Home

GV-Control Center

1. Device 5 Device 5 Device 6 Device 6 Device Device NM WR WM Device 8 NNN MR SR Device 8 Refresh Keyboard amp Joystick Keyboard amp Joystick Figure B 1 V1 or V3 Figure B 2 V2 2 Inthe Device field select the COM port connected to the GV Joystick V1 or GV Keyboard V3 3 Inthe Device field select GeoVision Joystick connected to the GV Joystick V2 4 Click the Start Service button Figure B 1 and then you can use the GV Joystick or GV Keyboard to control the PTZ camera 5 If more than one GV Joystick or GV Keyboard is connected repeat Step 2 to set up and use another GV Joystick or GV Keyboard 184 Appendix Appendix C RTSP Streaming The Control Center supports IP video devices using RTSP standard To connect the IP device compatible with RTSP standard 1 Select Protocol from the Brand drop down list Host Settings Host Name Host 1 Address 192 168 1 21 Remember Account ID GY Password HTTP Port 80 Default Configure Device Information Number of Cameras Update Information Number of Modules Module 1 Number of Inputs Number of Outputs Figure C 1 2 Select one of the following options from the Model drop down list E GV_HTTP_SDK_RTSP This option is for GeoVision SDK users The RTSP protocol uses a HTTP port for video streaming from the IP camera E
2. Text overlay s POS GV Wiegand Overlays POS or GV Wiegand Capture data onto the video Fisheye Select Geo Fisheye to choose a camera mode select Panomorph to enable a 360 view of a third party fisheye camera Mega Pixel View Enable PIP or PAP view See 3 2 PIP and PAP View Wide Angle Lens Dewarping Corrects image distortion See 3 1 4 Adjusting Distorted Views Display GPS Shows the camera s position on the video Select GPS Map Selects a map type for GPS display Full Screen Switches to the full screen view Snapshot Saves a video image Save as AVI Saves a video as avi format Download Downloads the video clip from the DVR or IP video device to the local computer Note The Defog and Stabilizer only work when the functions have been applied on the recording from the DVR 50 e Playback MPEG4 Player Files saved on GV NAS Systems are played back by the MPEG4 player Remote Playback x b Camera 1 y Video Events a 13 33 17 13 38 17 13 43 17 13 48 17 13 53 17 13 58 17 14 03 17 14 08 18 14 13 18 14 18 18 14 23 19 e 14 28 19 Genwrnwo 7114 33 20 y Figure 5 2 51 C GeoVision 5 2 Remote Playback The Remote ViewLog service allows the Control Center to access the event files of different hosts and play them back with ViewLog player 5 2 1 Running the Remote ViewLog 1 For DVR hosts GV System GV VMS their Remote ViewLog Ser
3. A On GV Control Center s main window select System and select Configure The System Configure window appears B Click the Auth Center tab select Use Remote Authentication Account type the Authentication Center s IP address and only modify the port setting if necessary i System Configure VMD Syston video Wal AthCerter User Login Local Use Remote Authentication Account IP Address 192 168 5 23 Fort 1545 Default E Auto Login ID Password Figure 9 38 C To automatically log in using a specific account select Auto Login and type the ID and password of an established account on Authentication Center D Click OK Re launch GV Control Center for this setup to be effective 162 FJ Other Applications 2 Tolog in through the Authentication Center make sure you have activated the Authentication Center see step 5 in 9 4 3 Setting Up the Authentication Center and follow the steps below A Launch the GV Control Center This dialog box appears AuthCenter Login Address Port ID Password Figure 9 39 B Type the Authentication Center s IP address port setting and the ID and password of an established account at the Authentication Center see step 2 in 9 4 3 Setting Up the Authentication Center AuthCenter Login Address Port 197 168 5 23 ID Password admin Figure 9 40 C Click OK GV Control Center is logged in immediately Note To log in locally to
4. GvNVR C GV 1480 MultilingualConfig C Program Files x86 MultilingualConfig MultiView C Program Files DMMultiview OCX C Windows GeoOCx Remote ViewLog C Windows Geovision Remote Viewlog 20111017 Figure 9 16 143 3 The message Do you want to apply the revised multilingual texts to another folder appears If the storage path for the application has been changed or if the associated application is not listed in the dialog box click Yes and select the folder of the application To export or send the revised text 1 To export the revision as an executable file click Tools Export and Export executable file You can copy the exe file to another computer and apply the same translation revision by running the exe file 2 To report the translation revision back to GeoVision e If your default mail client is Outlook Outlook Express or Mozilla Thunderbird click Tools Export and Send Report to send the revision e lf your default mail client is not set up or supported click Tools Export and Export text file and email the exported text file to gvlocalize geovision com tw 144 FJ Other Applications 9 3 Batch Functions The batch functions are integrated interfaces designed for management of mass number of GV IP Devices without the need to configure each device from its Web interface On these interfaces you can change assign IP address rename devices assign NAS and view storage s
5. ITEM WOI Coke Orange Joice Figure 8 12 For details on POS Live View see POS Live View Chapter 7 GV DVR User s Manual on the Software DVD 90 8 Multi Monitors Applications 8 2 9 Advanced Settings On the Matrix window click the Configure button No 5 Figure 8 5 System Configure System Configure Caption Camera Scan M Location Auto scan at startup Directs Enable DirectDraw w Camera Name FTZ Control Wig PTZ Panel Keep last frame when video lost or connection lost O PTZ Automation Keep Ser Figure 8 13 Caption Displays the ID Location or Camera Name stamp on screen Camera Scan Sets the rotation interval between cameras Click the Arrow button to set rotation mode of 1 4 6 9 16 or 24 channels You can also enable the automatic scan function at the Matrix startup DirectX Sets the DirectDraw function PTZ Control Select one type of PTZ control panel For details on PTZ Automation see PTZ Automation Chapter 1 GV DVR User s Manual on the Software DVD View If your video sources or connections tend to be interrupted or if you want to prevent the operator from Knowing about a broken connection select this option and set the duration for the last frame to remain on the screen when connections are lost Camera Configure Adjusts the properties and recording settings of cameras Video Attributes Adjusts video attributes of cameras Image Quality
6. Only for GV IP Devices Panorama View Channel Matrix Specifications Amount Unlimited Unlimited Unlimited 8 1 to 200 license Unlimited 500 hosts unlimited Single view Window 1 window Multiple view Window 36 divisions 8 views unlimited 768 CH in total 1 group 1200 CH 4 views 64 CH per view 1024 x 768 64 CH 1280 x 1024 64 CH 1680 x 1050 80 CH 1600 x 1200 64 CH 1920 x 1200 96 CH 1920 x 1080 96 CH 1280 x 800 48 CH 1440 x 900 48 CH Note Appendix One host supports up to 9 sets of 16 in and 16 out I O modules For 1920 x 1200 1920 x 1080 resolution DVR 1000 CH GV Video Server GV Compact DVR GV IP Camera 200 CH Total Total Total Total Total Total Total Total 512 CH on 8 Matrixes 512 CH on 8 Matrixes 640 CH on 8 Matrixes 512 CH on 8 Matrixes 768 CH on 8 Matrixes 768 CH on 8 Matrixes 384 CH on 8 Matrixes 384 CH on 8 Matrixes 187 Language Arabic Bulgarian Czech Danish Dutch English Finnish French German Greek Hebrew Hungarian Indonesian Italian Japanese Lithuanian Norwegian Persian Polish Portuguese Romanian Russian Serbian Simplified Chinese Slovakian Slovenian Spanish Sweden Thai Traditional Chinese Turkish Note The maximum number of hosts allowed depends on the performance of Control Center server Video Wall Server Feature Max No of Monitors Max No of Channels Scan Wind
7. When the option is disabled When multiple pop up alerts are triggered simultaneously the positions of pop up views on the VMD windows are based on the sequence order of motion or event detection When the first monitor is full of pop up views the next pop up view will go to the second monitor Example Both Monitor 1 and Monitor 2 are set at 4 screen divisions When 5 pop up alerts are triggered simultaneously the first 4 pop up views will appear on Monitor 1 and the last pop up view will appear on Monitor 2 When the option is enabled The positions of pop up views on the VMD windows are based on the camera sequence in the VMD Group Example In the VMD Group Camera A is listed as the third camera and Camera B is the fifth Both monitor 1 and monitor 2 are set at 4 screen divisions When the pop up alerts from the two cameras are triggered simultaneously Camera A images will appear on the third square of Monitor 1 and Camera B images will appear on the first square of Monitor 2 Note the order of pop up views is from left to right on the VMD window EJ Live video 3 4 5 Pop up Viewer on Another Monitor With the Pop up Viewer feature you can define the duration that a pop up view stays on another monitor The pop up view on the VMD window will be closed as soon as motion stops or an event is undetected When motion or an event is detected the camera view will pop up on the primary monitor and the assigned monitor together
8. e Advanced Live View Opens the live view window for further control See 3 7 Live View e Instant Playback See 5 7 nstant Playback 39 C GeoVision 3 4 3 Temperature Alarm You can set up a temperature alarm by specifying a critical temperature upon or beyond which the live view will pop up on the VMD window Note 1 The critical temperature here refers to the interior temperature of the device but not its operating temperature 2 This feature is only supported by GV System with GV 3008 Card and certain GV IP Cameras For the support list refer to the GV IPCAM H 264 User s Manual for detail 1 On the VMD window click the Show System Menu icon on the top right corner and select System Configure The System Configure dialog box appears 2 Type the critical temperature System Configure Directx Enable DirectDraw Monitoring Option Event Dwell Time Sec Motion detection 10 I O Detection 10 Temperature Alarm 60 Temperature Monitoring Critical Internal Temperature 40 aC 0 C 100 C Celsius C Fahrenheit F Figure 3 15 3 Right click the camera under the VMD Group select Video Analysis and select Temperature Alarm 4 The live view should pop up on the VMD window when the camera s temperature reaches or exceeds the specified critical temperature 40 EJ Live video 3 4 4 Dual Monitor Display You can set up two monitors to display the VMD windows for pop up displ
9. s main window and select the Network tab System Configure Network For Searching DVR TCP IP Port 2 1 Default Multicast Port 5200 Default For Searching IP Device Bind IP 192 168 5 235 Port 5202 Default E Assign IP Marvell Yukon 88E8001 8003 8010 PCI Gigabit Ethernet Controller Service Default Figure 9 43 This dialog box displays the related ports for DVR and IP devices To use the Search Host function No 3 Figure 9 32 it is required to open TCP port 5201 on the client DVR TCP port 5202 on the GV IP Devices and UDP port 5200 on the Control Center To connect GV Control Center to Authentication Center it is required to open port 1545 166 FJ Other Applications 9 4 6 Backup Settings Export Settings 1 From Authentication Center s main window click System and select Export Data This dialog box appears Option Host List Group List AuthCenter Setting Account Figure 9 44 2 Optionally click to unselect any item for settings export Click OK This dialog box appears Export Backup Data Hint Password Confirmation Figure 9 45 3 Type the username and password of the Authentication Center to proceed 167 Import Settings 1 From Authentication Center s main window click System and select Import Data This dialog box appears ow Desktop Organize New folder UY Favorites gg Libraries E De
10. 1 Each dongle has its own serial number Find it on the side of the dongle Later this serial number will be used in naming the files for upgrading SIC 7116442 GeoVision Figure A 1 2 Insert the dongle to the computer 182 Appendix In the GV folder double click GVUsbKeyUpClient exe This dialog box appears g GeoVision USB Key Upgrade Client USB Keys Information VSM 11081630 02328978 z HW Serial 11081630 Internal Serial OOOO8EE6 Softwares VSM Control Center identification Save Key ID Data Upgrade Upgrade Select All Select None Machine ID Exit Figure A 2 To retrieve the data from the dongle click Select All The information of the dongle is displayed in the information field Note the displayed number of HW Serial should be the same as that on the dongle To save the data to your local computer click Save Key ID Data If you have more than one dongle to upgrade click Batch Save Different dongle data will be saved as separate files The file will be named after the serial number on the dongle and saved as out For example if a dongle serial number is 7116442 the file is named NVR 7116442 out Send this data file to GeoVision at sales geovision com tw The GeoVision will examine the data file and send an in file back to you The file name also includes the serial number of that dongle In this example the data file you will receive i
11. 14 Source 15 Selected Source 32 Description Adds an image for automatic splicing Cancels the settings Manually splices the images together Makes the spliced images seamless Displays the setup procedure Changes image addition to the left or right option This function is only available with the Easy Mode Changes image addition to the top or bottom option This function is only available with the Easy Mode Sets the resolution of the panorama view Saves the created panorama view and closes the dialog box Closes the dialog box Displays the selected source image or the spliced images Splices more than two images of the same resolution together See Using Images of the Same Resolution in 3 3 1 Creating a Panorama View Selects the panorama set for the images to be spliced together Clicks again to rename the panorama set Selects the source image to be spliced Displays the selected image Live Video 3 3 1 Creating a Panorama View To connect camera views with overlapped areas follow the steps in Using Images with Overlapped Areas To connect camera views without overlapped areas and of the same resolution follow the steps in Using Images with the Same Resolution Using Images with Overlapped Areas 1 Select one panorama set No 13 Figure 3 9 from the drop down list If you want to rename the selected panorama set type the name in the field 2 Select one camera from the Source drop down list No 14
12. Adjusts the video quality with the choices of Best Normal and Low The better quality will result in bigger image size and need bigger bandwidth QView Allows you to display channels on another monitor For details see 8 2 5 Channel Display on Another Monitor Full Screen Extends the channels to full screen Press the Esc key to return to the original mode 91 Auto Retry when Connection Broken Automatically reconnects when the connection between the Matrix View and cameras is lost This option is enabled by default 92 8 Multi Monitors Applications 8 3 Video Wall A Video Wall is an establishment of multiple monitors on a server displaying composite IP sources from various IP devices Using the Control Center you can remotely configure and manage up to 200 Video Walls each with a different layout On each Video Wall you can display up to 288 IP channels freely adjust the size and position of each channel whether it be within or across monitors create up to 16 Zoom Windows which display channels through manual activation create up to 16 Scan Windows which are capable of displaying up to 64 channels in turn at customizable time interval display up to 16 web pages using Web Window play back up to 16 videos using Media Window play back up to 16 videos using Remote ViewLog Window display live views enabled from Remote E Map display up to 288 channels of customized view region of a remote monitor From Con
13. Ee Delete re Add new Layout Update Figure 8 42 2 The update completes when the Video Wall Server icon E reappears 3 Right click the Video Wall Server icon E and select Start Service 4 On the Layout List right click the Video Wall server and select Connect to resume the connection 120 8 Multi Monitors Applications 8 4 Fisheye View The hemispherical image of a fisheye host can be converted to a conventional rectilinear projection and displayed on Single Live View Matrix and Video Wall The following camera types are supported e G V Fisheye Camera e Any camera without a built in lens with an ImmerVision IMV1 Panorama Lens installed e GV IPCAM H 264 Camera of Box module with a third party fisheye lens installed e Any IP camera supported by GeoVision with a third party fisheye lens installed You can choose among four view modes and adjust the PTZ views to different angles Q as aate g Yy 7 a a i he Quad view 4 PTZ views M i y N I T ate SS z a a U ie E An E s v E A Dual 180 degree 2 180 views Single view 1 PTZ view Figure 8 43 121 Setting Up the Fisheye View 1 Enable the fisheye live view e For Single Live View right click the camera from the Host List Figure 1 1 e For Matrix display enable the Matrix view containing the fisheye view For detail see 8 2 1 Running the Matrix View e For Video Wall display activate the fisheye channel For det
14. Figure 2 1 2 To access live view of a camera right click the camera on the Host List and select Live View Note 1 To add a DVR host it is required to enable Control Center Service at the DVR otherwise the message Unable to Connect will appear when accessing the live view See 2 3 Connecting to Control Center 2 The Control Center supports IP video devices using RTSP ONVIF and PSIA standards To connect the IP device compatible with any of these standards select Protocol from the Brand drop down list See RTSP Streaming Appendix C 13 C GeoVision 2 2 2 Creating a Group You can group cameras from different hosts by location and purpose such as matrix view display 1 On the Group List window click the Add Group button No 4 Figure 1 4 Name the created group Drag the desired cameras from the Host List to the created group oo o Click the Save button No 1 Figure 1 4 to store your settings Tip Right click a camera to see the device information and access the live view A Getting Started 2 3 Connecting to Control Center The Control Center supports several types of hosts Only the DVR GV System GV VMS hosts need to be configured and started for connection to Control Center To configure the client DVR in order to access the Control Center services remotely through a network connection click the Network button on the main screen point to Control Center Server and then select Start Default
15. a PARA TAULUT eg PPrp ly ip i i T ri L l I W l HE J L f Eos a te a 4 E A r g if anne pe Original Image Setting Field of View Angle 1 360 eee ee ee S es Figure 3 5 To apply the configuration select the Change Size button No 2 Figure 3 1 and select Wide Angle Lens Dewarping 27 C GeoVision 3 2 PIP and PAP View With PIP Picture in Picture you can crop your video to get a close up view or zoom in on your video With PAP Picture and Picture you can create a split video effect with multiple close up views on the video You can enable PIP or PAP functions in Live View Remote ViewLog and Matrix View Live View In the Host or Group List right click one camera and select Live View In the Live View window click the Change Size icon and select PIP View or PAP View GV BX5300 Camera D a Pe m AK 9 49 53 z Stream 1 E Stream 2 320 Defog Stabilizer Wide Angle Lens Dewarping Wide Angle Setting IMV1 Panomorph Figure 3 6 Playback Right click one camera in the Host List or the Group List and select Remote ViewLog In the Remote ViewLog window click the View Mode button select Single View and select Mega Pixel PIP or Mega Pixel PAP Matrix Right click one camera view and select PIP View or PAP View 28 EJ Live video 3 2 1 Starting PIP View To start the PIP View follow the instructions below 1 After you sele
16. the Channel and Layout 5 To add another Web Window right click the space in Channel List and select Add Web Window 6 To delete a Web Window right click the icon in Channel List and select Remove Note To set up a home page on the Web Window see 10 5 Video Wall Settings Video Playback on Video Wall with ViewLog You can display and play back up to 16 recordings of last 5 minutes on Video Wall Y Total 1 288 w IL B g a Pi ee Ao Ah ae Zoom Window 0 ee Scan Window 0 ce Media window 0 M 7 iD 3 m iT iT E m Ta cL as D Ul a Figure 8 35 Beginning Pause Backward Play Sto Forward Y j r End b 1 E ida b gt PI J Figure 8 36 114 8 Multi Monitors Applications 1 Drag and drop the Remote ViewLog Window icon to the layout 2 Adjust the size and position of the Remote ViewLog Window For details steps 7 to 9 in 8 3 3 Adding a Server and Configuring the Layout 3 Drag a drop a camera from the Host List to the Remote ViewLog Window for playback Events recorded from the previous 5 minutes are played back on the Video Wall 4 To add another Remote ViewLog Window right click the space in Channel List and select Add Remote ViewLog Window 5 To delete a Remove ViewLog Window right click the icon in Channel List and select Remove Note Make sure you have enabled Rem
17. 1 Remote E Map Displays pop up live views when a motion input or temperature alert is detected See 3 4 VMD Monitoring Collectively manages I O devices of different hosts See O Central Panel Chapter 7 Speaks to multiple hosts over LAN or the Internet simultaneously See 4 2 Audio Broadcast Displays a selected camera view on the primary monitor when multiple monitors are used For Matrix View see 8 2 Matrix View Q GeoVision 1 3 3 The Host List 99999 999 set cn m FE 2A G System 1 Ep DYR List GY System 1 ay n DVR List ya Video Server List G ga IP Camera List S o GY CBW120 0 Camera List SH Camera Ay 10 BOX List wy Recording Server List ify Host List by ID ea Group List gg Host List Figure 1 3 The controls on the Host List No Name 1 Save 2 Delete 3 Add Host 4 Host Settings 5 Camera Information 6 Remote Control 7 Remote ViewLog 8 Microphone Description Saves the changes made in Host List Deletes the selected host Adds a Host Displays the host settings of the selected host Click to watch live view access Remote ViewLog and play back recordings instantly Access applications including Remote DVR Remote Desktop and Event Data Query See Remote DVR Applications Chapter 6 Plays back recordings of the selected camera See 5 2 Remote ViewLog Allows the user to speak to and listen to a selected host a Introduction 1 3 4 The Gro
