4131 XX where XX indicates the country code The country code indicates the AWK 4131 version and which bandwidth it uses We use AWK 4131 US as an example in the following figures The country code and model name that appears on your computer screen may be different than the one shown here Overview The Overview page summarizes the AWK 4131 s current status The information is categorized into several groups System info Device info and 802 11 info Overview All information on this page are active values System Info Model name Device name Serial No System up time Firmware version Device Info Device MAC address IP address Subnet mask Gateway 802 11 Info Country code Operation mode Channel RF type SSID AWK 4131 U5 AWK 4131_035 3937 O days 00h 05m 53s 1 0 Build 11041314 00 90 E8 22 BG CA 192 168 127 253 299 299 299 0 US AP 6 B G N Mixed MOXA 3 3 AWK 4131 Web Console Configuration Click on SSID for more detailed 802 11 information as shown in the following figure Wireless Status Auto refresh Show status of WLAN SSID MOXA 302 11 Info Operation mode AF Channel 6 RF type BiG Mixed SSID M2 MAC 06 90 E8 01 09 00 Security mode OPEN Current BSSID 06 90 E8 01
97. y Port Cost Edge Port Status Maintenance Maintenance functions provide the administrator with tools to manage the AWK 4131 and wired wireless networks Console Settings You can enable or disable access permission for the following consoles HTTP HTTPS Telnet and SSH connections For more security we recommend you only allow access to the two secured consoles HTTPS and SSH Console Settings HTTP console HTTPS console Telnet console SSH console Enable Enable Enable Enable Disable Disable Disable C Disable Submit Ping helps to diagnose the integrity of wired or wireless networks By inputting a node s IP address in the Destination field you can use the ping command to make sure it exists and whether or not the access path is available Ping Destination 192 168 253 2 If the node and access path are available you will see that all packets were successfully transmitted with no loss Otherwise some or even all packets may get lost as shown in the following figure 3 37 AWK 4131 Web Console Configuration Ping Destination Ping PING 192 168 127 2 192 168 127 2 56 data bytes 192 168 127 2 ping statistics 4 packets transmitted 0 packets received 100 packet loss Firmware Upgrade The AWK 4131 can be enhanced with more value added functions by installing firmware upgrades The latest firmware is available at Moxa s download center Before runni

AWK-4131 User`s Manual

Contents

Download Pdf Manuals

Related Search

Related Contents