Service Manual - Test Equipment Depot
Contents
1. 2 Add the displayed weight and wait until the display shows the second total weight to add 2 3 of capacity A APPENDIX A EB SERVICE MODES SERVICE CALIBRATION A 2 SERVICE CALIBRATION Cont A 3 3 4 5 6 Add the displayed weight and wait until the display shows the third weightto add full capacity After accepting the weight the scale will restart the scale check process Remove the weight while the self check is occurring The display will show 0 0 Turn off the scale Refer to Figure A 1 and return the jumper to the normal position SCALE CONFIGURATION 1 After performing paragraph A 1 and xx000 is displayed press COUNT button to step through the available settings for points of resolution as shown on table A 1 disregard any settings not shown in the table TABLE A 1 SCALE RESOLUTION SETTINGS MODEL RESOLUTION CAPACITY 3 30000 3000 0 6 60000 6000 0 15 15000 15000 30 30000 30000 When the correct value is displayed press the TARE button to accept The display will now show the capacity press the COUNT button to step through the available settings When the correct value is shown press the TARE button to accept The display will now show 0 0 After the configuration of the scale has been done it must be calibrated perform procedure in paragraph A 2 A 2 8 0 2 5 1 3 9 2 PN 80251392 A SERVICE MANUAL EB SERIES SCALES Test2. Cont 3 Add mass specified in Table 4 2 The mass should be placed on the center of the Platform With the specified mass on the Platform all of the overload down stops should hit the bottom Load Cell Frame 4 Tighten the nut on the down stop screws so they will not move and recheck TABLE 4 2 LOAD CELL OVERLOAD PROTECTION STOP GAP SETTINGS SCALE CAPACITY OVERLOAD GAP SETTING MASS 3 kg 0 6mm 4 5kg 6kg 0 8mm 9kg 15 kg 1 0mm 22 5kg 30kg 1 6mm 45kg 5 Reassemble the scale 6 Calibrate the scale using Appendix A instructions Check all operations 4 6 REPLACING THE BATTERY This procedure is used when it is required to change the Battery WARNING DEATH OR SERIOUS INJURY CAN OCCUR e Charge the battery only with the charger in the scale Charging the battery under any other conditions may cause the battery to overheat emit hydrogen gas leak ignite or burst e Operate the battery at normal temperature range as specified for the scale e Do NOT short the battery terminals under any conditions e Do NOT dispose of the battery in incinerators or crush or try to open Dispose of the defective battery in accordance with local regulations for lead acid type batteries CAUTION e Check the battery for any sign of irregularities in appearance If there is any damage to the case such as cracks deformation or leakage replace the battery with a new one e Do NOT charge the battery with the charger te
3. perform Performance Tests see Section 3 6 4 5 CHAPTER 4 REPAIR PROCEDURES REPLACING THE LOAD CELL COMPONENT This procedure is used when it is desired to keep the existing Load Cell Frame and replace only the Load Cell The Load Cell Assembly is centrally located inside the scale When the new Load Cell is mounted to the existing Frame the Overload Protection Stops must be adjusted l 2 6 Refer lo Section 4 1 and remove Top Housing Refer to Section 4 4 and perform steps 1 through 4 The Load Cell and Frame can now be removed Make sure the Load Cell Cable in the Bottom Housing can be removed by cutting the tie wrap holding the battery wires together with the Load Cell cable Remove the Load Cell by unscrewing two bolts on the top of the Load Cell and two bolts on the bottom of the Load Cell See Figure 4 16 MOUNTING BOLTS TOP OF LOAD CELL BOTTOM OF LOAD CELL Figure 4 16 Load Cell Mounting Bolt Locations Place the replacement Load Cell on the Bottom Load Cell Frame into position and install the two bolts previously removed DO NOT TIGHTEN Postion the Top load Cell Frame on top of the Load Cell and install the two bolts previously removed DO NOT TIGHTEN TABLE 4 1 LOAD CELL SCREW TORQUE INFORMATION CAPACITY TORQUE kg 7 N m 62 in Ib 6 kg 10 N m 88 Ib 15 kg 10 N m 88 in Ib 30kg 10 N m 88 in Ib Align Top and Bottom Frames and tighten screws as indicated
4. Equipment Depot 800 517 8431 99 Washington Street Melrose MA 02176 TestEquipmentDepot com