18. 4 Right click the channel again and select Zoom The channel is displayed on the selected Zoom Window and disappears on the original monitor 5 To disable zooming right click the channel and select Zoom again The image returns to the original monitor 6 When the Zoom Window already displays a zoomed view you can replace the view by right clicking another channel and selecting Zoom 105 7 To adda Zoom Window follow the steps below A Right click the space in Channel List and select Add Zoom Window A new Zoom Window icon appears in the Channel List B Refer to step 2 to adjust the position and size C To select a Zoom Window for zoom display right click the channel select Zoom Mapping and select a Zoom Window 8 Todelete a Zoom Window right click the icon from the Channel List and select Remove Note 1 106 To set the size of Zoom Window proportional to the source video right click the window and select Fixed Ratio To operate the Zoom Window using GV Keyboard V3 see 2 6 GV Video Wall GV Keyboard V3 User s Manual 8 Multi Monitors Applications 8 3 6 Setting Up a Scan Window With a Scan Window you can reserve a portion of the Video Wall to display a group of channels in turn Up to 16 Scan Windows can be established and a Scan Window can display up to 64 channels in turn 1 Establish a Group with the channels for scan display 2 Drag a Scan Window icon from the Channel List to a desired mon
19. 5 l fad Remote ViewLog AEE Matrix 2 TEBE iatri 6 R Remote E Map i HARE matric ILS VO Central Panel Matrix 4 HAR matrix Figure 8 1 Tip Right click the space at the bottom to sort icons in Icon List Tile or Details TT 2 Right click an icon select Show to display the window on the layout and manually drag the window to assign position Alternatively right click the window icon select Set Position and type co ordinates Y Figure 8 2 Tip It is workable to move and place a window between or among monitors 3 To adjust the resolution and access other settings right click the application window or the icon at the bottom 2010 0 Matrix 1024x768 1280 x 1024 O E H1920 1080 192 1600x 1200 1920 x 1200 Matrix 2 1280x800 j J 2270 Bee w 1920x 1080 VO Cent Remote 1440 x 900 w Show Full Screen Set Postion a RemoteDVR Matric 1 i a Remote ViewLog Matrix 2 Remote E Map Matrix 3 3 VO Central Panel be Matrix 4 Figure 8 3 Resolution Select a resolution option Show Uncheck this option to remove the window from the Application Position panel Activate Remote Camera For Remote DVR only Select or unselect access to individual channels of client DVR 78 8 Multi Monitors Applications Shut down when the Control Center is closed For I O Central Panel only Select to inactivate the I O Central Panel when the Control Center is closed Full Screen
20. Account Management Security Room Ga Administrator Eg admin Rename n PowerUser Change Password i E E Disable Account E Login this ID automatically Account Management Application Execute Matrix MI eExit Matrix Execute WMD System MIeExit VMD System Execute Remote E Map Exit Remote E Map Execute 1 O Central Panel Exit I O Central Panel JExecute Remote ViewLog MW Exit Remote ViewLog JExecute Broadcast Service MW Exit Broadcast Service im Fwraciita Dannrarna Figure 9 34 3 From Authentication Center s Host List click the Add Host a button to add hosts For details see 2 2 1 Creating a Host Tip You can configure hosts IP address device name remote storage and view storage information using the Batch Update Wizard 4 button from Authentication Center s main window For details see 9 3 Batch Functions 159 4 Optionally group the hosts You may create a group by its location or purpose such as a VMD group I O Panel group or an E Map group For each group you can further allow or restrict its access from each account A Right click a category VMD I O Panel E Map or Broadcast Service and select Add Group or create an independent group by right clicking the space and selecting Add Group Group List Group List bd XK f axe J EB YM Group VO Panel Group Bk p B E Map Group B L O Pan Delete B Broadcast Service E
21. Batch Update Wizard button and select Auto Set IP Address This window appears Assign IP New Setting Status Figure 9 17 2 Select the devices to be configured from the Host Name column To select all the devices click MI To uncheck all the devices click jm 3 To assign consecutive IP addresses to multiple GV IP Devices follow the steps below 146 Gateway and DNS server A Under the IPV4 section select and type the Start IP address Subnet Mask Default FJ Other Applications B Click the button B to preview the new IP address in the Assign IP column If more than one device is selected their IP addresses will proceed after the Start IP address Auto Set IP Address ol Host Name C G VSO4H C Gv v504H 1 C GV LX4C3 C GV BX120D BX120D E O GV BX320D BX320D E UBX3301 C DVR FE420 FE421 GV FE420 FE421 GV FES20 FES21 IP 192 168 3 83 192 168 0 137 192 168 4 31 192 168 0 69 192 168 1 251 192 168 2 11 192 168 2 245 192 168 2 17 192 168 0 84 192 168 0 103 MAC Assign IP 0013E2023255 0013E20433B3 0013E200FC2D 0013E2024741 0013E2023C1C O013E2FFO784 0013E2019B89 0013E20415F 0013E2034693 192 168 2 12 192 168 2 13 0013E2041783 192 168 2 14 C G BX120D Ipv4 Start IP address Subnet Mask Default Gateway DNS Server To manually enter IP addresses type the IP addresses in the Assign IP column Figure 9 18 New Setting Status Click Start to
22. Configure button No 1 Figure 1 2 and select QView This dialog box appears Figure 8 7 2 Use the drop down list to select a desired monitor 3 Click one channel to be displayed on that monitor Figure 8 8 4 To switch to another channel simply click another channel in the Matrix 8 8 2 6 Quick Zoom When you are monitoring Matrix Views on multiple monitors the Quick Zoom feature allows you to call back a desired camera view to display on the primary monitor for instant inspection 1 Click the Matrix Quick Zoom button fj No 21 Figure 1 2 This dialog box appears Matrix Quick Zoom Figure 8 9 2 To identify the position numbers of monitors click the Identify button The position numbers will be displayed on the Matrix Views Following is an example of running four Matrix Views in four separate monitors Figure 8 10 3 To display a desired camera view on the primary monitor type its monitor number of the Matrix View and the camera channel Click Zoom 4 To return to the previous Matrix View settings click Restore 5 To disable the position numbers displayed on Matrix Views click Identify again 88 8 Multi Monitors Applications 8 2 7 Configuring the Matrix Position When you have set up more than one monitor and want to display matrices separately on each of the monitors you can assign a monitor to each of the matrices 1 Configure the matrix position using the Application
23. E ee ee ee E ees ees 48 Oe MSTA AV ACK ices aceon dans aetstatansadeleanesndetcuiaatoe ni suba ctu asnca es dandaastidatansddvostumtdsleh quiastansientsa tials 48 52 FROTIVOLS LAY ACI is weitere a 52 5 2 1 Running the Remote ViewLog ccccccscccsescecescecsseeeceuececeueceeaseeeeaeeesaseessaseessueeeneuesenaas 52 Chapter 6 Remote DVR Applications cccccseeceeeeeceeeeeeeeeseneeeesenseneeeeseneeeesneones 53 oT ROMOL DN E eea E N E E E E 53 6 1 1 R nning the Remote DVR ssisacestrssctincisaiiwnnsiccmoniane cacnetand EEEE EEEO E ERRE 53 6 2 Remote LCSD aire cesses niniin aair ave ncdisiedeeistavncensumedeceddiebeactieedecs 55 6 2 1 Running Remote Desktop ccccccceccsseccseseeceseecsaeceneecesseceneuecesageeesaseeesaseessueeenseesenees 55 O22 FE Man ep E S E E enaneerencsicesiedeeseeied 56 6 3 Data Event Query on GV System GV VMS 1 0 0 ccceccccccceeeeeeseeeeeeeeeeeeeeeeeeesaeeeeeesaeeeeeseeeesaeeeeens 57 Chapter 7 I O Central Panel cccscceeeeeeceeeeeeeeeneeneeeesenecnesensonseeesenseneseneones 59 FA Running the VO Contral Pano vescercasensesdcsteucs ica seudaceseudeescbisnen aE ETERA 59 2 The VO Central Panel siissmncnisssrieensiirea aa kaia E EAEE 60 7 3 Creating a Group for Cascade TriQQers cccccccccccsesceeceeeeeeeeeeeeeseeseeeeseeeeeeseeeeeeseaeeeesseneeesaaeeees 61 T Creating OUD cesca EE EEEE E TENE EAEE TEEN EENE 61 geo Wy gues EUG Aa OU e E E EE 62 Too Ean a O DC IC O eurie
24. For Matrix window only Set Position See step 2 in this section 4 To configure the view and playback types for Remote E Map right click the Remote E Map icon or window Figure 8 3 View Type You can define the display position of live view enabled from the Remote E Map Remote E Map Select this mode for the camera live view to appear in a separate window Figure 3 1 This option is selected by default Live View Select this mode for camera live view to appear on Control Center s Live View window Figure 3 2 Video Wall Select this mode for camera live view to appear on the Video Wall For further details on Video Wall settings see 8 3 8 Displaying Live View Enabled from Remote E Map m Playback Remote E Map Select this option to play back recordings in a separate Instant Playback window Control Center Select this option to play back recordings in the Instant Playback window on the Control Center s main window 5 Re activate the application for the configurations to apply 19 8 2 Matrix View Matrix View allows the center operator to monitor up to 96 cameras from different hosts on the same screen Further the operator can remotely change camera s monitoring status and properties The Matrix view provides these features e Support for screen resolution of 1024 x 768 1280 x 1024 1600 x 1200 1680 x 1050 1920 x 1200 1280 x 800 1920 x 1080 and 1440 x 900 e Simultaneous display of up to 96 ca
25. GV Control Center at this step select Cancel Figure 9 40 From the pop up dialog box Figure 9 41 select Local and then follow step 2 to log in locally Clicking AuthCenter will bring you back to AuthCenter Login dialog box Figure 9 40 User Login Figure 9 41 163 9 4 5 System Settings General Settings To access this dialog box click the Configure button A from the Authentication Center s main window and select the General tab System Configure F Auto start service E Minimize when startup Layout E Display host name in the Group List E Sort the Group List by names Always On Top AuthCenter Style Blue Style Figure 9 42 Startup E Autorun When Windows Starts Automatically runs the Authentication Center at Windows startup Auto Start Service Automatically activates the Authentication Center service mE Minimize When Startup Minimizes the Authentication Center window after login Layout E Display Host Name in Group List Displays the host name of the added cameras on Group List Figure 9 36 E Sort the Group List by Names Arranges folders in alphabetical order 164 FJ Other Applications E Always On Top Keeps the Authentication Center window on top of all windows E AuthCenter Style Select a theme for Authentication Center window using the drop down list 165 Network Settings To access this dialog box click the Configure button A from the Authentication Center
26. GeoVision Control Center and follow the on screen instructions Downloading from GeoVision Website 1 Plug in the GV USB Dongle to the computer 2 Goto the Software Download Upgrading page of GeoVision Website http www geovision com tw english 5 8 VMS asp 3 To install the USB device driver select Video Management Software tab from the Driver section click the Download button f 2ouom of GV Series Card Driver GV USB Device Driver 4 To install GV Control Center select the Video Management Software tab from the Primary Applications section click the Download button cavm_orc of GV Control Center PJ Getting Started 2 2 Hosts and Groups You need to create hosts and groups before starting the services To create hosts you can use the Search Host function No 3 Figure 1 2 to detect GV devices and compatible third party IP devices on the same LAN and add them to the Host List or you can follow the steps in the following section Note 1 To use the Search Host function to locate GV devices it is required to open TCP port 5201 on the client DVR TCP port 5202 on the Video Server and Compact DVR and UDP port 5200 on the Control Center 2 If antivirus software is installed the Search Host function may be interfered and will not detect the available hosts In this case turn off the antivirus software and try again 11 C GeoVision 2 2 1 Creating a Host You can create a host of the DVR Compact DV
27. Position button No 2 Figure 1 2 For details see 8 3 Application Position Right click a Matrix group select Set Start Position and select a matrix number The matrix numbers here correspond to the ones on Application Position layout A P letter appears on the group folder once the position is assigned Group List ka S T l a t BR 4 VMD Group H E 1 0 Panel Group Matrix Remote ViewLog Panorama Setting Panorama wiew F Set Startup to Set StartPosition F Delete FI GeoVision Japan Rename AN GV FE420 amp FES AA GV MDR 120 Camera bee SN GV MFD130 Camera 1 Figure 8 11 Matix 1 Matix 2 Matrix 3 Matrix 4 Matrix 5 Matrix 6 Matrix 7 Matrix 3 Note To automatically display Matrix views at Control Center startup and set up the display order see 10 1 General Settings The folder turns red when it is assigned with a Startup position 89 8 2 8 POS Live View The POS Live View allows you to view POS transaction data or cardholder information of access control in a separate window Note This function is only supported by GV System To open the POS Live View window click the ViewLog button No 6 Figure 8 5 and select POS Live View To have the instant playback double click the desired transaction item or cardholder data on the POS Live View window Reno smear CALYPSO DEMO VERSION CALYPSO 3 2 Orange Joice Oreo Cookie Hot Dog lilk
28. RTSP over HTTP The RTSP protocol uses a HTTP port for video streaming from the IP camera E RTSP over TCP The RTSP protocol uses a TCP port for video streaming from the IP camera E RTSP over UDP The RTSP protocol uses an UDP port for video streaming from the IP camera 3 On the Command box type the RTSP link address For the RTSP command please consult the documentation of your IP camera For example For an AXIS IP camera type RTSP lt IP of the IP camera gt lt codec gt media amp For a HIKVISION IP camera type RTSP username password lt IP of the IP Camera gt 185 Appendix D Supported IP Device Brands and Protocols The supported third party IP device brands and protocols are listed below For detailed information refer to Supported IP Camera List on GeoVision s Website http www geovision com tw english 4_ 21 asp Geovision JVC ACTi Arecont Vision Z G a Messoa Axis Mobotix Bosch Panasonic Canon Pelco Samsung D Link EtroVision Sanyo SONY C U Hikvision HUNT IQinVision Verint Vivoteck 186 Appendix Control Center Feature GV VMS DVR NVR Host IP Camera Host GV Video Server Host GV Compact DVR Host GV Recording Server Video Gateway Hosts Remote DVR Remote DVR Desktop Remote ViewLog Video Wall optional I O Host Only for GV IP Devices Remote E Map Host Map Live View Matrix View Group Channel VMD Group Channel
29. Service or Start All Service to connect 15 C GeoVision 2 3 1 The Control Center Server Window When the client DVR starts the Control Center Service CCS as described above the server will be minimized to the system tray Click the server s icon to restore its window For GV System Ek Event Service IP Address Login Matrix i27 0 0 1 Login Remote viewLog 127 0 0 1 Login Remote viewLog i27 0 0 1 Logout Remote YiewLlog 127 0 0 1 Login Remote viewLog 127 0 0 1 Logout Matrix 127 0 0 1 Logout Matrix 127 0 0 1 Stop Service Control Center Stop Service All Service Start Service Control Center Stop Service Control Center Start Service Bandwidth Control Stop Service Bandwidth Control Start Service Control Center Login Matrix 127 0 0 1 Login Matrix 127 0 0 1 1152007 2 33 36 PM 1152007 2 33 47 PM 1152007 2 38 59 PM 11 5 2007 2 39 08 PM 1152007 2 39 18 PM 11 5 2007 4 19 12 PM 11 5 2007 4 19 12 PM 11 5 2007 4 19 12 PM 11 5 2007 4 19 15 PM 1152007 4 19 17 PM 11 5 2007 4 19 20 PM 11 5 2007 4 19 57 PM 11 5 2007 4 20 00 PM 11 5 2007 4 20 06 PM 11 5 2007 4 20 06 PM 11 5 2007 4 20 06 PM ee oo Figure 2 2 GV VMS 3 4 5 9 Q Oemssenice eN E E Aika ane wo EJ 4 74 Figure 2 3 16 A Getting Started The controls on the CMS Server No Name 1 2 Stop All Service Start Default Service Start Stop Control Center Service Start Stop Remote ViewLog Service Start
30. Shows the camera number or camera name Others DirectDraw Enhances video performance of live view images This function is enabled by default Shut down the Video Wall Server when the Control Center is closed Automatically disables Video Wall service when Control Center is closed Show Style Changes the icon display mode in Channel List Figure 8 27 Web Window Homepage Sets the homepage for Web Window on Video Wall For details on Web Window see 8 3 7 Displaying Remote Monitor Web Page and Playing Back Videos 175 10 6 Authentication Center Settings You can have all the user accounts and their access rights centrally managed by Authentication Center For more details on Authentication Center see 9 4 Authentication Center i System Configure VMD System Video Wall AuthCenter User Login 6 Use Remote Authentication Account IP Address Port Auto Login ID Password Figure 10 6 User Login E Local Logs in without connecting to an Authentication Center and the GV Control Center has full control over its accounts and their access rights m User Remote Authentication Account Logs in using an account already created on the specified Authentication Center to which the GV Control Center submits to the access rights settings IP Address Type the IP address of the Authentication Center Port Type the port setting of the Authentication Center The default is 1545 Auto Login Select this o
31. Stop Desktop Service Start Stop Bandwidth Control Service Event List Description Stops all Control Center Server services Starts all default services Starts or stops these services Matrix I O Central Panel and Remote DVR It indicates that the host allows or not allows the Control Center to access the I O modules and GV System GV VMS Allows or prohibits the Control Center to access the ViewLog files Allows or prohibits the Control Center to control the desktop Allows or prohibits the Bandwidth Control Server to control the bandwidth See 11 11 Bandwidth Control Applications GV DVR User s Manual on the Software DVD Indicates login ID event type event time service activation and IP address 17 C GeoVision 2 3 2 Advanced Settings To configure the CCS Server click Configure on the window menu Network Settings Keep the four communication ports as default unless otherwise necessary Setting ee r Network Command Port 3388 Data Port 3011 Log Port 5552 HTTP Port 5553 Network Settings Network Command Port 3386 5611 Codec Geo Mpeg4 Data Fort Remote ViewLog Log Port 5552 Maximum Users Http Part S555 End connection when idle more than 30 minutes Enable IP White List Codec Geo WWpeqd w 2 Remote YiewLog Maximum Users End connection when idle more than minutes Cancel Figure 2 4 GV System Figure 2 5 GV VMS Service
32. System GV VMS is in use and has been locked te DVR Remote Login W28r2000 16 38 42 IP 192 766 0212 User Figure 6 1 C GeoVision If the client wants to interrupt the connection click the button at the bottom right corner A valid ID and Password are required to stop the connection Tip If you wish to minimize the bandwidth used while viewing cameras of the client DVR you can choose to view certain cameras only There are two ways to activate and deactivate Cameras 1 Before connecting to the client DVR in the Control Center click the Application Position button f right click the Remote DVR window and select Activate Remote Channels to select or unselect cameras Actwe Remote Camera M 1 w 2 M 3 W 4 IM 6 W9 wlio i W 12 W 14 W i6 Mliy Mis Elis M20 ri W 22 23 8624 W25 M26 m27 28 29 M30 131 32 Figure 6 2 2 When connecting to the client DVR on the main screen of the client DVR click the Exit button and then select Activate Remote Camera Check or uncheck cameras Note Remote DVR current does not support audio ouput PTZ and I O control 54 6 Remote DVR Applications 6 2 Remote Desktop The Remote Desktop allows the Control Center operator to access its host DVR and also control the client desktop in a separate window The Control Center operator has a full control of the client GV System GV VMS and its operation system 6 2 1 Running Remote Desktop 1 The client DVR must act
33. This is especially useful when suspicious events occur and the operator would like to communicate with the security personnel at the surveillance site To access this feature right click on a camera view that you wish to communicate with and select Wave out Toggle to access audio from the host and Talk Back Toggle to speak to the host 04 GV BX130D BX130D E Camera 1 7 i i Snap Shot Instant Play P Start Monitoring Video Attributes advanced Video Attributes Wave Out Toggle Talk Back Toggle PIP View PAP View Wide Angle Lens Dewarping Wide Angle Lens Setting Toggle Fullscreen E Figure 8 6 85 8 2 4 Instant Playback When monitoring through Matrix View you can instantly play back any suspicious videos of a certain time length Time length choices include 10 seconds 30 seconds 1 minute and 5 minutes For details see 5 7 Instant Playback e To instantly play back the events of all channels click the ViewLog button No 6 Figure 8 5 select Instant Play and select the time length e To instantly play back the event s of a single channel right click the camera on the device tree on the Control Center window and select Instant Play 5 min 86 8 Multi Monitors Applications 8 2 5 Channel Display on Another Monitor If the Control Center is equipped with multiple monitors you can use the QView feature to display a selected channel on another monitor screen 1 Open the Matrix window click the
34. W Control Center Service if Remote ViewLog Service Remote Desktop Service Bandwidth Control Service General lv Prompt to Accept Remote Desktop Enable IP White List Limits access to the Control Center Server by assigning IP ranges Codec Sets video compression to Geo Mpeg4 or Geo H264 Note Remote Desktop does not support Geo H264 codec UPnP To automatically configure three communication ports on your router click the Arrow button beside Http Port for UPnP settings Remote ViewLog Sets the maximum number of users to access the video files for playback from 1 to 16 It also sets the idle time after which to end the Remote ViewLog application A Getting Started Event Log Settings Sets the log storage path and duration Set Default Service Select the desired services to set as default Default Service Service Control Center Service Control Center RemoteD R Matrix VO Central Panel etc Remote ViewLog Service Remote Desktop Service Bandwidth Control Service Cancel Figure 2 6 GV System Prompt to accept The client can be prompted to accept or reject the connection when the Control Center attempts to access its GV System GV VMS through Remote DVR service or Desktop through Remote Desktop F Remote DYR Logon From 127 0 0 1 Reject Comment 1 iz tying to connect to this Multicam IF you allow you will be logged out but you can resume later Never
35. When motion or an event is undetectable the pop up view on the primary monitor will close but the pop up view on the other monitor will last for the specified time The last image of the pop up view will remain on the screen if no new event pops up To clear the image right click on the screen and select Clear Note For this function to work the Control Center must be set up with at least two monitors 1 Click the Show System Menu button on the toolbar of VMD window and select Pop up Viewer This dialog box appears Pop up Viewer Select a monitor Play Time SEC Figure 3 18 2 Use the drop down list to select a desired monitor 3 Type Play Time to specify the length of time that a pop up view remains on another monitor Type the time length between 1 and 10 seconds 43 Chapter 4 Audio Communication 4 1 Audio Communication The Control Center operator can speak to listen to and engage in two way communication with a specified host Host List dX 2 I E Host 3 Microphone oo Wave Our F SI ele DVR List 2 Way b E Host 1 E Host 2 el Host 3 we TEST 249 Pi ba ar Compact DYR List ele Video Server List ele IP Camera List ale 10 60 List ale Recording Server List ale Host List by ID Figure 4 1 Speaking to a Host 1 Select a host from the Host List The name of the selected host appears in the space below the toolbar Figure 4 1 2 Click the Microphone button od No 8 Figu
36. X f Text Color f Background Color Alarm Level Level Undefined Trigger Setting i Trigger Associated Outputs Latch Trigger if Associated Camera Camera 1 W Digital Input invokes the Associated Camera Default Cancel Figure 7 6 Display Setting You can define the nature of I O devices by colors Note that the setting only affects the Detail style of the Advanced I O List No 4 Figure 7 2 Alarm Level drop down list Click the drop down list and select one of the six default colors Fire Smog Vibration Intruder Motion and Emergency For the Level Undefined option select Text Color or Background Color and then click the Input Output drop down list to change its color Tip To modify the naming for default alarm level see 7 4 Configuring the I O Central Panel in the following section Trigger Setting Trigger Associated Outputs Triggers outputs in cascade mode Latch Trigger Instead of a lasting output alarm the Latch Trigger option provides a momentary alarm when an input is triggered in cascade mode For details see Latch Trigger Chapter 6 GV DVR User s Manual on the Software DVD Associated Camera Assign a camera for its live view to be popped up when this input is triggered After this option is enabled you can click the input icon and select View Associate Camera to view live video anytime Digital Input Invoke Associated Camera The live video pops up when its associated
37. a camera to an input device right click an input device in the Advanced I O List and select Setting This dialog box appears Pin Setting Input Display Setting s Input 1 O Text Color Background Color Alarm Level Level Undefined w Trigger Setting Trigger Associated Outputs Latch Trigger e Associated Camera Camera 1 yt Digital Input invokes the Associated Camera Figure 7 21 7 Select Associated Camera assign a camera from the drop down list and select Digital Input Invokes the Associated Camera 8 Click OK When the input is triggered the live video of its associated camera will pop up Tip You can use a GV Keyboard to switch the audio microphone and speaker of the pop up video on or off 76 Chapter 8 Multi Monitors Applications 8 1 Application Position The Application Position is a tool for adjusting the resolution and position of the application windows in Control Center Note If the Control Center is displayed on a widescreen monitor you can also utilize this feature to help you arrange the positions of application windows 1 Click the Application Position button on toolbar The Application Position window appears 1920 0 1920 x 1 0 0 1920 x 1080 Monitor 2 Monitor 1 1920 1080 1920 A 0 1080 1920 x 10 1920 1080 1920 x1 Monitor 3 Monitor 5 Monitor 6 2270 3049 V0 Cent Remote Ps RemoteDVR Matrix 1 Matrix
38. a remote desktop server by right clicking the Remote Desktop Service from Host List and selecting Add Remote Desktop 112 8 Multi Monitors Applications 4 Drag the monitor to the layout and configure the position and size of the remote desktop on Video Wall For details see step 6 to 9 in 8 3 3 Adding a Server and Configuring the Layout 5 Activate the layout For details see 8 3 4 Activating the Channel and Layout The defined area of the remote monitor is displayed on the Video Wall Displaying Web Pages on Video Wall You can display and operate up to 16 web pages on the Video Wall DYR Layout1 x Live view hd 0 0 520 352 Total 2 288 Web Window 0 http awww geovision com tw 28 Zoom Window 0 Media Window 0 001 Office Camera Figure 8 34 Controls on the Web Window Icon Function Ki Click to go back to the previous page e Click to go to the next page Click to go to the home page Click to refresh the Web page Click to link to the specified Web address Follow the steps below to display a Web page on Video Wall 1 Drag and drop the Web Window icon to the layout 2 Adjust the size and position of the Web Window For details steps 7 to 9 in 8 3 3 Adding a Server and Configuring the Layout 3 Type the Web address in the blank Figure 8 34 and click 113 4 Activate the layout or just the channel for instant display For details see 8 3 4 Activating
39. approximately half size of that IP Camera resolution 22 Live Video 3 1 2 Displaying Multi Views The Live View window is designed for multi channel live view display You can monitor up to 36 channels simultaneously To display live view on this window you can e Drag the cameras from the Host List Figure 1 3 to Live View window Figure 3 2 e From a Remote E Map Figure 9 11 click on a camera icon Note For live views enabled from Remote E Map to display on the Live View window define the display position in Application Position window For detail see step 3 in 8 7 Application Position Figure 3 2 23 C GeoVision The controls on the Live View window No Name 1 S ot 10 11 24 screen Division My Favorite Screen Division Fit Window Fixed Ratio Full Screen Close all video Live View Setup Snapshot Monitor Stop All Monitoring Monitoring Status Description Select among the screen division 4 9 16 25 36 Applies the screen division set in Live View Setup No 7 Figure 3 2 Extends the live view to fill the channel Displays the live view proportionally to its source Changes the live view window to full monitor display Closes all the live view channels Sets the My Favorite Screen Division No 2 Figure 3 2 monitor for full screen display and the host and camera name caption display Snapshots and saves the live views curr
40. ask me again Figure 2 7 GV System Auto start default service when Windows starts Automatically runs the default services at Windows startup Hide when minimized Hides the minimized Control Center Server window to the system tray 19 Chapter 3 Live Video 3 1 Live View You can choose to display live views in separate windows or collectively on the Live View window 3 1 1 Displaying Single Live View To display single live view window Figure 3 1 e On the Host List Figure 1 3 or Group List Figure 1 4 right click any camera and select Live View e On the Host List or Group List click the Camera Information button and select Live View e Ona Remote E Map window Figure 9 11 click a camera icon PUIOQUOUYBDGOUYUW Host 3 Camerc 1 HEE J pe Fy te is an i Ls x x 7 is ile ere a et a ee a a Figure 3 1 EJ Live Video The controls on the single Live View window No Name Change Camera 2 Change Size 3 Audio 4 Microphone 5 Setting 6 PTZ 7 Visual Automation 8 Snapshot 9 Zoom 10 Instant Play Description Switches to another camera of the same host m Size Changes the size of the live video The size corresponds to the video resolution set at the host The size choices are only available when the video resolution is higher than 320 x 240 Defog Enhances image visibility Stabilizer Stabilizes live images Stream1 Stream2 Chooses c
41. hierarchy drag the desired inputs outputs from the left Standard I O List to the group Note In the cascading hierarchy each input can only be used once while the same output can be used repeatedly 61 C GeoVision 7 3 2 Editing a Group To modify group settings right click a group and select View Edit This dialog box appears Group Information Group Mame Hallway Group Notify Setting Invoke Alarm Buzzer a fi Current Pin Setting Input 1 Input Level Undefined g Trigger Associated Outputs Change leon Default icon amp Hallway Input 1 e Output 1 Output 2 Figure 7 5 Group Name As described in Figure 7 4 Group Notify Setting As described in Figure 7 4 Current Pin Setting To enable this option highlight an I O device from the group list at the bottom Trigger Associated Outputs Triggers outputs in cascade mode Click the Finger tab to apply the change to all I O devices at the same group Change Icon To enable this option select one of two displayed icons Normal or Trigger Click the Change Icon tab to change an icon Click the Finger tab to apply the change to all I O devices at the same group 62 I O Central Panel 7 3 3 Editing an I O Device In addition to editing groups you can also edit the settings of individual I O device Right click an I O device and select Setting This dialog box appears Pin Setting Input Display Setting fis inputi
42. input is triggered See 7 13 Popping Up Live Video After Input Trigger 63 C GeoVision 7 4 Monitoring Hosts from the I O Central Panel You can watch host live view play back recordings and view host information directly from the I O Central Panel This is especially useful for administrator to get an immediate checkup of the host when a trigger event occurs 1 0 Central Panel A A S e L Standard 1 0 List Advanced I O List Gate 1 Modules Offre F Host 3 2 Modules SD Module 1 o Outputl 3 inputi Output Output1 Output Module 2 Input a Input Output Figure 7 7 Watching Live View On the I O Central Panel click an input and select View Associated Camera to watch the live view of the camera associated with this input device A single Live View window appears To associate a camera with the input see 7 3 3 Editing an I O Device For details on single Live View see 3 1 7 Displaying Single Live View 64 I O Central Panel Viewing Host Information You can obtain information on host name alarm level and a history of trigger events Right click an input icon from the Advanced I O List and select Information The Pin Information dialog box appears Fin Information Hame Inputi Signal Type Input Last Trigger Time gii4 20iz2 15 49 48 Alarm Level Level 4 Intruder Position Module 1 Pin 1 Host Host 3 Trigger Time List 11 Of14fe0l
43. map used to monitor the installed GV IP Devices I O devices and cameras connected to GV System GV VMS The Remote E Map can e illustrate the location of the installed cameras and I O devices with icons e illustrate the surveillance zone of the installed cameras e signal motion and I O events with blinking camera icons or blinking map areas e access and play back event recordings via camera icons For detail see 5 7 Instant Playback 7 Note Third party IP cameras are not supported in Remote E Map Follow the steps below to create and activate a Remote E Map 1 Drag the desired hosts from the Host List to the E Map Group in the Group List Group List La X lt f Gi Sx 2 RES cel VMD Group Za VO Panel Group 3 E Map Group Figure 9 1 2 Click Save to store the settings 3 If your E Map Group contains any Client DVR channel be sure to enable the Control Center service on the DVR 4 Create E Maps for the hosts you saved in the E Map Group in step 1 e Select System on the Control Center s main window and then select E Map Editor or e Select E Map Editor within the Control Center folder from the Windows Start menu The E Map Editor window appears For an overview of the E Map Editor window see 9 1 1 The E Map Editor Window For details on creating an E Map see 9 1 2 Creating an E Map 5 Setup motion and or I O alerts for the hosts For details see 9 7 3 E Map Alerts 128 FJ Other Applica
44. of the access rights of all the accounts This option is only available for an Administrator account E Select or unselect the listed features and functions on the General Application and Video Wall tabs to allow or prohibit the account s access 179 10 8 Backing Up System Configurations You can export and back up GV Control Center s configurations By default settings in Host List Group List Control Center Setting settings in System Configure Figure 10 1 Live View Setting Virtual PTZ Setting GV Keyboard E Map and Video Wall are included for backup Exporting System Configurations 1 On the GV Control Center s main window select System and select Export Data This dialog box appears Export Data Option Host List Virtual PTZ Setting Group List Geokeyboard Control Center Setting E Map Settings Live View Setting z Video Vall Cancel Figure 10 10 2 By default all the options are enabled Click an item to unselect 3 Click OK The login dialog box appears 4 Setup the hint optional and password and then click OK The Save As dialog box appears 5 Type the file name and click Save to start exporting Importing System Configurations You can restore the configurations or import the settings to another Control Center 1 On the GV Control Center s main window select System and select Import Data The Open dialog box appears 2 Browse a previously exported file and click Open The
45. options Snapshot Save the current panorama view as an image file Blending Make the two images smoothly blended together If this is not set there can be harsh edges in the panorama Refresh Rate When the panorama view is enabled the system load will increase Change the refresh rate for the panorama images to optimize system performance The refresh rate is from Speed 1 Slow to Speed 5 Fast 3 C GeoVision 3 4 VMD Monitoring With the VMD Video Motion Detection function the operator can be alerted with a pop up display of live videos when any of the following events occur Motion Temperature Alarm Input Trigger Crowd Detection Advanced Unattended Object Objection Advanced Scene Change Detection and Advanced Missing Object Detection Note The VMD feature does not support the third party IP cameras 3 4 1 Running VMD 1 Drag the desired cameras from the Host List and drop them to VMD Group in the Group List System View Service Help Apague JAR Group List x ld X ot oo 2 e YMD Group ah DVR_FAE Camera 1 ah DVR_FAE Camera 2 EH DYR_FAE Camera 3 h DVR_FAE Camera 4 ay DVR_FAE Camera 6 ah DVR_FAE Camera 10 L LO Panel Group E Map Group Qo Matrix 1 m New Group gtyHost List E Live View Status List ag Group List Figure 3 13 2 To select the event for a pop up alert right click the camera select Video Analysis and select
46. or later GPU Graphics Processing Unit decoding is added to lower the CPU loading and to increase the maximum frame rate GPU decoding is only supported by the following software and hardware specifications Software Specifications Windows 7 8 8 1 Server 2008 Windows 7 8 8 1 Server 2008 R2 Server 2012 R2 R2 Server 2012 R2 V3 1 1 or later V3 1 1 or later 4MP 2MP 1MP 2MP 3MP 4MP SMP H 264 H 264 Hardware Specifications Intel chipset with onboard VGA Ex Intel Q87 Q85 B85 287 H87 H81 Q77 Q75 277 Z175 H77 B75 Q67 H67 H61 Q65 B65 Z68 Express Chipset Note If you want to use an external VGA card it is required to connect a monitor to the onboard VGA to activate GPU decoding Vi Chapter 1 Introduction Control Center is a central monitoring station solution CMS that provides the CMS operator with these major features e Picture in Picture and Picture and Picture views See 3 2 PIP and PAP View e Panorama View See 3 3 Panorama View e Pop up video alerts upon motion detection input trigger critical temperature and many more See 3 4 VMD Monitoring e Instant Playback See 5 7 Instant Playback e Remote playback See 5 2 Remote Playback e Access to client DVRs See 6 7 Remote DVR e Access the desktop of a host GV System GV VMS and the operating system See 6 2 Remote Desktop e Central management for I O devices from different hosts See Chapter 7 I O Central Panel e Di
47. password request dialog box appears 180 10 System Configuration Type the password you set up in step 4 of Exporting System Configurations You will be prompted to confirm Click OK The Import Data dialog box appears Click to unselect the configurations for import and click OK The Control Center logs out automatically and starts importing the selected settings You will be requested to log in when the import is complete 181 Appendix A GV USB Dongle Upgrade Note the following requirements and limitations for the Control Center Dongle Requirements e An appropriate USB dongle of Black color is required e tis required to install drivers from the Software DVD for the GV USB Dongle to work e Installing the latest GV USB Dongle driver V1 2 1 0 will limit the total number of upgrade and downgrade of the dongle to 9 times e The GV USB Dongle can be upgraded to include more functions e Using more than one GV USB Dongle of different applications on the same computer is possible However Control Center and Center V2 cannot be run together e Two GV USB dongles with Control Center application is not possible on a single computer Upgrading the Black Dongle The Black Dongle can be upgraded to include more functions or enhance the system You need to collect the data from your dongle and send it back to GeoVision for an upgrade The upgrade is a charged service To upgrade your dongle follow these steps
48. sure the Video Wall server is connected to Control Center 2 On the Layout List select the server and click the Host Remote Control button amp amp No 2 Figure 8 18 If you have set up a password for remote access a password prompt appears For details see step 4 8 3 1 Configuring and Setting Up the Remote Server Remote Desktop Password Control Center Figure 8 40 118 8 Multi Monitors Applications 3 Type the password and click OK The desktop of the selected Video Wall server appears in a window You can control the desktop by using the control buttons on the window Figure 8 41 Window Start Opens the start menu of the remote desktop 1 2 Change Monitor Changes the display mode all Monitors or a single monitor only 3 Monitor Display Mode Shows the current display mode 4 Host Name Shows the name of the server 5 Host Resolution Shows the resolution of the server desktop 6 Server Desktop Shows the server desktop 119 8 3 10 Updating the Video Wall Server Version You can remotely update the version of Video Wall servers from Control Center server Note This function is only supported by V3 0 3 0 and above 1 On the Layout List Figure 8 18 right click a Video Wall server and select Update The update starts immediately and the Video Wall server is disconnected from Control Center The Video Wall Server icon E disappears from the system tray Layout List Be wR ar Disconnect
49. the types of events that have been configured for this camera at its host Note Motion Detection is selected by default 3 To open the VMD window click the VMD System icon ra When motion or event is detected within the camera view the live video will pop up on the VMD window 38 Live Video 3 4 2 The Controls on the Window Figure 3 14 1 Page Up amp Down Scrolls the page up and down 2 Refresh 3 Select Quad Show System Menu 5 Minimize 6 Exit 7 Pop up camera Refreshes the camera view The feature is unavailable when the Camera pops up in the user defined position option is enabled Figure 10 3 Sets the screen division Includes these settings e Image Quality Changes the display quality to Best Normal or Low e Host List Displays the hosts added to the VMD group in tree view e Pop up Viewer Displays a pop up event on another monitor See 3 4 5 Pop up Viewer on Another Monitor e System Configure Enables DirectX specifies the duration of pop up camera view after the motion stops when an input is detected or when a critical temperature is reached exceeded defines the critical temperature e Event Popup Changes the duration that a pop up view remains on the screen By default each popup remains for 60 seconds e Sound Scheme Changes the alarm sound for different events Minimizes the window in Windows taskbar Closes the window Right click the pop up camera to have these settings
50. will be reduced to 320 x 240 A panorama view has a resolution limit of 1920 x 1080 Once the limit is reached you cannot stitch more images to the created panorama view Using Images of the Same Resolution To stitch images of the same resolutions and with no overlapping into a panorama view follow the steps below 34 On the Panorama View Setup dialog box Figure 3 9 select Easy Mode Video source must be the same resolution Select one panorama set from the drop down list To rename the selected panorama set type the name in the field Live Video 3 Select a reference image k Panorama View Setup alel s ataa Panorama selection n Easy mode video source must he the same resolution Panorama 1 Source camera 2 Selected Source Figure 3 12 A Select one camera from the Source drop down list No 14 Figure 3 9 B Click the Add button No 1 Figure 3 9 This image appears in the Preview Window No 11 Figure 3 9 4 Select an image to be stitched to the reference image 4 Panorama View Setup ojaan s saa Panorama selection rr Easy mode Video source must he the same resolution Panorama 1 Source Selected Source Figure 3 13 A Select a camera from the Source drop down list No 14 Figure 3 9 B To place the image to the left or right of the reference image click the Left Right button No 6 Figure 3 9 To place the image to the top or bottom of t
51. your computer is equipped with enough VGA cards To set up multiple monitor positions and resolutions see 8 1 Application Position 2 The Matrix supports megapixel resolution only on a single screen Click the a button at left top corner of the single screen to display megapixel images 3 According to your screen divisions the Matrix will reduce the received resolution as close to the division size as possible For GV IP Devices the JPEG stream of 704 x 480 or smaller will be changed to the MPEG stream of the similar size the JPEG stream higher than 704 x 480 will remain as JPEG stream The mechanism is designed to reduce CPU usage and save bandwidth 83 8 2 2 Live View Enhancement Enhancing Live Images You can enhance the coloring to have more vivid and saturated images This function is enabled by default Click the Configure button No 5 Figure 8 5 select System Configure select Enable DirectDraw click OK and restart the Control Center program for the mode to take effect Adjusting Distorted Views Images may be curved especially near the corners To correct image distortions right click the channel you want to adjust for distortion and select Wide Angle Lens Settings The Wide Angle Dewarping Setting dialog appears For details see 3 7 4 Adjusting Distorted Views 84 8 Multi Monitors Applications 8 2 3 Two Way Audio The Two Way Audio feature allows the operator to speak to and listen from the selected host