5. Reading Mean Delta x Delta n number of Reading Mean Sum of Readings 10 Delta Reading Mean Standard Deviation The Square root of the sum of the Delta x Delta 9 5 Add the ten readings and divide the total by 10 to find the Mean average Mean Reading 1 Reading 2 Reading Reading 4 Reading 5 Reading 6 Reading 7 Reading 8 Reading 9 Reading 10 10 6 Calculate the Delta for each reading and record in the work sheet Delta 2 Reading Mean 7 Calculate the Delta x Delta for each reading and record in worksheet 8 Add the ten Delta x Delta values and divide by 9 9 Calculate the Standard Deviation by applying the square root of the result from step 8 Standard Deviation 3 9 CHAPTER 3 SCALE TESTING AND CALIBRATION 3 6 3 Off Center Load Test The Off Center Load Test is used determine whether displayed weight values will be affected by moving the sample to different areas of the weighing surface See Figure 3 4 This test must be performed using a single mass or the masses must be stacked 1 2 Zero the scale Place a mass equal to 1 3 of the full scale capacity in the center of the weighing surface Press the ZERO button to return the reading to zero Slide the mass halfway between the center and the rear edge of the Platform and record the reading Slide the mass to the center of the weighin
6. Recheck alignment CHAPTER 4 REPAIR PROCEDURES 45 REPLACING THE LOAD CELL COMPONENT Cont 7 Position the Load Cell and Frame in the Bottom Housing and install the four retaining screws through the Frame into the Bottom Housing See Figure 4 17 RETAINING SCREW TIE WRAP Figure 4 17 Load Cell Frame Mounting Bolt Locations 8 Install a cable clamp holding the Load Cell cable on the bottom of the Frame assembly to the other wires in the Housing 9 Proceed lo section 4 5 1 and set the overload stops 4 5 1 Overload Protection Stop Adjustment When a Load Cell has been replaced in the existing Load Cell frame the Overload Protection Stops must be set before calibrating or testing the scale This will require the use of mm feeler gauges ranging from 0 6 to 1 6 mm and masses See Table 4 2 1 Ateach Overload Stop Protection location insert the proper feeler gauge as specified in Table 4 2 2 With the correct feeler gauge positioned in the first Overload Protection Stop press down on the Frame and see if there is movement of the frame Adjust the Overload Protection Stop until there is no movement with the feeler gauge inserted The resulting gap should be the thickness of the feeler gauge Do all four stops and recheck until settings are correct ADJUSTING SCREW LOCKING NUT Figure 4 18 Overload Stop Locations 4 12 CHAPTER 4 REPAIR PROCEDURES 4 5 Overload Protection Stop Adjustment
7. Switch on the cover connected to the scale 3 6 CHAPTER 3 SCALE TESTING AND CALIBRATION 3 5 2 Battery Tests cont 3 With the AC Adapter connected measure the battery voltage at the battery terminals the voltage should be approximately 6 to 7 Volts dc when charging The voltage should be above 6 0 Volts dc ten minutes after charging stops NOTE Ifthe scale operates less than 80 hours charge the battery and turn on the scale and test how long the scale operates If the scale operates less than 40 hours with no backlight the battery should be replaced This is 5096 capacity 4 Ifthe battery requires replacement refer to Section 4 6 charge the new battery overnight and check scale performance 3 7 CHAPTER 3 SCALE TESTING AND CALIBRATION 3 6 PERFORMANCE TESTS Accurate performance of the EB Series Scales is determined by a series of three performance tests Repeatability Test Off Center Load Test and Linearity Test These tests are used to evaluate the scale performance before and after repairs Each scale tested must meet the requirements specified in each test as well as the specifications listed in Table 3 4 A scale passing each of these three tests complies with Ohaus specifications A segment display test determines if the display is working properly 3 6 1 Segment Display Test Connect the AC Adapter into a suitable power source and connect it to the scale Turn the scale on all 999999 segments are displayed followed by