52. 1500 GV BxX3400 GV CAW120 GV CB220 GV FD2410 GV FD320D FD321D GV FE2301 GV FE520 ele si a FE FE 3 BMAMIMAMAMANAMBEE F Eo beeen Bo bee 4 Figure 9 32 No Button Description 1 Activate Activates the Authentication Center service which will pass the access rights settings to the connected GV Control Center 2 Configure Configures the program startup layout and network settings For details see 9 4 5 System Settings 3 Search Host Searches the GV IP Devices under the same LAN with the Authentication Center 4 Batch Update Wizard Configures IP address device name and NAS storage for multiple GV IP Devices and displays storage space information J Host List Displays or closes the Host List 156 No 10 11 12 13 14 15 16 17 Button Group List Save Delete Add Host Host Settings Save Delete Rename Camera Information Move Up Move Down Access Rights FJ Other Applications Description Displays or closes the Group List Saves configurations made on the Host List Deletes a selected host Adds a host Displays host settings of the selected host Saves configurations made on the Group List Deletes a selected group Renames a selected group Shows the device model device name IP address and the live view of a selected camera under the Group List Moves the selected camera up on its group folder Moves the select
53. 168 4 31 192 168 0 69 192 168 1 251 192 168 2 12 192 168 2 245 192 168 2 17 192 168 0 84 192 168 0 103 MAC 0013E2023255 0013E20433B3 0013E200FC2D 0013E2024741 0013E2023C1C 0013E2FF0784 0013E2019B89 0013E20415F7 0013E2041783 0013E2034693 Rename New Setting Status Figure 9 20 2 Select a device to be configured from the Host Name column To select all the devices click Ml To uncheck all the devices click L 3 Type the new device name in the Rename column 4 Click Start to start updating When the update is completed the new name is shown in the New Setting column and the Status shows Success Upgrade device name ol Host Name C Gv VSO4H C Gv VSO4H 1 C Gv Lx4c3 C G BX120D 8X120D E C GY 8X320D 8X3200 E GV UBX3301 C DVR FE420 FE421 GV FE420 FE421 GV FES20 FES21 GV BX120D IP 192 168 3 83 192 168 0 137 192 168 4 31 192 168 0 69 192 168 1 251 192 168 2 12 192 168 2 245 192 168 2 17 192 168 0 84 192 168 0 103 MAC 0013E2023255 0013E2043383 0013E200FC2D 0013E2024741 0013E2023C1C O00 13E2FFO78A 0013E2019889 0013E 20415F7 0013E2041783 0013E2034693 New Setting Figure 9 21 Success Success Success Success FJ Other Applications 9 3 3 Configuring the NAS You can set GV IP Cameras and GV Target Cameras to record to NAS Network Attached Storage devices Note 1 For the NAS application it is required to use GV IP Cameras firmware V3 0 or lat
54. 2 14 28 12 Of14fe0l2 14 28 47 Ofi4fe0l2 14 28 53 O 14fe012 14 28 56 Of14f2012 14 31 31 Ofi4fe0l2 14 31 45 Of14fe0l2 14 32 05 Of14fe012 14 32 14 Gfi4fe0l2 14 35 07 Of14fe012 14 35 15 90 14 2017 15 49 48 Figure 7 8 Playing Back Trigger Events To play back host recordings click its associated input from the Advanced I O List and select Instant Play The Instant Playback window appears For details see 5 7 Instant Playback Alternatively you can select a specific trigger event for playback Right click the input icon from the Advanced I O List select Information select an event from the Trigger Time List Figure and select Instant Play Note To allow remote access from Control Center the following functions must be enabled ahead e DVR Enable recording and Remote ViewLog Service e GV IP Devices Enable recording and ViewLog Server 65 C GeoVision 7 5 Configuring the I O Central Panel On the panel toolbar click the Configure button No 1 Figure 7 2 and select Panel Setting This dialog box appears Panel Configuration General Notify Startup Show Duick Link Start Schedule Monitoring Layout Show Host Hame Use User defined Text Figure 7 9 Startup Show Quick Link Opens the Quick Link window at panel startup Start Schedule Monitoring Starts Mode Schedule at panel startup For details see Setting up Mode Schedule belo
55. 88 3759 g lasses NAS 9795 14991 g GV BX120D Bx120D E SD Card 347 1879 g GY FE420FE421 ID or password error g GY UBX3301 Figure 9 28 153 9 3 5 Updating Host Information You can update the information such as the port and the number of cameras input and output modules installed of multiple hosts Note This function is supported for all host types 1 On the Host List Figure 1 3 right click a group you want to update For example right click the DVR List and select Update DVR Information g ele DVR List J Add Group j Add Host DWR H Updating DYR Information Gl E i Al Host 4 TEST 249 PC vs E Figure 9 29 2 The Update Host Information window appears Update Host Information Please select the Hostis to update Host Mame IP Status mP Host 1 192 168 4 48 MP Host 2 192 164 4 48 TS PHost 3 192 169 0 214 MP Host 4 192 169 4 119 C W TEST249 PC 192 168 4 48 Update Information Figure 9 30 3 Select hosts and click the Update Information button to start updating 4 You will be prompted when the update is completed Click OK to finish GV Edge Recording Manager fx _ Finish update Figure 9 31 154 FJ Other Applications 9 4 Authentication Center Authentication Center is an account and access rights management system that provides centralized control over multiple GV Control Centers When a GV Control Center is logged in through an Authentication Ce
56. 9 Forcing Output To manually force an output click one output and select Force Output E Inthe Standard I O List you can force the output individually m Inthe Advanced I O List considering cascade triggers you can only manually force the output at the top level e g Figure 7 15 Outputs at sub levels cannot be forced manually e g Figure 7 16 However if the output is not in a cascading hierarchy you can definitely force it manually e g Figure 7 17 4 Elevators Entry 4 6 Toilet 1O Gs Input 2 Output 1 Output 2 Output 1 Output 3 Output 2 Output 3 Output4 Output 3 Output 4 Figure 7 15 Figure 7 16 Figure 7 17 71 C GeoVision 7 10 Editing Background Image With the Background Image feature you can import a floor plan to lay out the locations of triggered O devices This feature works in the Icon style of the Advanced I O List 1 To switch to the Icon style click the Advanced I O List Style button No 4 Figure 7 2 and then select Icon Select a group in the Advanced I O List The I O icons of this group will be displayed Right click on the right screen and select Background Image to import a graphic file Now you can freely drag the I O icons to the desired locations on the imported map oo as Oo To add images to another group repeat the steps 2 to 4 1 0 Central Panel TH a aaqa Mode Default a Adva
57. B dongle with Video Wall function needs to be inserted to the GV Control Center server for connection to the Video Wall server Follow the steps below to install the program and set up the Video Wall server 1 Insert the Software DVD to your computer where multiple monitors are established for Video Wall select Install GeoVision Paid Software and click Yes to accept the License Agreement 2 Click GV Video Wall Server and follow the on screen instructions 3 Point to Start and select the amp Video Wall Server to execute the service The Video Wall server icon is minimized in the system tray Video Wall server Figure 8 16 95 4 Right click the Video Wall server icon and select Configure This dialog box appears Location Name Office 1 Multiscreen Service RemoteDesktop Password E Autorun When Windows Starts Auto load the last status Service Port 5630 b Listen port a Monitor Origin Resolution Monitor 1 0 0 1920 x 1080 Monitor 2 1920 0 1920 x 1080 Monitor 3 1920 10 1920 x 108 4 mr j Figure 8 17 Location Name Displays the name of the local computer m Remote Desktop password Sets up a password for accessing the desktop of this Video Wall server from Control Center Auto run when Windows starts Starts the Video Wall service when the Windows Starts Auto start service when program starts up Starts the Video Wall service
58. C FAUNO The Vision of Security GV Control Center User s Manual V3 2 0 0 CCV32 A GeoVision 2014 GeoVision Inc All rights reserved Under the copyright laws this manual may not be copied in whole or in part without the written consent of GeoVision Every effort has been made to ensure that the information in this manual is accurate GeoVision Inc makes no expressed or implied warranty of any kind and assumes no responsibility for errors or omissions No liability is assumed for incidental or consequential damages arising from the use of the information or products contained herein Features and specifications are subject to change without notice GeoVision Inc 9F No 246 Sec 1 Neihu Rd Neihu District Taipei Taiwan Tel 886 2 8797 8377 Fax 886 2 8797 8335 http www geovision com tw Trademarks used in this manual GeoVision the GeoVision logo and GV series products are trademarks of GeoVision Inc Windows and Windows XP are registered trademarks of Microsoft Corporation December 2014 Content Namina and Denm onean a V E a OAA E EAE A A EAA V GPU Decoding Specifications cccccccceeeeeeeeeeeeeeeeeneeeeeeeeseeeseneeeneaeesenesenesenenenes vi Chapter Mme gg es ee gt meee eee eee NE Enri NEPE 1 1 1 Minimum System Requirement ccccccccssseeecssececseseeeceesseecseaseeessageeecseaseeessgeessneeessegeeeesees 2 Mee HOCUS ee cts ess ete s
59. Figure 3 9 and click the Add button No 1 Figure 3 9 3 Click Manual Setting No 3 Figure 3 9 This dialog box appears Source Reference Camera 5 Camera 4 Figure 3 10 4 From the Reference drop down list select one camera as the Reference image At this step the camera you selected at Step 2 will be the only Reference image 5 From the Source drop down list select one camera as the Source image to be stitched with the selected Reference image 33 C GeoVision 6 To stitch the two images together click on a significant point in the Reference image and then look for the same point in the Source image A dialog box of point selection will prompt you to confirm You need to set up 3 points for stitching Point 2 Point 3 Cancel Figure 3 11 Note For the best result position the points in the overlapping areas on both images Avoid placing the points in a cluster or lining them up straight The resulting image is displayed in the Preview window If satisfied with the result click OK to exit the setup dialog box If not re enter the 3 points for stitching If you want to stitch a third image or more click Manual Setting and repeat Steps 3 to 5 multiple times When you finish stitching images click the Save Before Exit button No 9 Figure 3 9 to save the created panorama view before exiting the Panorama View Setup dialog box Note The resolution of the images to be stitched
60. I O List right click one host and select I O Enable Setting This dialog box appears LO Activation ie TEST2 22 Module 1 l Input Pin 4 e CS es Reset Output Cancel Apply Figure 7 19 2 Check the Input Output to arm or uncheck the Input Output to disarm the device s Then click Apply to verify the changes 74 I O Central Panel 7 13 Popping Up Live Video upon Input Trigger You can be alerted by a pop up live video after an input device is triggered Up to 16 live videos can be accessed simultaneously 1 On the toolbar click the Configure button No 1 Figure 7 2 select Panel Setting and click the Notify tab This dialog box appears Panel Configuration General Notify W Enable digital input to invoke the associated camera f Multiple Window Mode Maximum number of invoked camera views YME Integration Mode Figure 7 20 2 Specify the Maximum Number of Invoked Camera Views that can pup up at the same time when inputs are triggered Note that the maximum number of pop up videos is 16 3 Select Enable digital input to invoke the associated camera to activate the function 4 To display pop up live view in separate window select Multiple Window Mode 5 To display pop live live view on the VMD window select VMD Integration Mode For this option you must also enable the VMD window by clicking VMD System icon No 18 Figure 1 2 19 a C GeoVision 6 To map
61. R Video Server IP Camera I O Box and Recording Server The Host Settings dialog box may look different among these devices The following steps are an example of adding an IP camera host 1 Host Settings Host Name Address On the Host List window click the Add Host button No 3 Figure 1 3 and select Add IP Camera This dialog box appears GV EBL2100 192 166 7 14 Use Remote Authentication Account Remember Account ID Password Command Port HTTP Fort Log Port Brand Model Stream Device Information Number of Cameras Number of Modules Module 1 i Number of Inputs Number of Outputs admin 10000 Defaut 80 Default Configure 5552 Defaut i Geovision GeoVision_GV EBL2100 Figure 2 1 Type the host name IP address login ID and password of the host Keep the communication port as default unless otherwise necessary Click the Update Information button to request the number of cameras I O modules and streams of the host When the update is complete the message Update system information successfully appears Optionally select Stream 1 or Stream 2 for live view display By default the Stream setting is Auto and the received streaming is based on the streaming setting of the connected IP camera Click OK to add the host PJ Getting Started Tip 1 To access the Web interface of the IP device click Configure on the Host Settings dialog box
62. SECT DOS Figure 6 3 Note The size of one single file for transfer cannot exceed 4 GB but there is no size limit for multiple files 56 6 Remote DVR Applications 6 3 Data Event Query on GV System GV VMS You can query events that occur at DVR hosts by defining search criteria The search results can be displayed in text or in chart You can also export your research results in the form of text html or excel Query Categoryies Search Criteria E Event Data Monitor Monitor E C Syst Event Type Device Information Note Date ystem C Login Camera 2 z DST Rollback 2011 06 1 4 00 00 01 C Counter 2011 06 1 4 23 59 5 POS i Chart Txt Export 1 Page 1 1 Total record s 3 Dype Davee oman Nolo Remnac TMe Meo a 70 Motion i sibs 2 12 34 PM 6 14 2011 2 13 13 PM 6 14 2011 2 54 36 PM 60 Motion amera Search Results Video Icon Playback Window Figure 6 4 1 Enable the WebCam Server e On GV System click the Network button J select WebCam Server and click OK e On GV VMS click Home cal click Toolbar XI click Network ea click WebCam Server and click OK 2 On the Control Center right click the desired DVR host on the host list select the Remote Control button No 6 Figure 1 3 and select Event Data Query The Event Data window appears 3 On the left panel select a query category and then click Submit Query at the bottom to display its search criteri
63. The Instant Play window appears AVI Player You can select the camera date and video events for playback Instant Play Event Only w Video Events a gt 13 36 10 14 33 44 14 42 43 7 14 46 13 SA 72012 14 46 15 488 ie Zis 01 27 o 15 02 55 15 15 32 b Move to prev 1 min Move to prev 5 min Playback scroll Move to next 5 min Move to next 1 min End Backward Forward Figure 5 1 For further playback features right click the Instant Play window Name Functions Includes these options e Frame by Frame Plays back video frame by frame e Real Time Plays back video on real time This mode saves waiting time for rendering but drop frames to give the appearance of Play Mode real time playback e Key frame Plays back the key frame of the video e Audio Turns the video sound on or off and reduce noise e Auto play next 5 minutes Plays back video up to 5 minutes 49 C GeoVision Name Render Tools Functions Includes these options Deinterlace Converts the interlaced video into non interlaced video Scaling Smoothens mosaic squares when enlarging a playback video and applies the colorful mode to enhance the coloring Deblocking Removes the block like artifacts from low quality and highly compressed video Defog Enhances image visibility Stabilizer Reduces camera shake Text overlay s camera name and time Overlays camera name and time onto the video
64. You can enhance the coloring to have more vivid and saturated images Click the System on the main window menu and select DirectDraw Configuration The Colorful dialog box appears Select Use Colorful Model click OK and restart the Control Center program for the mode to take effect i Colorful Direct Draw Scale Note The results of Coloful Mode can be afftected by the VGA card 1 Ifthe preview image cannot be displayed it indicates the VGAcard does not support DirectDraw E 2 The image may appear jagged if this option is enabled 3 Ifthe image quality remains the same itis not necessary to enable this option Figure 3 3 26 6 Live Video 3 1 4 Adjusting Distorted Views When viewing images through Single Live View Matrix View or Video Wall the images may be curved near the corners Use the Wide Angle Lens Dewarping feature to correct image distortion 1 On the live view select the Change Size button No 2 Figure 3 1 and select Wide Angle Settings The Wide Angle Dewarping Setting dialog box appears DYR 1 Camera 3 v Small Size 320 X 240 Actual Size Wide Angle Lens Dewarping Wide Angle Settings PIP View PAP View E a ty a CE oe AA L if l 1 ol 3 4 S be Figure 3 4 2 Move the slider at the bottom to correct the degree of warping The adjusted view is shown on the right Wide Angle Dewar ping Setting f E Peel a a
65. a Monitor events that are monitored System system activities Login user login logout status 57 C GeoVision S ee fs S 58 Counter counter events POS POS transaction events Define each search criteria such as Event Type Device Information Date etc The search criteria vary depending on the search category selected If you want to search the events recorded during the Daylight Saving Time period select DST Rollback and specify the time period in the Date column Click Submit Query The search results will be displayed in text form To graph the search results click the Chart button To play back any attached video click the Video icon EH To export the search results select the file type using the drop down list and click Export Chapter 7 I O Central Panel The I O Central Panel provides a centrally managing solution for I O devices from different hosts Its major features are e Group I O devices from different hosts e Trigger I O devices in cascade mode e Monitor different I O cascade configurations at different times of the day e Provide quick access to triggered I O devices by a Quick Link window Note 1 The Advanced I O Panel at the client DVR and the I O Central Panel at the Control Center can conflict each other Its recommended that the client DVR cleans up the settings in the Advanced I O Panel and renders the I O control to the Control Center 2 The I O Central Panel on
66. ail see 8 3 4 Activating the Channel and Layout 2 Enable the dewarpped views e For Single Live View select the Change Size button Figure 3 1 and then select Geo Fisheye e For Matrix display right click the fisheye channel on the Matrix window Figure 8 5 and then select Geo Fisheye e For Video Wall display right click the fisheye channel on the layout Figure 8 26 and then select Geo Fisheye The original hemispherical view is converted to 4 PTZ views the Quad View by default on the Matrix window or the Video Wall 3 To customize other settings right click the channel on the Single Live View Matrix or the Video Wall layout and select Fisheye Option to access the following Camera Modes You can choose among four view modes Geo Fisheye Quad view Composed of four PTZ views Geo Fisheye 360 degree Composed of two PTZ views and one 360 panoramic view Geo Fisheye Dual 180 degree Composed of two 180 views Geo Fisheye Single view Composed of one PTZ view Camera Position Select Ceiling Wall or Ground according to where the camera is mounted Adjust Auto Pan Speed At Top Left Channel Select low medium or high speed to enable Auto Pan for one PTZ view at the rotation speed of your choice This option applies to Quad view 360 degree and Single view Zoom Select Zoom In or Zoom Out and then click on the image Show Source Video At Top Right Channel You can display the circular source image i
67. ated groups alphabetically Note that when this function is enabled the Move up and Move down buttons will not be available for re arranging the order of the groups E Always On Top The Control Center window always stays on the top of other windows Control Center Style Sets the color theme for Control Center user interface 171 10 2 Network Settings To access this dialog box click the Configure button No 1 Figure 1 2 and select the Network tab i System Configure Network VMD System Video Wal For Searching DWA TCP IP Pott 5201 Multicast Port 5200 For Searching IP Device Bind IP 1927 168 5 23 E Assign IP Marvell Yukon 88E8001 2003 2010 PCI Gigabit Ethemet Controller Figure 10 2 This dialog box displays the related ports for DVR and IP devices To use the Search Host function No 3 Figure 1 2 it is required to open TCP port 5201 on the client DVR TCP port 5202 on the GV IP Devices and UDP port 5200 on the Control Center 172 10 System Configuration 10 3 VMD System Settings To access this dialog box click the Configure button No 1 Figure 1 2 and select the VMD System tab i System Configure i car Video Wall Position 1 Monitor 1 1024x768 3 Option E Camera pops up in the user defined position Note Any changes to the YMD system setting will take effect the next time you start the system Figure 10 3 Position Sets up to two monitors to displ
68. ation using the drop down list You can set different icons for an event and no event situation In this example Icon1 appears on the E Map when no event occurs and when an event occurs the icon changes to the default one Change Icon peeve east event east southeast event southeast gi a event south southwest event southwest northwest event northwest g event input output lcon Type No Event IPCam jpg E Event Default Icon Figure 9 5 133 6 134 To change the icons for I O devices right click any I O device icon on the map and select Change Icon The following window appears Change Icon lcon Type Preview No Event Default Icon E Event Default Icon Figure 9 6 Click No Event and select an icon to display when the I O device is not triggered Click Event to select an icon to display when the I O device is triggered You can use your own icon by clicking Add Icon Click File in the window menu and select Save to Control Center or Save to File to save the created E Map file FJ Other Applications 9 1 3 E Map Alerts You can monitor and set up alerts on E Maps When motion or input trigger is detected on the subscriber the camera or input icon on the E Map will be enclosed with a blinking frame to indicate an event You can also click the camera icon to watch its live view For this application to work subscribers must have e installed and enabled related I O se
69. ay the VMD windows Option When the Camera pops up in the user defined position option is enabled the position of pop up camera on the VMD window is based on the camera sequence in the VMD Group e g if camera is listed as the third camera in the VMD Group camera will pop up on the third square on the VMD window the order of pop up cameras is from left to right When this option is disabled the poison of pop up camera is based on the order of motions detected 173 10 4 Remote Desktop Settings To access this dialog box click the Configure button No 1 Figure 1 2 and select the Remote Desktop tab ip System Configure VMD System Remote Desktop Video Wall Connection Speed Modem 56 Kbps p Figure 10 4 Connection Speed Select the Internet connection speed to suit you needs Modem 56 Kbps Broadband 128 Kbps 1 5 Mbps or LAN 10 Mbps or higher 174 10 System Configuration 10 5 Video Wall Settings To access this dialog box click the Configure button No 1 Figure 1 2 and select the Video Wall tab i System Configure VMD System Video Wal Caption ID Host Name Camera Name E Shut down the Video Wall Server when the Control Center is closed Show Style Tile Web Window Homepage http Awww geovision com tw Figure 10 5 Caption ID Shows the ordinal number of the channel being added to the layout Host Name Shows the host name of the channel Camera Name
70. ays Note For monitor resolution of 1280 x 1024 and above up to 42 pop up views can be displayed on a VMD window For monitor resolution lower than 1280 x 1024 up to 36 pop up views can be displayed on a VMD window To set two monitors to display the VMD windows 1 On the main window select System select Configure and click the VMD System tab i System Configure VMD System Fosition Monitor 1 19201080 Monitor 2 1920x1080 Option Camera pops up in the user defined position Note Any changes to the VMD system setting will take effect the next time you start the system Figure 3 16 2 Inthe Position section select the monitor to be the first VMD window Monitor 1 and the second Vital Sign Monitor window Monitor 2 Click OK 3 To open the VMD window click the VMD System button on the Group List 4 To set the screen division for both Monitor 1 and Monitor 2 click the Select Quad button on the VMD window and select a screen division Monitor 1 4 Channel Monitor 2 9 Channel 16 Channel 36 Channel Figure 3 17 41 C GeoVision si When the first monitor is full of the pop up camera view the next pop up camera view will go to the second monitor Applications of two VMD windows The position of pop up cameras on the VMD windows varies when you enable or disable the Camera pops up in the user defined position option in Figure 10 3 42
71. box right click the image select Mega Pixel Setting and click Set Color of Focus Area To hide the navigation box on the image right click the image select Mega Pixel Setting and click Display Focus Area of PAP Mode To delete a navigation box right click the desired box select Focus Area of PAP Mode and select Delete To add another navigation box when less than seven navigation boxes are drawn right click the image select Mega Pixel Setting and then select Enable Add Focus Area Mode To exit the PAP view click PAP view again Live Video 3 3 Panorama View Spliced from multiple camera images a panorama view provides a continuous scene for live monitoring Each camera selected for the panorama view will keep the recording in original format Up to 4 sets of panorama views can be created To access this feature on the Group List right click the desired group and select Panorama Setting The CMS Panorama program is enabled and minimized to the system tray The following Panorama Setup dialog box also appears ya C 10 11 D E i Panorama View Setup Panorama selection Source Host 3 Camera 2 Figure 3 9 31 C GeoVision The controls on the Panorama View Setup dialog box No Name 1 Add 2 Undo 3 Manual Setting 4 Blending 5 Demo 6 Left right location 7 Top Bottom 8 Customize resolution 9 Save Before Exit 10 Exit 11 Preview Window 12 Easy Mode 13 Panorama Selection
72. ck the Configure button No 1 Figure 1 2 and select the General tab i System Configure E Minimize when startup E 0 Central Panel E Matrix E Remote E Map E VMD System E Authentication Server User ID F Keep Last Live View Status Layout E Display host name in the Group List E Sort the Group List by names E Always On Top Control Center Style Blue Style Figure 10 1 Startup E Autorun When Windows Starts Automatically runs the Control Center at Windows startup E Minimize when startup Automatically minimizes the Control Center toolbar to the taskbar when the Control Center is started E O Central Panel Automatically runs the I O Central Panel at Windows startup E Matrix Automatically displays up to 8 Matrix Views at Control Center startup Click the Matrix Setting button to specify the display order E Remote E Map Automatically runs the Remote E Map at Windows startup VMD System Automatically runs the VMD function at Windows startup Authentication Server ID Automatically connects to the Authentication Server Type the authorized ID and password of the Authentication Server Click the User ID Setting button to modify 170 10 System Configuration Layout E Display host name in the Group List Displays the individual camera s host name on the Group List E Sort the Group List by names Automatically arranges the cre
73. ct PIP View an inset window of the camera view with a navigation box appears in the image gi a ee ra Pe a my r _ GEES R EET i z AT a A FA VA a a J E Ta iiwas i i E ie k 1h Ean e coy ae amp LAS i Ta Ey Figure 3 7 Point the cursor to the inset window A hand icon appears You can drag the inset window to the desired area on the image Point the cursor to the navigation box A star icon appears You can move the navigation box around in the inset window to have a close up view of the selected area To adjust the navigation box size move the cursor to any of the box corners enlarge or diminish the box To change the frame color of the navigation box right click the image select Mega Pixel Setting and select Set Color of Focus Area To exit the PIP view click PIP View again 29 C GeoVision 3 2 2 Starting PAP View To start the PAP View follow the instructions below 30 After you select PAP View a row of three inset windows appears on the bottom of the screen Figure 3 8 Draw a navigation box on the image and this selected area is immediately reflected in one inset window Up to 7 navigation boxes can be drawn on the image To adjust a navigation box size move the cursor to any of the box corners enlarge or diminish the box To move a navigation box to another area on the image drag it to that area To change the frame color of the navigation
74. dinadteianiuunnicietuendadanousion 81 8 2 2 Live View Enhancement n ennennnssnnernnsrsrnsrrssrrrsrrrnsrrosrrnsrresrrernrrnsrrosrrennnrnsnresrrnsrreernne 84 8 23 PWO WAY AUdIO resnie sinan eoa Er AEE ERE E E EEEE EE EEE E 85 oLA INSAN AYO AG IG erknire n Ene EEE EE EE ENE a 86 8 2 5 Channel Display on Another MOnitor ccccccccccccseeeeeeeeeeeeeeeeeeeeeeeeeeeaeeeeesaeeeeeeaeeeeeesaees 87 O UCE ZOON asa errs cee set estate ote sacs E E E E added 88 8 2 7 Configuring the Matrix POSItION cccccccccceeeceeceeeeeeeaeeeeeseeeeeeseeeeesaeeeeesaeeeeeesseeeeseeeeeeaas 89 oa 6 i POS EVE VION See ee E eee enn ree ne ner eee ere eee 90 929 Advanced SONGS aeee degen eor cies ace densa sense EEEE A 91 Bo Video WNA E e E E N EE E EE E E TEE E 93 8 3 1 Setting Up a Video Wall Server cc ccccccssecccceeseeeceeeseeeceeseeeceaeeeeeeseeessageesssegseesseaseeess 95 Gae Te LVU LS ree N e E E E 98 8 3 3 Adding a Server and Configuring the Layout ccccccecseeeeeeeeeeeeesaeeseeseeeeeesseeeeeesaeeeeeeas 99 8 3 4 Activating the Channel and Layout ccccccccccseececeeeeeeeeeeeeeeeeeeeeseeeeeesaeeeeeseeeeeseeeeneas 104 8 3 5 Setting Upa ZOOM WInNdOW srsrsiss a AE EAE 105 8 3 6 Setting Up a Scan WINKOW cccccccccsssceccesececsesseeccaaeeecsaeeecseseeecueeeesegseesssaseesssageees 107 8 3 7 Displaying Remote Monitor Web Page and Playing Back VIdGEOS ccccseeeeeeeeeeeees 110 8 3 8 Displayin
75. ds a layout for Video Wall 6 Delete the Selected Layout Deletes the highlighted layout 7 Rename the Selected Layout Renames the selected layout 8 Apply the Selected Layout Applies the selected layout 9 Deactivate Layout Disables the applied layout 1 O Server and Layout tree view Displays remote servers and layouts 98 8 Multi Monitors Applications 8 3 3 Adding a Server and Configuring the Layout Follow the steps below to add the Video Wall server you have set up and configure its layout on the Control Center server 1 From the Control Center s main window click the Layout List button No 9 Figure 1 2 on the toolbar 2 On the Layout List window click the Add Host 4 button This dialog box appears Connect to Server IP Address Figure 8 19 3 Type the IP Address of the remote server and click OK The remote server is displayed Layout List AR St a paN WE Office1 Figure 8 20 Tip Alternatively press F8 or click the Search Server button No 5 Figure 1 2 to search for available servers on the same LAN IP Port Name 192 168 0 171 5630 Control Center 1 C 192 168 0 38 5631 TEST232 Search Port m Figure 8 21 99 4 Click the Add new layout button 4 to create a new layout This dialog box appears Add new Layout Layout Name C Inherit from other layout 1 Figure 8 22 5 Name the layout and click OK The monitors are displayed In t
76. e Le nombre maximal de zones de d tection mouvement 4 Save Cancel Figure 9 14 Note 1 The search is case sensitive 2 Before making any revision click Tools and select Revision Note to read the revision instructions 5 Double click the text you want to revise This dialog box appears Sizes rin Define the maximun and minimum size of objects For motion detection E Figure 9 15 6 Revise the translated text and click OK Tip The text may contain symbols such as d or n that instruct the application to perform certain functions Be careful not to change the symbols in the translated text 142 FJ Other Applications Applying the revised text 1 To apply the revised translation to the applications click Save For the following applications the system will automatically locate the corresponding files on your computer and replace with the revised translation e GV Control Center V3 0 or later e GV Video Wall Server V3 0 or later e GV System GV VMS e Remote ViewLog e GV IP Device Utility e Multi View e Remote E Map e Center V2 e Vital Sign Monitor e Dispatch Server e GV GIS e MCamCtrl Utility e POS Text Sender e Authentication Server e SMS Server e Audio Broadcast e Multicast e TwinDVR System e Bandwidth Control Client Site e Backup Viewer e Mobile Server 2 After applying the revision a dialog box appears to show which applications have been revised Click OK Updated
77. e host and select Add to Broadcast Service or drag the desired hosts from the Host List to the Audio Broadcast window Tip To add hosts by dragging click the Setup button and select Always on top to keep the Audio Broadcast window to be on top of other windows 3 You can mark or unmark the hosts on the Audio Broadcast window to enable or disable audio broadcasting to them 4 To start audio broadcasting to the hosts click the Start Stop Broadcasting button on the Audio Broadcast window and talk to the microphone connected to the computer of Control Center 46 4 Audio Communication 4 2 2 The Audio Broadcast Window Host Mame IF Status S Host 1 192 168 2 58 On 4 A Host Geo 192 168 3111 On F S Host meg 1 192 168 3 15 CIF Figure 4 4 The controls on the Audio Broadcast window No Name Description 1 Host Name Displays the host name 2 IP Displays the host IP address 3 Status Displays the connection status of the host 4 Change Style Minimizes or enlarges the Audio Broadcast window 5 Close Closes the Audio Broadcast window Always on top Always displays the Audio Broadcast window on top of the screen 6 Setup Opacity Select the opacity level for the Audio Broadcast window The value can range from 20 fully transparent to 100 fully opaque Start Stop T Starts or stops audio broadcasting Broadcasting Click the button and drag the Audio Broadcast window to the desired 8 Dragging Area Di
78. e view point preset point automatically appears under Preset ID Guard Tour Setting Enable Sel Current Preset E Available Preset Setting Preset ID Dwell Time Guard Tour Setup ID Dwell Time View Order Delete Item Figure 8 47 3 Specify the duration for the live view to stay on this preset point dwell time The default setting is 10 seconds 4 Optionally click Preview to see a preview of the preset point 125 5 126 Click Apply This point is added to Guard Tour Setup Guard Tour Setting Enable Set Current Preset Mame Home Available Preset Setting Preset ID Dwell Time Guard Tour Setup view Order Delete Item Figure 8 48 8 Multi Monitors Applications 6 To add more preset points follow steps 1 to 6 In this example three preset points Home Gate and Desk are established Guard Tour Setting Enable Set Current Preset Available Preset Setting Preset ID Dwell Time Guard Tour Setup Dwell Time View Order Delete Item Figure 8 49 To change the order of the preset points select a preset point from the ID column and select a number from the View Order drop down list 8 Optionally click Demo to watch a preview of the PTZ tour Select Enable to start the PTZ tour To stop the PTZ tour disable this function on the Guard Tour Setting 127 Chapter9 Other Applications 9 1 Remote E Map The Remote E Map is a
79. ecs sxeciaccaxceanscxaciactensensseccesacnntaneskaawexteonsSansskangah oncaaGanestandsanasiecsanseconeceearnse 29 PAn ARNO PARF VEW ce e E e ET 30 Ia PAOA WCW eaa EEE E EE E 31 3 0 1 Creating aPanorama ViICW sn iiiecvsiausdanensidesinssedb usactatadiseqeidarendaksecneadhdecvsdantfesecavedpedaaceetel 33 3 3 2 ACCESSING a Panorama VICW ccccccccssscccessceceeeeceseceneuececeuecesaseeeeaseeesaeeesaeeessueteneuesenaes 37 3 3 3 Panorama View Controls cccccccsssceccessecceeeseeccsseeecsegseecseueeecsaseeessageeessagseesssaseeessageeees 37 3 YMB MONLO oera E E 38 Se RUANIN VME ipee E A E E E E E A ES 38 3 4 2 The Controls on the WindOW cccccccseeececeeeeeeeseeeeeesaeeeesseeeeesseeeeeeseeseeeseeeeeeeseeeeesaeseeeeas 39 34 OTIS Fat INC Al gees etc ae eccceeoee sede sets E Er aR RES 40 s44 Du uakMonkor DISDA y ssassn ranp EE EE AE ES PATE AEAEE 41 3 4 5 Pop up Viewer on Another MOnitor ccccccccccccsececeeeeceeeeseeeeseeeseueeseeseeeeseeeeseeeeseeeseeeees 43 Chapter 4 Audio Communication ccecceeeeeeeeeeeeneeeeceeseneeeeseneoneeeesoneeeesensones 44 AT Audo ONC AN OM eese e E eaea EE eea 44 de AERO S e E E E E E E E AES 46 4 2 1 Starting the Audio Broadcast cccccecccccseeeeeeeeeeeeeeeeeeesaeeeeesaeeeeeeseaeeeesaaeeesseeeeesaeeeeesaess 46 4 2 2 The Audio Broadcast Window cccccccccseeceeeeeeeceeeeeceeeeeseeeeseeeesseueesaeeeeseeeeseeeeessueeesanees 47 Jp rhe i es Mg er
80. ed camera down on its group folder Displays the access right of each user type by group 157 9 4 3 Setting Up the Authentication Center Follow the steps below to configure and activate the Authentication Center Note If you have configured the Authentication Center with any GV Control Center connected restart and reconnect the GV Control Center for the settings to take effect 1 To launch the program go to Windows Start click Programs select AuthCenter click AuthCenter and type the username and password to log in By default the username is admin and no password is required The main window appears For an overview of the main window see 9 4 2 The Authentication Center Window 2 Configure the account and access rights A On the main window click System and select Account Setup This window appears By default an administrator account admin is created with no password Optionally click Change Password to set up a password for the admin account Account Management admin Ga Administrator PE Rename Poweruser Change Password n User E Disable Account E Login this ID automaticaly Account Management System Configure Figure 9 33 158 FJ Other Applications B Click 7 to add accounts and configure the access rights using the General and Application tabs For details see 10 7 Account Management In this example a user account Security Room is added with access to certain functions only
81. ein epee we tales aed cg ee ain sects ec tet sete A en eased 4 Eo OVS tec as ts lc an crt tial cnet setae db ssa noe cela ase Senin ed eae ieee 5 1 3 1 The Control Center Main Window cccccccccccseeeeeeseeeeeeseeeeeesaeeeeesseeeeessaueeesaaeeesaeneeeeneess 5 Mee TAS TOOD aE E E E piettttlpieiyerhitcnaaleiumlotatetanendnates 6 Wie TheFog E er E E EEE 8 VO The Group iSi cers iana E E EE EAEE EE aeevexeesenier 9 Chapter 2 Getiing Staried e nnr na eee eee eee 10 ZN MAO eE E E E E A E EE E E 10 PAF E a e E OS E E A TE O EA ETE E E A T A T 11 22 1 Creating a Hos Ue suas tects xe ntact R E a a 12 22 2 Creating OUD ahi sees sense E aE ENEE settee EEEE EE 14 2 3 Connecing to Control Cente sence en ea a anere 15 2 3 1 The Control Center Server WiINKOW c cccccccsseeccceeececceeeeecseeeeeeeueeecseaeseesseeeessageessaaes 16 23 2 Advanced SCUINGS sssi a EA EEE A 18 Chapter 3 Live Vid O sisisororisininnsinss ni a 20 S LENTON a E E E E E E E E 20 3 1 1 Displaying Single Live VIEW siciascscicsiescesdveds cade ciedsweddadesuedsndbecesdadazeadddudactudaadiesedsedicacdidedesaeos 20 3 1 2 Displaying MUN VIEWS eee isto catisiciiin sertarssincsitiaivaie EE a EAA AAE EAEE 23 Salad Enhancing Live VideO sissriessneiiini n EE EE EEEE NEEE EE 26 3 14 Ad sing Distorted VIEWS essiri oe nea e eE EEE AEO ENRERE EAEE Ean 27 32 PIP and PAP WCW cee arson ces tectee scarce desppaddetennens ho etpnnaeanadne aiia a aa raii 28 321 Staring PIP VIEW sic
82. enabled from Remote E Map 1 Make sure you have selected the Video Wall option for Remote E Map s view type For details see step 4 in 8 7 Application Position 2 Adjust the E Map channel size and position on the Video Wall See step 6 in 8 3 3 Adding a Server and Configuring the Layout Office 1 Layouti x 0 0 426 341 425 2 425 336 852 0 426 341 Total 7 288 001 002 003 Corridor Gate Section Camera Camera Camera 0 341 426 341 425 339 425 339 848 336 428 342 004 Remote E Map Zoom Window 0 Host 1 Gate Camera Camera 2 A aaa annA ase casa ramannnan A 2 Scan Window 0 Remote FMD annem Zoom Window 0 g 001 Corridor Camera 4 003 Section 4 Camera BBP 004 Host 1 Camera 2 OOS Host 1 Camera 3 006 Host 1 Camera 5 007 Host 1 Camera 6 a lt Figure 8 39 3 Right click the E Map channel to access more settings See step 8 in 8 3 3 Adding a Server and Configuring the Layout Tip You can have 1 4 9 or 16 divisions within the Remote E Map channel 4 When the layout is activated live views from E Map will be displayed on the Video Wall 117 8 3 9 Remotely Accessing the Video Wall Server You can remotely access the any connected Video Wall server and its operating system from Control Center Note You can access the desktop of one Video Wall server at a time Any newly opened desktop window will replace the previous one 1 Make
83. ently displayed on the Live View window Enables monitoring of all the live views Disenables monitoring of all the live views The monitoring status is indicated by the color of the device name bar For GV System GV VMS GV Recording Server hosts V1 25 or later e Red The channel is being monitored e Yellow The channel is not monitored nor recorded For GV IP Device hosts e Green The channel is being monitored but not recorded e Red The channel is being monitored and recorded e Yellow The channel is not monitored nor recorded EJ Live Video Right click the live view to access the following features No Name 1 Snapshot 2 Advanced Control 3 PIZ Instant Play 5 min 5 Show Position 6 Zoom Wide Angle Lens Dewarping Wide Angle Lens Setting Description Snapshots and saves the live view Displays the live view in a separate window For detail see 3 7 7 Displaying Single Live View Enables the PTZ function Note this function is only supported by IP Cameras that support the PTZ function Plays back the recordings of the last 5 minutes Locates the current host camera on the Host List by highlight Displays and extends the current live view to the full Live View window Corrects image distortion See 3 1 4 Adjusting Distorted Views Sets the degree of dewarping to adjust image distortion See 3 1 4 Adjusting Distorted Views 25 C GeoVision 3 1 3 Enhancing Live Video
84. er and GV Target Cameras firmware V1 02 or later 2 For system performance and compatibility it is highly recommended to use GV NAS Systems for recording 3 Make sure the computer installed with GV Control Center is under the same LAN with the NAS devices Assigning NAS Storage for Recording Note For system performance and compatibility it is highly recommended to use GV NAS systems for recording 1 On the main screen click the Batch Update Wizard button 4 and select NAS Setup The cameras that support NAS devices appear in the NAS Setup window IO Host Name Ip MAC Firmware Version C G BxX120D 192 168 0 103 0013E2034693 v2 04 2012 12 09 C G UBX3301 192 168 2 12 O0013E2FFO784 v2 05 2012 12 26 Figure 9 22 149 2 Select cameras for NAS management and click Start This window appears 3 Click the Search all available network hosts A button to detect the NAS installed under the LAN The detected network hosts are listed 111 PC A ID Password Storage Path Free Space Total Space MB Status W 124 Pc O f GV FD3200 o 0 ox WE 278 Pc O av vexiz01 1 o D my RB a coraceseacocs R I assy U ap caTHy U AD0ISON WIN7 U ao Joyce a I aex I ALEX _DESKTOP I aLrResco U ALLAN XP E ALLEN U ALLEN 885M D3V U AMANDA UBUNTU U ANOREW NB U ANDYCHEN TESTPC UE anoycHen valo I anovun a l INREY Dr Figure 9 23 4 Select a NAS from the list and click the Sea
85. es Configures various cascade modes Displays connected I O modules Groups I O devices in cascade mode I O Central Panel 7 3 Creating a Group for Cascade Triggers You can group I O devices by function or geography Further the group allows cascade triggers meaning that the trigger actions of one trigger can activate another trigger For this example you might have a group called Entrance that contains all I O devices installed at entrances The Entrance group might contain other sub groups each of which contains just the related I O devices in various geographic locations Group containing all I O devices installed at entrances Input 2 installed at the front entrance Output 1 sub group at the kitchen Be Tre 2 e Output 1 l Output 2 r Output 3 Output 3 sub group at the garage Figure 7 3 When Input 2 is triggered it will trigger Output 1 and Output 3 sub groups and Output 1 will trigger Output 2 in a cascade series 7 3 1 Creating a Group 1 Right click on Advanced I O List No 9 Figure 7 2 and then select Add A Group This dialog box appears Group Information Group Mame Hallway seine Motity N ome Al Figure 7 4 Group Name Names the group Group Notify Setting m Invoke Alarm Invokes the computer alarm on I O trigger Select a sound from the drop down list 2 Click Save to apply the settings and return to the panel 3 To create a cascading
86. ew account button at the bottom and select Add Administrator Add PowerUser or Add User In this example we add an administrator account To rename the account click on the account name Account Management admin 1 Rename Change Password Disable Account Login this ID automatically Account Management General Application Video Wall System Configure Import Data Export Data Host List Add Host Delete Host Host Settings Delete Group Rename Group Add Group aj ol Figure 10 8 4 To seta password click Change Password on the right This dialog box appears Change Password Old Password New Password Confirmation Hint Figure 10 9 A Type a password in the New Password and Confirmation field B Optionally set up a password hint in the Hint field This hint appears if you click the Forgot Password button on the Control Center User Login dialog box C Click OK to save 5 You can also configure the following settings for the selected account E Rename Click to rename the selected account E Change Password Click to set up or change the password E Disable Account Click to disable the account 178 10 System Configuration E Login this ID automatically Log in the account without password verification when the GV Control Center is activated E Account Management Select to allow the account to access the Account Management dialog box Figure 10 8 and hence the configuration
87. for connection Motion I O Input Alert Sound Select this option and assign a wav file to alert the operator when motion is detected or input devices are triggered Camera Blink I O Blink When cameras or input devices are triggered their icons on the E map flash EMap Auto Popup When cameras or input devices are triggered the related map will be displayed on the Remote E Map window instantly Show Event Select this option to display motion or input triggered events on the Host Information window 139 Hide Tree List Select this option to hide the tree list Enable DirectDraw The DirectDraw is enabled by default Some VGA cards might not support DirectDraw and can produce distorted frames In this case disable the feature Use small icon The Remote E Map uses the large icons of cameras and I O devices by default Select this option if you want to use small icons 140 FJ Other Applications 9 2 MultiLang Tool for Translated Text The user interface has been translated from English into 30 other languages If you find the translation to be unsuitable and would like to correct it you can use the MultiLang Tool to revise the translation Next you can apply the revised text to the applications and export an exe file to make the same revision on another computer You can also send the revision back to GeoVision to have the revision included in future software releases Note When using the MultiLa
88. g Live View from Remote E Map ccccceccceeseeeeeeeeeeeeeeeeeeeeeseeeeeseeeeeseeeeeens 117 8 3 9 Remotely Accessing the Video Wall Server cccccecccecseeeeeeeeeeeeesaeeeeeeeeeeeeesaeeeseeeeeeeas 118 8 3 10 Updating the Video Wall Server Version cccccccseeceeeaeeeeeseeeeeeseeeeeesaeeeeeeseeeeeesaeeeeas 120 od ASI O VEN eop E E EE bbe indented E E 121 Skl AURA TA TOU e e D E E EE 124 Chapter 9 Other Applications cccccccecceeeeeeeeeeeeseneeneeeeeoneeeeseneenesensoneseesenees 128 LTE ROOSTE I o ee E E E E E E 128 91 1 The E Map Editor WINGOW seecssrenper ie endien inia aE ake ieeiededoeenttesdoedeakelenesees 130 ts Creating an A einaste E EEE 131 DTS IPOS eraren A E AE EE AEREE 135 9 1 4 Setting the Polygonal Area cccccccccssscccceeseecsesseeecsegeeeceeeeeceeseeessgeeessageeesegseesseaseeenas 136 9 1 5 Setting up the View Zone nonannnsenennsnnnenernrornnnrosnrornrrerennrornnrersnnrernrrerennrrnnnerennrernnnenee 137 916 The E Map WING OW sssiipisueiisirp nienn np aia A E EE ENR 138 9 1 7 Configuring the Remote E Map cccccsssecccesseeecceeeeecceeseecseueesseaseeecsagseessecseesssagenes 139 9 2 MultiLang Tool for Translated Text 00nnnnnnnnnannnnnnnnnnennnnnnnnnnrnrnnsrnrrnsnrnesnrrnsnrnrsnnrrnsnrrrsrnrrenne 141 Jo ELC IC UO ri E E acta 145 9 3 1 Configuring the IP ACCIreSs ccccccesscecsssececeeeseeceeaseeeceauseeceeeeessaseeeesausessesaseesssa
89. geess 146 9 32 Renaming DEVICES ssie a EE AEE E EE ARA EE ER 148 O23 COMMUTING MENAS serierna n EEEO ARE 149 9 3 4 Viewing the Storage INfOrmatiOn cccccssecccssseeecceeseeeceeseeeceeseecseseeecseuseesssaseesssageees 153 930 Updating HOST InionmatlON sissi Ei 154 9 4 Authentication Center taticssiccsewcetleresteosiysstsciasncrusiesuecseianactepiinr canacuveeiteddeiasuseeueraesedaaescaels 155 9 4 1 Installing the Authentication Center 0 0 0 ccccccccceeeceeceeeeeeeeeeeeeseeeeeeseeeseeeseaeeeessaeeeeenaneees 155 9 4 2 The Authentication Center WINndoOW ccccccccccseeeeeceeeeeeseeeseeeeeeeeeeesaeeeeseeeeesaeeeesaaesees 156 9 4 3 Setting Up the Authentication Center 0 0 0 0 ccccccecccccseeeeeeeeeeeeseeeeeeeseeeeesaeeeeeeseeeeeesaeeeeeas 158 9 4 4 Logging In the GV Control Center 0 0 0 ccccccccceceeeeeeeceeeeeeeeeeeeeseeeeeeeseeeeeeseaeeeesseneeesaaneees 162 945 System oe WNS serena aana EA Ea ORN in 164 AG ACK US WNS epei see cases ace E E E E 167 Chapter 10 System Configuration cccccceseeeeeeeeeeeeeeeeeeeeeeeeseeesenssneaeneaeeees 169 10 1 General SNC Saar ater en rte erecta eee aetna ala nE N E E EE 170 1O INGTON STING een EEE EE E EN 172 103 VMD System SC THING S espinaka a a EEE a ESEE 173 10 4 Remote Desktop Settings cccccccccssscecceesseecceseeecsaseeceeseecceuseesceageeecsageeesseuseeessaseeessagsees 174 10 5 Video Wall Settings suriirnresiasin ani E iE REEE EANN 175 10 6 Authe
90. gs Host Mame Room 1 Address 192 169 35 2098 Password 56 82 Data Port 5632 Default Number of Cameras Update Information Cancel Figure 8 31 E Password sets a password requirement for any remote access of this server If the remote server contains more than one monitor select a monitor using the drop down list under Set Viewing Range To define the display area select Setup and draw a square on the monitor These options appear m Save Saves the selected display area E Abort Gives up the configuration E Full Screen Sets the display area to full screen After you have defined the display area click Save to store the configuration Right click the RDS icon and select Start Service 111 3 Add and connect the Remote Desktop server to Control Center A On the Control Center s toolbar click the Search Server button No 8 Figure 1 2 The Remote Desktop servers under the same LAN with Control Center are searched Search Server 192 165 56 41 GEOVTSIO S0B2D Search Port 615 Default Search again l Figure 8 32 B Select a server and click Connect The remote server and the installed monitors are shown in the Host List and connected to Control Center In this example the remote server contains one monitor Host List Recording Server List alg Remote Desktop Service E eal GEOVISIO a0R2D Monitor 1 l Host List by ID Figure 8 33 Tip Alternatively you can add
91. he reference image click the Top Bottom button No 7 Figure 3 9 C Click the Add button No 1 Figure 3 9 The Left or right Top or bottom location dialog box appears 35 C GeoVision D Select Left or Right Top or Bottom to add the image 5 To add another image repeat step 4 Note You will only be able to add cameras next to the last camera view added For example when adding a third camera you can only use the direction buttons Si Pal in relation to the second camera You will not be able to go back and select the first camera 6 To specify the width and height of the panorama view click the Customize Resolution button No 8 Figure 3 9 select Enable and type the Width and Height in pixels Customize resolution if Enable Width Height 800 500 oane Figure 3 14 7 When you finish stitching images click the Save Before Exit button No 9 Figure 3 9 to save the created panorama view before exiting the Panorama View Setup dialog box 36 Live Video 3 3 2 Accessing a Panorama View There are two ways to access a panorama view e Right click the Group that has set a Panorama view select Panorama View and select the desired panorama set from the list e Right click the CMS Panorama icon on the system tray select Panorama View and select the desired panorama set from the list 3 3 3 Panorama View Controls Panorama 3 Figure 3 12 Right click the panorama view to have these
92. his example the remote server contains 6 monitors Office 1 Layouti x Layout List Total 0 288 PA SS RA ER cad gy vf El Office 1 1920 0 1920 x 1080 0 0 1920 x 1080 LEIM Ree Fala il E Layout 1 Monitor 2 Monitor 1 Monitor 4 1320 1080 1920 x 0 1080 1920 x 1080 1920 1080 1920 x 1 Monitor 3 Monitor 5 Monitor b ve Zoom Window 0 a Scan Window 0 E3 Remote E Map gt Media Window 0 g Web Window 0 Figure 8 23 6 Drag and drop the desired channels from the Host List or Group List to the layout 100 8 Multi Monitors Applications Adjust the channel size and position Fitting adjustment on Automatic adjustment on Manual adjustment on Monitor 3 Monitor 1 Monitor 5 amp 6 Control Center 1 Layout1 gt m Total 10 7 288 H1920 0 1920 x 1080 ax EES REESE Monitor 2 A x Hioni or 4 0 p960 p40 OMAN Camera 1 Camera 1 HX 360 540 5 p60 coe Camera 1 oa x USD ae 1920 1080 1920 x 1080 anora 960 1083 1771 x 1076 GY LX4C3 GY BX 70B Bx 220DB E Camera 2 Camera 1 era i E FE aS Zoom Window 0 2 Scan Window 0 Ls Remote E Map Oo Media Window 0 g Web Window 0 ied Remote ViewLog Window 0 MBN Gv Lx4c3 Camera1 GV VSO2A Camera 1 WO Fp7131 Camera1 GV LX4C3 Camera 2 z GV VS024 Camera 2 GV BX220D BX 200 E Camera 1 Figure 8 24 Manual adjustment Drag the four corners and sides of a channel to adjust its size and re p
93. ht click the map and select Finish to finalize the zone 137 9 1 6 The E Map Window Figure 9 11 The controls on the Remote E Map window 1 O WdOIN I OO Oo AIO 0 138 Login Host Information Previous Home Next ViewLog Configure Tree List Blinking Icon Output Icon Click to log in up to 500 hosts Click to view the information of incoming events upon motion detected and I O devices triggered Click to go to the previous E Map file Click to back to the top of the tree view Click to go to the next E Map file Click to access the Remote ViewLog function Click to configure the Remote E Map The list displays all created E Map files and folders The blinking icon represents a triggered camera or I O device Click to manually force the output device FJ Other Applications 9 1 7 Configuring the Remote E Map Click the Configure button No 7 Figure 9 11 to display the following dialog box Configure Download EMap files r Use local EMap files Browse D Control Centeralarnipuezer iw DaContral CenterAlarnbuser we AWE _ Browse __ Browse Figure 9 12 Download EMap files Click to download E Map files from the subscriber server to the local computer This option can reduce network load when you want to view E Maps of multiple subscribers Use local EMap files Once downloading E Map files to the local computer you can use these E Map files
94. in window See 8 3 Video Wall Manages mass number of GV IP Devices with integrated interface You can change assign IP address rename devices assign NAS and view storage space information of multiple GV IP Devices See 9 4 Batch Functions Searches for any remote servers with Remote Desktop service activated See Displaying a Remote Monitor on Video Wall 8 3 7 Displaying Remote Monitor Web Page and Playing Back Videos Displays the Video Wall Layout List on the main window See 8 3 2 The Layout List Displays Host List on the main window Displays the Group List on the main window Displays live views collectively on the main window Drag and drop cameras for live view display For more detail see 3 1 2 Displaying Multi Views Displays the Instant Play window on the main window See 5 1 Instant Playback No 14 15 16 17 18 19 20 21 Name Remote DVR Remote DVR Desktop Remote ViewLog Remote E Map VMD System I O Central Panel Broadcast Service Matrix Quick Zoom w Introduction Description Allows the Control Center to access a remote client GV System GV VMS See 6 1 Remote DVR Allows the Control Center to access the desktop of a host GV System GV VMS and the operating system See 6 2 Remote Desktop Allows the Control Center to access the event files of different hosts and play them back See 5 2 Remote ViewLog Allows you to monitor client DVR and GV IP Devices on E Maps See 9
95. ital Sign Monitor Control Center Vital Sign Monitor Video Wall 1 to 200 license Internal or external Note 1 For the Video Wall function make sure you insert a GV USB dongle with Video Wall function to Control Center server It is recommended to use the internal GV USB dongle to have the Hardware Watchdog function which restarts the PC when Windows crashes or freezes 1 Introduction Supported DVR Version The Control Center is compatible with e GV System GV NVR V8 5 or later e GV VMS V14 1 or later C GeoVision 1 2 Options Optional devices can be purchased to assist your surveillance management A GV Keyboard V3 can be used to operate PTZ camera Matrix View GV Keyboard V3 ViewLog and Video Wall For details see GV Keyboard V3 User s Manual A GV Joystick can be used in conjunction with GV Keyboard V3 to GV Joystick control PTZ channels from GV Control Centers For details see GV Joystick User s Manual An Internal GV USB Dongle provides the hardware watchdog function Internal GV USB to GV Control Center server by restarting the computer when Dongle Windows crashes a Introduction 1 3 Overview 1 3 1 The Control Center Main Window Figure 1 1 By default there are five areas on the main window No Name 1 Toolbar 2 Host List 3 Group List 4 Live View 5 Layout List 6 Instant Play Description See 7 3 2 The Toolbar later Di
96. ition F Delete Rename 2 User i L i E e ea All w Eason Todd Figure 8 4 81 aera G s 7 4 bs gt 2 f j QE G amp S 6 7 8 1 Exit Closes or minimizes the Matrix window Select screen divisions with the choices of 1 4 6 8 9 12 16 20 24 32 36 48 64 80 or 96 channels 2 Screen Division 3 Date Time Indicates the current date and time 4 Monitor Starts or stops monitoring 5 Configure Access the Matrix settings and camera properties 6 ViewLog Opens ViewLog 7 Camera Scan Rotates through screen divisions Displays the PTZ control panel To display the PTZ control 8 PTZ panel you can also right click the connected channel and select PTZ Control 82 8 Multi Monitors Applications Monitoring status is indicated by the color of the device name only supported by GV IP Devices GV VMS and GV System e Red A GV IP Device or a channel from GV VMS is being 9 Monitoring Status monitored and it may or may not be being recorded A channel from GV System is being monitored and recorded e Yellow The camera is not monitored Tip To enable monitoring right click a channel and select Start Monitoring The device name bar of the monitored channels change to red when these cameras are being recorded Note 1 To display Matrix views in separate 8 monitors make sure
97. itor Scan Window o is created by default Total 10 28 5 pope re 1920 0 1920 x 1080 Monitor 4 1920 0 1920 x 1080 0 0 7380 pau 960 1 50x oa Camera 1 Camera 1 scan Window 0 1x1 Division Camera 2 1920 1080 1920 x 1080 0 1080 1920 x 11 Monitora kontang 960 1083 1771 x 1076 GV BX220D BX220D E Camera 1 as Zoom Window 0 ae Scan Window 0 e3 Remote E Map gt Media Window 0 ga Web Window 0 emt Remote ViewLog Window 0 hes GV VS02A Camera 1 MD Gv Lx4C3 Camera 1 MBE Gv 8x2200 8x220D E Camera 1 GV VS02A Camera 2 z FD7131 Camera 1 q Figure 8 28 3 Manually or automatically adjust the position and size of the inserted Scan Window For detail see 8 3 3 Adding a Server and Configuring the Layout in this section 107 4 108 To configure the scan display settings right click the Scan Window select Setup This dialog box appears i Display Setting Position Caption Scan Setting Display Interval Division Scan by 1 Cam al Figure 8 29 Position Sets the position co ordinates and size of the Scan Window Caption Sets the caption color and size Scan Setting Display Interval displays channels at the specified interval The default is 3 seconds Division the channels are displayed in the specified divisions Note For megapixel channels it is strongly recommended to set the Display Interval to at least 10 seconds to compensate for lo
98. its original size 11 Floor Plan The window displays the imported graphic file 12 Map View Tree view of E Map files and or folders 13 Host View Tree view of host folders 130 FJ Other Applications 9 1 2 Creating an E Map To create and edit an E Map file follow the steps below 1 Click the Add Map button on the toolbar A New Map file will be created in Map View and the Floor Plan window separately kg E Map Editor File Edit Map Host View Lid eS EDO eamm Map View E A New Map Figure 9 3 Click the New Map file in Map View and then click the Load Map button to import a graphic file The file opens in the Floor Plan window Drag and drop the icons from Host View onto the map in the Floor Plan window To change the orientation of the default camera icon right click the camera from the Host View No 13 Figure 9 2 and select an orientation 131 5 To change the camera icon to your own 132 A Right click the camera from the Host View No 13 Figure 9 2 and select Change icon This dialog box appears Change Icon Default leon lcon Type Preview No Event Default Icon E Event Default Icon Figure 9 4 B Click the Add Icon button and locate your icon file Note Make sure the icon file is of 32 x 32 pixels or smaller FJ Other Applications C Select the icon you just added specify the condition that the icon appears by selecting No Event or Event and define the orient
99. ivate Remote Desktop Service No 5 Figure 2 2 first 2 Atthe Control Center highlight a host in the DVR List Then click the Remote Control button fs and select Remote Desktop When the connection is established the client desktop will appear in a separate window on the Control Center desktop Note You can choose a suitable connection speed See 10 4 Remote Desktop Settings 55 C GeoVision 6 2 2 File Transfer The File Transfer function is designed to transfer files easily between the Control Center and client DVR 1 Run the Remote Desktop 2 Click the File Transfer button on the upper left corner of the Remote Desktop The File Transfer Service dialog box appears 3 Select the desired file to transfer to Local the Control Center or Remote the client DVR File Transfer Service Ready Local Remote 192 169 0 254 o o Name Size Modify Time Name Modify Tir A J 2 C CommRes 1024 O 12 2016 5 Lg Documents and Settings 12 26 20 C RECYCLER Bf2ef2016 4 _ FOUND OO0 12 26 2014 La System Volume Informa Bf2e4f2016 9 C MIDIA 12 26 201 C Test program 9 11 2016 4 C Program Files 12 26 20 C Recycled 12 26 20 CE System Volume Informa 12 26 201 Ca WINDOWS 12 26 2014 E f26f AUTOEXEC BAT 12 26 2001 x m Low Z boot ini 9 11 2006 2 BOOTSELT DOS 12 26 2014 S CONFIGS YS 12 26 20 s lt i D Mame Size Progress Local Remote BOOITSECT DOS 0 50 KB 100 Di a CABOOT
100. ly supports GV IP Devices 7 1 Running the I O Central Panel 1 For DVR hosts the client DVRs must activate Control Center Service No 3 Figure 2 2 first 2 On the Control Center Toolbar drag the desired hosts from the Host List to the I O Panel Group in the Group List and click the Save button e ex e Geov ision YMD Group T 10 Panel Group wl E Map Group a Host 3 ci Corridor o Gate Figure 7 1 3 Click the I O Central Panel button on the Control Center toolbar When the connection is established the I O Central Panel appears on the Control Center desktop C GeoVision 7 2 The I O Central Panel 1 0 Central Pane A e F Mode Default W Standard VO List a Hosti 1 Modules 344 Module 1 inputi Input 2 Output 1 output 2 E ios Advanced lO List Figure 7 2 The controls on the I O Central Panel No Name 1 Configure 2 Mode Schedule 3 Toggle Quick Link 4 Advanced I O List Style 5 Expand Tree Row 6 Collapse Tree Row 7 Mode 8 Standard I O List 9 Advanced I O List 60 Description Accesses Panel and Schedule settings Starts stops Mode Schedule Displays the Quick Link window for quick access to triggered I O devices Displays the Advanced I O List in various styles View Edit Icon and Detail Expands tree branches Collapses tree branch
101. map Rename Add Group a BroadcaL AddGroup OO Save Figure 9 35 B Name the created group C Drag the desired cameras from the Host List to the group folder The Group List may look like this Group List Ld XK i aan ge E gt VMD Group a mo Office i GvV LX403 Camera 1 OV BX12720D BX120D E Camera 1 OV BX130D BX130D E Camera 1 VO Panel Group E Map Group Broadcast Service ea Panorama GV BAZZ0D BAZ20D E Camera 1 i Egg GV BX220D BX220D E 1 Camera 1 cei GV BX3400 Camera 1 k Figure 9 36 160 FJ Other Applications D Configure the access right for each group Click each folder and grant access right to the group by selecting from the right tab By default access is not granted for any created account For example Group List S mi ao 4 Y E PowerUser E User E Security Room a GV LX4C3 Camera 1 lM GV BX120D BX120D E Camera 1 GV BALSOD BALS0D E Camera 1 Figure 9 37 E Click the Save button 5 On the main window click to activate the Authentication Center 161 9 4 4 Logging In the GV Control Center With Authentication Center activated you may choose to log in GV Control Center through Authentication Center or retain the control at GV Control Center by logging in locally 1 Grant Authentication Center the right for managing GV Control Center s accounts and access rights settings
102. meras e Display of up to 8 Matrix windows in 1 monitor or separate 8 monitors at a time e Support for remote configuration of camera status and properties e Support for Camera Scan PTZ Control and POS Live View functions e Access to client ViewLog for playback 80 8 Multi Monitors Applications 8 2 1 Running the Matrix View 1 For DVR hosts the client DVRs must activate Control Center Service No 3 Figure 2 2 first At the Control Center highlight a Group and click the Matrix button BE The Matrix window appears Tip 1 To add or replace one camera view in a Matrix view make sure you have set the Control Center window position to be always on top and simply drag the desired camera from the Group List to the desired channel position See 10 1 General Settings Note that when Matrix is closed and opened next time the dragged cameras will not be displayed You can set the access right to a group folder By default only an Administrator and Power User account have the right to configure the access to a group folder To allow for access log in an Administrator account right click a group folder select Privilege select User or Power User and select accounts to allow for access to this folder Group List Wat 2 RR Geovision j 3 YMD Group a 1 0 Panel Group E Map Group Matrix Remote Yiewlog Fanorama Setting Panorama View Set Startup to b Set Start Fos
103. n 7 7 Setting Up Mode Schedule The Mode Schedule allows you to monitor surveillance sites using different I O cascade configurations according to the scheduled time For example you may want I O cascade triggers one way during business hours and another way for non business hours Modes can be switched automatically at a scheduled time 7 1 1 Creating a Mode 1 Click the Mode drop down list No 7 Figure 7 2 and select Mode Edit This dialog box appears Advanced 1 0 Modes Advanced KO Settings Save Newhlode 1 ay Newhlode 2 Cancel Add Delete Rename Copy Figure 7 11 2 Click Add and name the created mode You can create up to 100 modes 3 Click Save to return to the panel 4 Select the created mode from the Mode drop down list and create the groups in the Advanced I O List For details see 7 3 Creating a Group for Cascade Triggers earlier in this chapter 68 I O Central Panel 7 2 Creating a Mode Schedule Define the times and days you like the panel to switch modes 1 On the panel toolbar click the Configure button No 1 Figure 7 2 and select Schedule Setting This dialog box appears Schedule Setting Save Cancel Mame hlode Time Days System Default Mode Default Figure 7 12 2 Click Add to create a schedule This dialog box appears Schedule Information Mame Office Hours Mode Time 10 00 00 19 00 00 Days C Sunday Tuesday Wednesda
104. n E EE 63 7 4 Monitoring Hosts from the I O Central Panel ccccccecceceeeeeeeeeeeeeesaeeeeeseeeeeeeseeeeeseaeeeeeaaaeees 64 7 5 Configuring the I O Central Panel ccccccssscecceeseecceeseeeceeseecceaseessaeeecsageeecseaseeessaseesssageees 66 TO VIG WING COPA CONE OG seirseiors anieri e NOE RAE E EAA EE EEEE 67 7 f Setting Up Mode Schedule cccccccccsssececcesseecceeseeecsegeeceeseeceeaseeecsgeeecsagseessegeeessageeessanseees 68 T1271 Creating a MOUS saisacisseoriasicincesoniisn oct deaemsakanestastwndansstavbanawenesaxsakanacesndaswedxaaenilangukenicmageedsiesaut 68 7 7 2 Creating a Mode Schedule ccccccccsescecceeseeeceeseeeceeseeecseuseecseseescsageeessageeessegseessesenenes 69 7 eo UCE LINE Gane one EE E ee ene ee ee E ee ee eee ee 70 To Fa QUID UI certs cre ane demesesta sor E ET dete 71 7 10 Editing Background Mage essesi EE Ad 72 7 11 Managing a Group of I O DeVICES ce eccccccecceeceeeeeeeaeeeeeaeeeeeeseeeeesseseesseeeeeseaeeessaneeesaaseeees 73 F12 COMMONMIG NO DC WICCS seses aaaea 74 7 13 Popping Up Live Video Upon Input Trigger cece ccccceececeeeeseeecee cece eeseeeeseeeeseeesaeeeseneeaeeess 15 Chapter 8 Multi Monitors Applications ccccccsseeeeeeeeeeneeeeeenecneeeeseneeeeseneoes T7 9 1 Applicaton POSION een en ne ee ee eee ee TT oa NA VEN a E E E E E 80 8 2 1 Running the Matrix VICW ictcsescrcsscstcranstasccteitencsasvienannonsdnscedancatbendavunn
105. n the top right quadrant when Quad view is selected 122 8 Multi Monitors Applications Guard Tour Setting Guard tour is a virtual PTZ tour to monitor important spots within the live view range This option is only available under the Single View mode For details see 8 4 7 Virtual PTZ Tour Fisheye Settings Wall Mount 180 View Wide View Figure 8 44 Wide View Increases the height of the 180 degree view when camera position is set to wall mount Figure 8 45 1 Wide View Disabled Figure 3 45 2 Wide View Enabled 4 You can drag and drop any PTZ view or 180 degree view to adjust the viewing angle 123 8 4 1 Virtual PTZ Tour Set up a virtual PTZ tour to monitor important spots of your surveillance site This function can be applied to Single Live View Live View Window Matrix and Video Wall Before you start make sure your GV Fisheye Camera is set to the Single View mode For details on the view mode see Cameras Modes 8 4 Setting Up a GV Fisheye Camera 1 Right click the camera live view or the camera on the layout Figure 8 23 select Fisheye Option and then select Guard Tour Setting This dialog box appears Guard Tour Setting Enable Set Current Preset Available Preset Setting Preset ID Dwell Time Guard Tour Setup ID Dwell Time View Order Delete Item Figure 8 46 124 8 Multi Monitors Applications 2 Type a name for the current live view and click Add This liv
106. nced lO List Entrance Lobby ME Output 1 Output Output 4 lt Ent Output Output 3 Figure 7 18 72 I O Central Panel 7 11 Managing a Group of I O Devices With groups of I O devices set up on the Advanced I O List you can enable or disable these I O devices by groups Enabling a Group On the Advanced O List right click a desired group and select Start Monitoring All input devices of this group are now enabled When inputs are triggered outputs will be activated in cascade mode Disabling a Group On the Advanced I O List right click a desired group and select Stop Monitoring All input devices of this group are now disabled No cascade triggers will occur Pausing the Triggered Inputs This feature is designed for a group of outputs set to be Toggle mode When inputs activate outputs in cascade triggers right click this group and select Pause Monitoring The inputs of the group will be reset but the outputs keep on alarming 73 C GeoVision 7 12 Controlling I O Devices The Control Center operator can manually arm or disarm any I O devices of different hosts without interrupting the monitoring Note This function also supports the client GV IP Devices of these firmware versions GV Compact DVR Firmware V1 43 or later GV IP Camera Firmware V1 05 or later GV Video Server Firmware V1 45 or later Arming or disarming I O devices 1 On the Standard
107. ng Tool it is recommended to revise an entire sentence at a time instead of simply searching a single word and replacing the word in all other strings Revising the translated text 1 Install the MultiLang Tool from the Software DVD A Insert the Software DVD to your computer It runs automatically and a window appears B Select Install GeoVision Free Utility and click Yes to accept the License Agreement C Select GV MultiLang Tool and follow the on screen instructions 2 Close all GeoVision applications first and then double click MultilingualConfig exe This dialog box appears MultilingualConfig Language Tools Yersion English Multilingual Text IIll Save Cancel Figure 9 13 3 Click Language and select the language of the text you want to revise 141 4 Inthe Search field type all or part of the text in English or the target language and click Search MultilingualConfig Language Tools Version mation detection Search English Multilingual Text Select windows For motion detection S lectionner les Fen tres pour d tection de mouvement Ignore motion detection For defined region Ignorer la d tection de mouvement pour la zone d nifie Decode all Frames upon motion detection D coder toutes image sur d tection mouvement 1Define Detect Region rin Define the detect region irin 1D finir la zone de d tection rin D finir la zone de d t Maximum number of motion detection regions has been r
108. nger connection and processing time Drag and drop the established group to the Scan Window To activate scan display right click the Scan Window and select Activate The channels are displayed by turn on the Scan Window at the specified interval To inactivate scan display right click the Scan Window and select Activate To create a new Scan Window right click the space on Channel List select Add Scan Window and repeat steps 1 to 6 To remove a new Scan Window right click the Scan Window icon in Channel List and select Remove 8 Multi Monitors Applications To zoom a Scan Window 1 If only one Zoom Window is set up right click the activated Scan Window and select Zoom The channels are displayed in turn on the Zoom Window and disappear on the original Scan Window 2 If more than one Zoom Windows are set up right click the activated Scan Window select Zoom Mapping select a Zoom Window and select Zoom The channels are displayed in turn on the selected Zoom Window and disappear on the original Scan Window 3 To disable zooming right click the activated Scan Window and select Zoom again The channels return to the original Scan Window Note To operate the Scan Window using GV Keyboard V3 see 2 6 GV Video Wall in the GV Keyboard V3 User s Manual 109 8 3 Displaying Remote Monitor Web Page and Playing Back Videos Displaying a Remote Monitor on Video Wall You can display customized view region of a remote mo
109. nitor as a channel on Video Wall Up to 288 Remote Monitor channels can be displayed 1 Install the Remote Desktop server to the remote server you intend to access A Insert the Software DVD to the server select Install GeoVision Paid Software and click Yes to accept the License Agreement B Click GV Remote Desktop Server and follow the on screen instructions The Remote Desktop server is installed shortly and automatically enabled The RDS icon appears in the system tray 2 Define the display area of the remote server and access other settings A Right click the RDS icon and select Stop Service B Right click the RDS icon fi again and select Configure This dialog box appears Setting Autorun When Windows Starts Refresh Rate Slow Y Port Settings Service Port 5632 Default Password Set Viewing Range Monitor 1 Setup Wiew Cancel Figure 8 30 Autorun When Windows Starts automatically activates Remote Desktop Service when Windows starts E Refresh Rate defines how quickly this remote server refreshes while being accessed By default the Slow option is selected 110 8 Multi Monitors Applications m Service Port corresponds to the Data port for Remote Desktop Service in Control Center Server Tip Access the Data port by right clicking the remote server from the Host List under Remote Desktop Service and then select Host Settings This dialog box appears Host Settin
110. nter e The Authentication Center provides GV Control Center the settings on user accounts also their username and password and only these accounts are legitimate for logging in the GV Control Center e The Authentication Center also provides GV Control Center the Host List and Group List settings e The GV Control Center s account management Host List and most of the Group List functions become non configurable 9 4 1 Installing the Authentication Center You can install the Authentication Center from Software DVD or GeoVision Website Installing from Software DVD 1 Insert Software DVD to the computer It runs automatically and a window appears 2 Click Install GeoVision Free Utility and click Yes to accept the License Agreement 3 Select GV Authentication Center and follow the on screen instructions Downloading from GeoVision Website 1 Go to the Software Download and Upgrading page of GeoVision Website http www geovision com tw english 5 8 asp 2 Select the Video Management Software tab from the Supplemental Utilities section click the Download icon P o of GV Authentication Center 155 9 4 2 The Authentication Center Window amp 2 3 4 5 6 Panorama AuthCenter gt System View Help Host List Dx eO 8 GY Bx 3400 a VMD Group i e Office i liil VO Panel Group i litil E Map Group i liil Broadcast Service IP Camera List Panorama 0 GV BX120D BX120D E ah Camera 1 GV Bx
111. ntication Center Settings ccccccccsssceccseceeceeseeeceaeeecseuseeessaeeessagseesseuseeessageeessageess 176 10 7 ACc unt Manageme N asesrpisssip air aN AE e Ae Rp aT NEP AeA aE 177 10 8 Backing Up System Configurations ccccccccccseeecceseeeeeeeeeeeeeeeeeeesaeeeeeaeeeeeseeeeeesseneeesaaeeees 180 Appendix A GV USB Dongle Upgrade ccccceceeeceeeeeneeeeeeeseneeeeseneeeesensones 182 D ngle FR SQUIFCINIGING sssrds ee nn eE RETO EN EE aair EE TEER ET REEE 182 Upgrading the Black Dongle iscivsiecsaitadsevedarscnsaisrsonuiadandenealanssnendiaderaedaaaeeandsddunvedaracadinelusacanndandsdeanidawinns 182 Appendix B PTZ Control Using GV Joystick and or GV Keyboard 184 Appendix C RTSP Streaming wiscasesccancdesciacadcsnnsiasacatanatessbsnadesnansatesiamaiesseuadenenain 185 Appendix D Supported IP Device Brands and Protocols 2 csccsseeeeeees 186 Appendix E Specifications essnsesnnsesnnnunnononnennnnennnnannnnennnnnnnennnnennnnannnnannnnnne 187 Naming and Definition GeoVision Analog and Digital Video Recording Software The GV System also refers to GV Multicam System GV NVR System GV DVR System and GV Hybrid DVR System at the same time GeoVision Video Management System for IP cameras Convention VF In this manual DVR hosts refer to both GV System and GV VMS Oooo l C GeoVision GPU Decoding Specifications For GV Control Center and GV Video Wall V3 1 1
112. o activate all the channels of a layout click the layout on the tree view or the tab and select the Apply the Selected Layout G button No 8 Figure 8 18 104 8 Multi Monitors Applications 8 3 5 Setting Up a Zoom Window A Zoom Window is a window reserved for displaying zoomed channels Up to 16 Zoom Windows can be established 1 Drag the Zoom Window icon from the Channel List to a desired monitor The Zoom Window 0 is created by default Control Center1 Layoutl x v Total 10 288 DX mX 1920 0 1920 x 1080 Monitor 4 1920 0 1920 x 1080 0 0 960 x p40 960 0 APP age Camera 1 Camera 1 Zoom Window 0 l GY LX4C3 Camera 1 ma A 0 SAN SARI 960 540 3po0 ana Camera 2 Camera 1 ax LDR 1920 1080 1920 x 1080 a eeii 960 1083 1771 x 1076 Zoom Window 1 GY BX220D BX220D E Camera 1 Ka Zoom Window 0 Py Scan Window 0 Es Remote E Map gt Media Window 0 gu Web Window 0 ems Remote ViewLog Window 0 Channel List W Gv Lx4c3 Camera1 WBN Gv vs02A Camera1 WP FD7131 Camera1 ee Zoom Window 1 MBB cv vs02A Camera 2 WP Gv 8x2200 Bx220D E Camera 1 4 Ww p Figure 8 27 2 Manually or automatically adjust the position and size of the inserted Zoom Window For detail see step 7 in 8 3 3 Adding a Server and Configuring the Layout earlier in this section 3 Make sure the channels intended for zoomed view are activated Right click the channel and select Activate
113. odec PIP View Refers to Picture in Picture You can zoom in on the video See 3 2 PIP and PAP View PAP View Refers to Picture and Picture You can create a split video effect with multiple close up views on the video See 3 2 PIP and PAP View Fisheye Dewarps the fisheye view to quad view IMV1 Panomorph Dewarps the fisheye view Note this option is only available for a third party fisheye camera and when the camera resolution is set as 1280 x 1024 or higher Wide Angle Lens Dewarping Corrects live view distortions See 3 1 4 Adjusting Distorted Views Receives audio from the host Enables speaking to the host A microphone must be installed properly in the computer Enables and configures the audio and video settings Adjusts the image color Normalization and decreases the fogginess of the image Sampling Range Activates the PTZ control by selecting PTZ Panel or PTZ Automation Allows you to change the current state of an electronic device e g light ON by clicking on its image directly The function is only available when the same function is set at the host Takes the snapshot of the displayed live video Enlarges the video by selecting 1 0x 2 0x and 3 0x Plays back the recording in the last 10 seconds 30 seconds 1 minute or 5 minutes 21 C GeoVision Note When the video resolution of the IP camera is larger than the screen resolution of the Control Center the maximum live video you can view is
114. op Image Camera 1 Figure 8 25 Auto Arrange See Automatic adjustment in step 7 Identify Monitor Shows the monitor number Hide All Inactivates and hides all the channels Show All Shows all the channels on the layout Use Desktop Image Use the desktop image on the layout Update Desktop Image Refreshes the Video Wall with desktop image This option is only available when Use Desktop Image is enabled 9 Right click a channel to access the following features Control Center 1 Layoutl x T Total U 288 ox FSO ee ee ee 1920 0 960 x 540 Monitor 1 Monitor 4 Setup i Fitto Screen Lock Unlock 1920 1080 180 1920 x 10 1920 1080 1920 Monitor 3 sia he tor 5 Monitor b otal Wide Angle Lens Dewarping Wide Angle Lens Setting Location on E Map Auto Arrange Figure 8 26 102 8 Multi Monitors Applications Setup Contains settings on position co ordinates size captions host name and camera name Zoom Mapping See 8 3 5 Setting Up a Zoom Window later in this section Fit to Screen See Fitting adjustment in step 7 Lock Unlock Select to lock or unlock the channel at its current position A locked channel appears in dark gray Activate Activates the current channel on Video Wall Zoom See 8 3 5 Setting Up a Zoom Window later in this section Hide Inactivates and hides the channel To show a hidden channel right click the icon at the bottom of the layout and
115. osition For example the GV BX220D BX220D E channel is manually placed across Monitors 5 and 6 Automatic adjustment Right click the space on a desired monitor and select Auto Arrange the channels on the selected monitor will be automatically reshaped to equal size and arranged in order of being added to the layout For example four channels are automatically sorted on Monitor 1 Fitting adjustment Right click a channel and select Fit to Screen the channel will fit the nearest monitor For example GV LX4C3 is fitted to Monitor 3 Tip To set multiple channels to the same size drag your mouse to highlight the channels right click one of the channels and then select Setup Type the width and height Double click a channel for it to extend to full monitor size For example a channel put across two monitors will be extended to fit the two monitors Click the pin icon to fix a channel to the assigned position 101 8 Right click the space of a monitor to access the following features WX 4H x ax ax 01920 0 960 x 540 960 0 960 x 540 0 0 960 x 540 960 0 960 x 540 TEST244 PC TEST244 PC TEST244 PC TEST244 PC Camera 5 Camera 6 Camera 4 Camera 9 WX H1920 540 960 x 960 540 960 x 540 TEST244 PC TEST244 PC Auto Arrange Camera f Camera 8 Identify Monitor cera 0 1080 19 ax i ae Monitor 5 Hide All 01920 1080 1920 x 1080 Show All Use Desktop Image TEST 244 PC Update Deskt
116. ote ViewLog service on the GV IP Devices and GV System GV VMS for this application Video Playback on Video Wall with Media Window You can play back and display up to16 media files on Video Wall File types supported by Microsoft Media Player are supported for playback in Media Window DYR Layout1l x foe es eas 663 0 488 Total 1 7 288 Media Yrindow 0 Event20121226 b Il E dy d hH 00 00 00 00 sata ae amp Zoom Window 0 y Media Window 0 Ill _ Remote YiewLog Window 0 _ 001 Office Camera Figure 8 37 115 116 Volume Up Play Stop Volume Down Browse Pause p Forward b Il Bod lt 00 00 00 00 Figure 8 38 Drag and drop the Media Window icon to the layout Adjust the size and position of the Media Window For details steps 7 to 9 in 8 3 3 Adding a Server and Configuring the Layout Activate the layout or just the channel for instant display For details see 8 3 4 Activating the Channel and Layout Click the Browse button Figure 8 41 to browse a file for playback The recording is played back shortly To add another Media Window right click the space in Channel List and select Add Media Window To delete a Media Window right click the icon in Channel List and select Remove 8 Multi Monitors Applications 8 3 8 Displaying Live View from Remote E Map The Video Wall can be used to display live views
117. ow Channels Zoom Window Web Window Media Window Remote ViewLog Window Remote Monitor Live view from Remote E Map Language Amount Unlimited The maximum number of monitors allowed depends solely on the graphic cards installed to the Video Wall server 288 16 64 16 16 16 16 288 On each Video Wall you can display a customized view region of a remote monitor 1 Arabic Bulgarian Czech Danish Dutch English Finnish French German Greek Hebrew Hungarian Indonesian Italian Japanese Lithuanian Norwegian Persian Polish Portuguese Romanian Russian Serbian Simplified Chinese Slovakian Slovenian Spanish Sweden Thai Traditional Chinese Turkish Note The total number of camera channels and Remote Monitors displayed on the Video Wall cannot exceed 288 All specifications are subject to change without notice 188
118. pace information of multiple GV IP Devices Supported GV IP Devices The batch functions only support the following GV IP Devices of the specified firmware versions and do not apply to GV Recording Server GV System and GV VMS GV IP Devices Supported Version GV IP Camera V3 00 or later GV SD220 GV IP Speed Dome V1 04 or later GV SD220 S S GV Target Camera V1 02 or later GV VS11 V1 03 or later GV Video Server GV V S12 V1 07 or later GV VS14 V1 01 or later 1 Recording to GV NAS Systems is only supported by GV IP Camera and GV Target Note Camera of the specified versions Files recorded to GV NAS Systems are stored in the MPEG4 format and those recorded to memory cards are stored in the AVI format 145 9 3 1 Configuring the IP Address You can set the IP address of more than one GV IP Devices at a time Follow the steps below Auto Set IP Address ol Host Mame C Gv VS04H CI Gv VS04H 1 C GV L 4C3 CI GV BxX120D 8 120D E OI GV BX320D Bx320D E C UBXS301 C DVR FE420 FE421 CI Gv FE420 FE421 COI Gv FES20 FE521 Pig Start IP address Subnet Mask Default Gateway CONS Server IP 192 166 355 192 168 0 137 192 168 4 31 192 168 0 69 192 168 1 251 192 168 2 12 192 168 2 243 192 168 2 17 192 168 0 854 MAC 0013E2023453 OO1SE2043363 OO1SE200FC2D OO1SE2024 741 OO1SE2023C 10 00 13E2019689 OO1SE20415F OO1SE2041 705 On the main screen click the
119. position 47 Chapter 5 Playback 5 1 Instant Playback You can retrieve and play back recordings from DVR GV IP Device and GV Recording Server Note Playback for GV Recording Server is only supported for V1230 or later The following function must be enabled ahead to allow remote access from the Control Center DVR Enable recording and Remote ViewLog Service No 4 Figure 2 2 GV IP Devices Enable recording and ViewLog Server To start instant playback In the Host List Figure 1 3 or Group List Figure 1 4 right click one camera and select Instant Play 5 Min On the Live View window Figure 3 2 right click one camera and select Instant Play 5 Min In the VMD window right click the pop up camera and select Instant Play 5 Min On the I O Central Panel Figure 7 2 click an input icon and select Instant Play or right click an input icon select Information select an event from the Trigger Time List and select Instant Play In the Matrix view Figure 8 5 click on the Camera Name select Instant Play and select the time length On the Remote E Map Figure 9 11 click the Host Information button to display the Host Information dialog box and select an event for playback Tip By default the event selected from Remote E Map is played back on the Control Center s main window To play back in a separate Instant Playback window see 8 7 Application Position for details e Playback 2
120. ption to automatically log in the Authentication Center using the specified ID and password as soon as Authentication Center is connected 176 10 System Configuration 10 7 Account Management You can establish multiple accounts of different access rights There are three types of accounts available for setup Administrator Power User and User each with different access rights by default see the table below However you can also customize the access rights to suit your needs General Application Video Wall System settings Configuring executing and exiting Adding configuring settings backup host all the applications in Control and deleting hosts and Account Type and group settings Center layout for Video Wall User Access to Host List only Execution of Matrix and VMD only By default the GV Control Center contains an Administrator account with the Login ID admin and no password Establishing an Account To add a new account follow the steps below 1 Log in an Administrator account with the right for Account Management Figure 10 8 For first time users log in the default Administrator account 2 Select the Configure button No 1 Figure 1 2 and select Account Setup This dialog box appears Account Management a Administrator 83 admin Poweruser User General Application Video Wall O 0O O O E d 0O 0O O O K E Cancel Figure 10 7 177 3 Click the Add n
121. rch the host s network storage button to detect its shared folder s This dialog box appears Please enter username and password Search Server Username Figure 9 24 5 Type the administrator username and password of the NAS device that allows for highest level of access The default username and password for a GV NAS System are both admin The server s folders are detected and shown 150 FJ Other Applications 6 Expand the server to show its folders z MAS Setup E cina xp E aiorno Pc g ev waszo0 L admin e hddi public ed IP_ Camera GY NAS4008 Figure 9 25 7 Assign storage paths for the cameras O tJ GEO WIN WESPE A _ Host Name A Storage Path Free Space Total Space MB Status D320D Bx1301 a E GINA xP g GV F WGV NAS2008 IP_Camera 0 0 OK bel GIORNO PC g Gcv u GV NAS2008 IP_Camera 0 0 OK gt E Gv CONTROL PC a ev Naszoo8 H admin B B hddi nubli bet Gv Nas4008 Figure 9 26 A On the NAS Setup window select at lest one camera to assign the storage path B Select a NAS folder from the list and click the Select this storage path for the device button to assign this storage path The storage path appears in the Storage Path column immediately C In the ID and Password column type the ID and password of an established account of the NAS server For example for a GV NAS System type the default username Cam01 and default passwo
122. rd 12345678 8 Click the Save button to store the settings Note 1 Be sure that you assign each IP camera to record to a different user account in GV NAS System to avoid disrupting the recycling process 2 For GV NAS2008 4008 the default user name is Cam01 up to Cam08 for each of the 8 user accounts for GV NAS2016 4016 the default user name is Cam01 up to Cam16 for each of the 16 user accounts The default passwords are all 12345678 For details see GV NAS System Quick Start Guide and User s Manual 151 Changing the NAS Storage for Recording In the NAS Setup window Figure 9 26 select a camera select a NAS folder and click gt gt The new storage path is immediately assigned Alternatively type the storage path ID and password of a NAS folder Click Save al to apply the settings Deleting the NAS Storage for Recording 1 Inthe NAS Setup window Figure 9 26 select a camera and its storage path and click the Delete the selected storage path R button Figure 9 26 2 Click the Save ka button Figure 9 26 to store the settings 152 FJ Other Applications 9 3 4 Viewing the Storage Information You can view storage information such as the storage type free space and the overall disk space of GV IP Devices Click the Batch Update Wizard button 4 and select Storage Information Storage Information g DYR FE420 FE421 ID or password erro Free Disk Spa Disk Space M _ HDD 36
123. re 1 3 and select Microphone The button turns yellow when it is enabled You can speak to the host through a microphone Host List y Ss SOET ha y Ein mi a p GY FE420 amp REAJI Figure 4 2 4 Audio Communication Listening to a Host 1 Select a host from the Host List The name of the selected host appears in the space below the toolbar Figure 4 1 Click the Microphone button T No 8 Figure 1 3 select Wave Out and select a camera number if there are more than one camera The button turns yellow when it is enabled You can listen to the camera through a speaker Speaking and Listening to a Host 1 Select a host from the Host List The name of the selected host appears in the space below the toolbar Figure 4 1 Click the Microphone button T No 8 Figure 1 3 select 2 Way and select a camera number if there are more than one camera The button turns yellow when it is enabled You can speak and listen to the camera with microphone and speaker 45 C GeoVision 4 2 Audio Broadcast The Control Center operator can use the Audio Broadcast function to speak to multiple hosts at one time Note The Audio Broadcast function supports both GV and third party IP devices with speaker functions 4 2 1 Starting the Audio Broadcast 1 To open the Audio Broadcast window click the Broadcast Service button on the Toolbar This dialog box appears Host Mame Status Figure 4 3 2 Right click th
124. s named NVR 7116442 in After you receive the updated file insert the correct dongle matching the in file you receive and then run GVUsbKeyUpClient exe Click Select All to read the dongle click Upgrade and then open the updated file to upgrade the dongle You can also select more than one dongle in the list and click Batch Upgrade to upgrade them at the same time Make sure these dongles match the updated files you receive 183 Appendix B PTZ Control Using GV Joystick and or GV Keyboard You need to run the following program in the background when using the GV Joystick and or GV Keyboard to control PTZ For details on the GV Joystick operations see GV Joystick User s Manual For details on the GV Keyboard operations see GV Keyboard User s Manual Control Center You can control the PTZ cameras using up to 8 GV Joysticks and or GV Keyboards in Live View and Matrix 1 Run mcamctrl exe from the program folder The Keyboard amp Joystick dialog box appears an X amp Keyboard amp Joystick CMS X ID 1 Name Name Control Center Startup type Manual PTZ Maximum Speed Startup type Manual PTZ Speed Monopoly mode Setting Monopoly mode Joystick Control Setting Device 1 Device 1 GeoVision Joystick af v Device 2 Device 2 Device 3 Device 3 Device 4 Device 4
125. select Show Fixed Ratio Show the host live view proportional to its source image Geo Fisheye Activates the display settings configured for Fisheye Option For detail see 8 4 Fisheye View Fisheye Option Configures the display settings and PT settings of fisheye camera Wide Angle Lens Dewarping Enables dewarping to the current channel Sets the degree of dewarping first Wide Angle Lens Setting Sets the degree of dewarping See 3 1 4 Adjusting Distorted Views Location on E Map Shows the position of this camera on Remote E Map This host will be highlighted in yellow Auto Arrange See Automatic adjustment in step 7 Tip You can set up multiple channels to the same size by highlighting the channels and right clicking one of them to define their width and length Note 1 For the Remote E Map channel Zoom Mapping Zoom Fixed Ratio Wide Angle Lens Dewarping and Location on E Map options are not supported The Geo Fisheye and Fisheye Option are only available for activated fisheye channels 10 To create another layout repeat steps 3 to 8 103 8 3 4 Activating the Channel and Layout After you have set up at least one layout you can activate a channel at a time or all the channels of a layout at once The activated channel or layout will be displayed on the Video Wall e To activate a channel right click the channel and select Activate You can repeat this operation with another desired channel e T
126. sktop A TEST a Downloads Computer ti Network di GV BEX120_V215_141107 E Recent Places Libraries Ji License E ees Ji RemoteViewlog V8590 al Music ral Auth Center Shortcut E Pictures _ AuthCenter_Setup20141121 cch E Videos ral edge recording Shortcut fay VMS Shortcut File name AuthCenter Backup File ccb om F E Cnmnuter Figure 9 46 2 Selecta previously exported settings file and click Open This dialog box appears Import Backup Data Password 4AuthCenter Figure 9 47 3 Type the password of the Authentication Center and follow the on screen instruction to import the settings 4 Once the settings are imported you are prompted to log in the Authentication Center again 168 Chapter 10 System Configuration This chapter details the following settings e General settings of GV Control Center including startup settings and layout See 70 7 General Settings e Port settings for searching client DVR and or IP devices See 10 2 Network Settings e VMD display settings See 70 3 VMD System Settings e Connection speed for Remote Desktop See 10 4 Remote Desktop Settings e Video Wall captions See 10 5 Video Wall Settings e Login settings See 10 6 Login Settings e Types of accounts and access rights See 10 6 Account Management e Importing and exporting settings See 10 7 Backing Up System Configurations 169 10 1 General Settings To access this dialog box cli
127. splay of up to 96 cameras from different hosts on the same screen See 8 2 Matrix View e Video Wall See 8 3 Video Wall e Access to the desktop of Video Wall server See 8 3 9 Remotely Accessing the Video Wall Server e Remote E Map See 9 7 Remote E Map e Support for 31 languages on the user interface Control Center also supports GV IP Devices GV Video Server GV Compact DVR and GV IPCam and GV Recording Server or GV Video Gateway for central monitoring C GeoVision 1 1 Minimum System Requirements Before installation make sure your computer meets the following requirements Windows 7 8 8 1 Server 2008 R2 Server 2012 R2 Core i7 2600K 3 4 GHz 8 GB Dual Channels Hard Disk 168 fe GigabitEthemetx2 O intemal or External GVLUSB Dongle Note 1 Ifyou are using more than two graphic cards on a server make sure they are of the same brand model and driver version to ensure maximum efficiency We do not recommend installing GV Control Center and GV Center V2 Pro on the same PC Running GV Control Center and GV Center V2 Pro on the same PC may result in CPU overload error or system failure When you find CPU usage is high or live view is unsmooth dropping frames you may need to increase the CPU thread and memory or decrease the number of connected cameras to improve the system performance Software License Unlimited Control Center Control Center Video Wall 1 to 200 license Control Center V
128. splays hosts and its channels in a tree diagram See 1 3 3 The Host List Displays hosts in Groups of VMD I O and E Map See 1 3 4 The Group List Displays images from the hosts Drag and drop the cameras from the Host List for live view display See 3 1 2 Displaying Multi Views Click the tab to switch to the Layout List The Layout List contains layouts for Video Wall See 8 3 2 The Layout List Displays the Instant Play window on the main window for playback See Instant Playback Chapter 5 C GeoVision 1 3 2 The Toolbar aM eB LOL No Name 1 Configure 9 Application Position 3 Search Host 4 Connect to server 5 Search Server 6 Open Activated Layout T Batch 8 Search Server 9 Layout List 10 Host List 11 Group List Live View 12 Window 13 Instant Play Figure 1 2 Description Displays system settings including general settings network settings VMD settings Remote Desktop and Video Wall Configures position and resolutions of application windows including GV System GV VMS Remote ViewLog Remote E Map I O Central Panel and up to 8 matrices See 8 1 Application Position Opens the Search Host window with which you can detect and add devices of the same LAN to the Host List and select a network card if you have installed more than one Adds a server to Layout List of a Video Wall Searches for Video Wall servers See 8 3 Video Wall Opens the activated layout on the Control Center s ma
129. start changing the IP address When the update is completed the new IP address is shown in the New Setting and Success is shown in the Status columns Auto Set IP Address Oo Host Name O Gv vso4H EO Gv VSO4H 1 O Gv Lx4c3 C Gv Bx120D Bx120D E O Gv Bx320D BxX320D E M UBx3301 C DVR FE420 FE421 GV FE420 FE421 GV FE520 FE521 C GV BX120D IPV 4 Start IP address Subnet Mask Default Gateway DNS Server IP 192 168 3 83 192 168 0 137 192 168 4 31 192 168 0 69 192 168 1 251 192 168 2 11 192 168 2 245 192 168 2 17 192 168 0 84 192 168 0 103 MAC 0013E2023255 0015E20433B3 00135E200FC2D 0013E2024741 0013E2023C1C 0013E2FF0784 0013E2019889 0013E20415F7 0013E2041783 0013E2034693 Assign IP 192 168 2 12 192 168 2 13 192 168 2 14 Figure 9 19 New Setting 192 168 2 12 192 168 2 13 192 168 2 14 Status Success Success Success 147 9 3 2 Renaming Devices You can modify the device name for multiple devices through this interface without visiting each device s host settings page On the main screen click the Batch Update Wizard button Z and select Upgrade Device Name This window appears Upgrade device name z o Host Name C Gv VSO4H C GV VSO4H 1 C Gv LxX4c3 C GV BX120D 8X120D E C GV BX320D 8X320D E C GV UBX3301 C DVR FE420 FE421 C GV FE420 FE421 C GV FE520 FE521 C Gv BX120D IP 192 168 3 83 192 168 0 137 192
130. tions 6 Optionally set up the following e polygonal areas for a blinking effect when trigger events occur See 9 1 4 Setting the Polygonal Area e view zones to illustrate the monitoring area on the E Map See 9 1 5 Setting the View Zone 7 Click the Remote E Map button The Remote E Map window appears Figure 9 11 You can click a camera icon to watch its live view For detail on the E Map Window see 9 7 6 The E Map Window Note By default each camera live view is displayed in a separate window You can also choose to display the live view on the Live View panel or Video Wall For detail see 8 7 Application Position For details on general settings of Remote E Map see 9 7 7 Configuring the Remote E Map 129 9 1 1 The E Map Editor Window nT Map Wiew New Map i New Map Host View x era CO g GV EBX2100 1 GV BX130D BX130D E 4 GV FD320D FD321D bol Host1 File Type Control Center Figure 9 2 The controls on the E Map Editor window No Name Description 1 Up Returns to the previous E Map file 2 Add Map Adds an E Map file 3 Add Host Adds a host folder in the Host View 4 Load Map Imports a floor plan 5 Rename Renames an E Map file and or folder 6 Delete Deletes an E Map file and or folder T Zoom In Zooms in on the floor plan 8 Zoom Out Zooms out on the floor plan 9 Fit to Screen Fits the floor plan to the E Map Editor Window 10 Actual Size Shows the floor plan in
131. trol Center you can access and configure the settings of Video Wall server GV Video Wall Server 1 Computer installed with multiple graphic cards Up to 200 Video Walls GV Contral Center GV US5B Dongle Computer installed with multiple graphic cards Figure 8 14 93 Note 1 A GV USB dongle with Video Wall function is required to connect to the Control Center 2 The number of monitors allowed depends on the capability of the Video Wall server s graphic card 3 For the minimum system requirements of a Video Wall server see 1 1 Minimum System Requirements An application of the Video Wall With the appropriate dongles the Control Center allows you to display application windows such as Remote eMap GIS Vital Sign Monitor Remote Desktop and Remote ViewLog on the defined monitors along with the Video Wall This establishment is illustrated below Scan Window Vital Sign Monitor a Dongle 1 Control Center Video Wall Vital Sign Monitor Figure 8 15 To create Scan Window and Zoom Window on the Video Wall see 8 3 5 Setting Up a Zoom Window and 8 3 6 Setting Up a Scan Window To create a Remote E Map see 9 1 Remote E Map To define the display position of applications on different monitors see 8 1 Application Position 94 8 Multi Monitors Applications 8 3 1 Setting Up a Video Wall Server You can build the Video Wall server on a dedicated server or with the GV Control Center A GV US
132. ttings on the client DVR and IP devices e created their own E Maps see 9 7 Remote E Map e activated Control Center Service on the host GV System GV VMS To access this function click the Remote E Map button X6 on the main window the E Map Window appears 135 9 1 4 Setting the Polygonal Area Use the Polygonal Map function to help you quickly locate a triggered device Draw an area on the map and it will flash when any device within the area is triggered Figure 9 7 Setting Up a Polygonal Map 1 On the E Map select a map icon S 2 Highlight and right click the map icon and select Edit Polygonal Map 3 Click on the map to start drawing a polygonal shape indicated by a yellow dotted line University Unitus Building Figure 9 8 4 After closing the shape right click the map and select Finish The enclosed area will be colored in blue When a device placed within the polygonal map is triggered the blue area will flash in blue and red 136 FJ Other Applications 9 1 5 Setting up the View Zone The View Zone function allows you to illustrate the monitored area of each device on the E Map pn Livingu we Hallway Figure 9 9 Setting Up a View Zone 1 In the E Map Editor window select a device icon 2 Highlight and right click the device icon and select Edit View Zone 3 Move the mouse to adjust the size and direction of the monitored area Hallway Figure 9 10 4 Rig
133. up List AAI ert Matrix 1 oy MD Group L 0 Panel Group 5 im E Map Group SU Gy L 4c3 E gt Matrix 1 T Mew Group E eg Group List Host List Figure 1 4 The buttons on the Group List No Name Description 1 Save Saves the changes made in Group List 2 Delete Deletes the selected group 3 Rename Group Renames the selected group 4 Add Group Adds a new group under the selected category 5 Camera Information Looks up device information and access its live view 6 Move up Moves the selected camera up in its group T Move down Moves the selected camera down in its group 8 Matrix Displays matrix view See 8 2 Matrix View 9 Remote ViewLog Plays back recordings of the selected camera See 5 2 Remote ViewLog Chapter 2 Getting Started 2 1 Installation Follow the steps below to install GV Control Center from the Software DVD or GeoVision Website Note By default the GV Control Center contains an Administrator account with the Login ID admin and no password Installing from Software DVD 1 Plug in the GV USB Dongle to the computer 2 Insert the Software DVD to your computer It runs automatically and a window appears 3 To install the USB device driver select Install or Remove GeoVision GV Series Driver and follow the on screen instructions 4 To install GV Control Center select Install GeoVision GV Control Center V3 1 2 0 and click Yes to accept the License Agreement 5 Click
134. vice No 4 Figure 2 2 must be activated first 2 Atthe Control Center highlight a host in the Host List or a group in the Group List Then click the Remote ViewLog button When the connection is established the ViewLog player will appear on the Control Center desktop For details on ViewLog see Chapter 4 GV DVR User s Manual on the Software DVD For Remote ViewLog service you can access the event files of up to 96 cameras by highlighting a group However the Multi View of ViewLog can only display up to 16 cameras So you need to select the desired cameras for Multi View mode On the ViewLog function panel click the Setting button to display the System Configuration dialog box and select the Multi View tab 52 Chapter 6 Remote DVR Applications 6 1 Remote DVR The Remote DVR service allows the Control Center to access client GV System GV VMS and configure their settings remotely This feature reduces the trips to each client DVR individually 6 1 1 Running the Remote DVR 1 The client DVR must activate Control Center Service No 3 Figure 2 2 first 2 At the Control Center highlight a host in the DVR List Then click the Remote Control button on the Host List and select Remote DVR If the connection is established the main screen of the client DVR will display on the Control Center desktop At the same time the client DVR will display the following message advising that the GV
135. w Layout Show Host Name Displays the host name of each I O device on the Advanced I O List Use User defined Text Allows you to modify the text of Alarm Level Figure 7 6 66 I O Central Panel 7 6 Viewing Connection Log You can view the connection status of the hosts On the panel toolbar click the Configure button No 1 Figure 7 2 and select View Notification This dialog box will appear The maximum of 1000 messages will be logged for reference 10 Central Panel Notify Max 1000 Time 11 5 2009 2 26 00 PM 11 5 2009 2 26 00 PM 11 5 2009 2 26 00 PM 11 5 2009 2 26 00 PM 11 5 2009 2 26 00 PM 11 5 2009 2 26 00 PM 11 5 2009 2 76 20 PM 11 5 2009 2 26 21 PM 11 5 2009 2 76 31 PM 11 5 2009 2 26 33 PM 11 5 2009 2 26 34 PM lt Message Host lt Giv IPSpeedDome gt is disconnected Host lt V 5 02 gt is disconnected Host lt Gy IPCAM H 264 gt is disconnected Host lt Gv S12 gt is disconnected Host lt Gv S12 11 gt is disconnected Host lt Giv IPCAM1 3M is disconnected Success to reconnect to the Host lt VWS 02 gt Success to reconnect to the Host lt GW IPCAM H Success to reconnect to the Host lt GV VS12 gt Success to reconnect to the Host lt Gi VS12 1 Success to reconnect to the Host GV IPCSM1 l gt Figure 7 10 Time Displays the time of the connection disconnection Message Displays the connection disconnection status of the hosts 67 C GeoVisio
136. when the Video Wall server program is launched Auto load the last status Select this option to automatically load the previous Video Wall settings Service port Corresponds to the Control Center server port See Figure 8 19 Listen port Corresponds to the port for searching servers in Control Center server See Figure 8 21 Monitor displays the number of monitors installed co ordinates and resolutions 5 Select the monitors to be used for Video Wall display and click OK 6 Right click the Video Wall server icon and select Start Service 96 8 Multi Monitors Applications Note 1 To find and modify the Listen port on the Control Center click the Search Server button No 5 Figure 1 2 2 With Control Center the VideoWallServer program is installed launched and activated by default 97 8 3 2 The Layout List After you have installed the Video Wall server on a dedicated server utilize the Layout List on the Control Center s main window to create a Video Wall layout For detailed steps see 8 3 3 Adding a Server and Configuring the Layout and 8 3 4 Activating the Channel and Layout Bo TI ER i a eh eG O df Officel ee A Layout 1 Figure 8 18 No Name Description 1 Host Setting Configures background settings decienicis Conical Accesses the PaSa of uae Wall server See 8 3 9 Remotely Accessing the Video Wall Server 3 Add Host Adds a host 4 Delete Host Deletes a host 5 Add Layout Ad
137. y Thursday Friday C Saturday oane Figure 7 13 Name Type a name for the schedule Mode Select a mode from the drop down list Time Define a time period you want the mode to run Days Check the day box es you want the mode to run 3 Click OK to apply the settings and click Save to return to the panel 4 To start the mode schedule click the Mode Schedule button No 2 Figure 7 2 and then select Mode Schedule Start 69 C GeoVision 7 8 Quick Link The Quick Link provides a quick access to triggered I O devices It is a separate window that displays all the groups established in the Advanced I O List The group icon flashes when any included I O device is triggered Clicking the flashing icon will bring you to the I O location in the Advanced 1 O List 70 To open the Quick Link window click the Toggle Quick Link button No 3 Figure 7 2 To open the Quick Link window at panel startup check the Show Quick Link option in Figure 7 9 A 1 0 Central Panel a El G Quick Link Mode Default ww Elevators I Standard IO List O a Advanced IO List S amp Host 1 DVR 1 Modules g Elevators A4 Module 1 B amp Input 1 F Input 1 Output 1 Input 2 Output 4 Input 3 el Exit Exit Lobby amp Input 4 Output 2 Output 1 f Output 2 d Lobby y Output 3 E Input 2 Output 4 Output 2 Figure 7 14 I O Central Panel 7

GV-Control Center

Contents

Download Pdf Manuals

Related Search

Related Contents