8. a E E 4 4 Main PG Bodo REDIGOSITIGIE L usd dad aod p Rep akan 4 4 4 3 2 Display PC Board 4 7 43 3 LED Eta ed a oia dia S aq d 4 8 4 4 Replacing the Load Cell Assembly with frame 4 9 45 Replacing the Load Cell CompoONGliE succus 4 11 4 5 1 Overload Protection Stop 4 12 46 Replacing the Batory d i citra EP Ramada e iui as pads 4 13 CHAPTER 5 PARTS LISTS 5 PANS LISIS pcm b Del EB Series Scales u e Rae u S ERREUR tad MUR 5 2 APPENDIX A EB SERVICE MODES SERVICE CALIBRATION A EB Service spa HC A 1 Am Entering Seice MF a assaaassaskaqaspiakusrasphesinqaqaayqaqaqaquyphkkaqasankaqu A 1 nro S Dole eg E annie ipii eibi ina i ae aE A 1 A Scale CoD DNO s jissana Epi L Lunaqa an biswiiaakanninaqhanaspansphapasawaqaypapikpau A 2 CHAPTER 1 INTRODUCTION 1 INTRODUCTION This service manual contains instructions for the diagnosis and repair work to be performed by Ohaus Dealers or Ohaus authorized service centers Knowledge of the operation of the EB Scale is assumed Instruction manuals may be required with this service manual For complete information on operation refer to the Instruction Manual This manual cove
9. a countdown of 8 s 7 s 6 s and so on until all zeros are reached briefly followed by a software revision number This is a segment display test Figure 3 3 illustrates the starting of the display test Eero 7 71 3 fox J J 01 CI CI LO ZERO Gm o o 4 Figure 3 3 Segment Display 3 6 2 Repeatability Test Repeatability is the Standard Deviation of a set of similar weight readings Requirements To perform this test a single mass must be used for all readings The test mass should be approximately 1 2 of the capacity of the scale Before starting a repeatability test set up the scale as follows Set Up Enter the menu and adjust and record the following setting A Setthe Filler level to 1 B Set the zero display range to 1d C Set the scale to display the same units as the performance specifications Record Settings Filler Level Setting Auto Zero Tracking Setting Displayed Units Zero Relurn Mass Used 3 8 CHAPTER 3 SCALE TESTING AND CALIBRATION 3 6 2 Repeatability Test Cont Test Procedure 1 Zero the scale 2 Using a test mass approximately 1 2 the capacity of the scale place the mass on the center of platform Record the reading on the worksheet provided 3 Remove the mass from the Platform 4 Repeat this test starting at step 1 until you record a total of ten readings Fill in this worksheet with the ten 10 readings Reading Delta
10. carefully lift the Top Housing from the Base and tilt forward Reach under the Top Housing from the front and carefully disconnect the flexible cable from connector on the Display PC board 5 Set the Top Housing aside 4 1 CHAPTER 4 REPAIR PROCEDURES 4 2 REPLACING THE MEMBRANE SWITCH The membrane switch is affixed to the Top Housing ofthe scale To replace the Membrane Switch the scale must be disassembled to gain access to the switch connections 1 Refer to Section 4 1 and remove Top Housing CAUTION Use care in the next step as the Display PCB wiring is attached to the PC board 2 Place the scale in the upright position and carefully lift the Top Housing from the Base Housing Figure 4 2 Removing the Top Housing 3 Carefully disconnect the ribbon cable from connector on the Display PC board See Figure 4 3 Figure 4 3 Disconnecting the Ribbon Cable 4 2 CHAPTER 4 REPAIR PROCEDURES 4 2 REPLACING THE MEMBRANE SWITCH Cont 4 Disconnect the Membrane Switch Cable from the Display PCB as shown in Figure 4 4 Figure 4 4 Disconnecting the Membrane Switch Cable 5 the Top Housing lift up the defective Membrane Switch if necessary carefully prying it up with a knife and gently peel it off the Top Housing 6 Carefully clean the Top Housing membrane switch area removing all traces of adhesive The best method is to use a flat razor blade 7 Insert t
11. defec tive or LCD may be defective NOTE Ifthe LCD shows signs of damage such as cracked dim or partial characters the LCD should be replaced The Display PC Board is replaced as a whole assembly Check procedures in Tables 2 1 2 2 and 2 3 first and verify that other problems do not exist Then refer to Section 3 6 1 and test the LCD Display Replace Display PC Board or LCD See Repair Procedures 4 3 2 After repair proceed with Performance Tests in Sec tion 3 6 2 3 CHAPTER 2 DIAGNOSIS TABLE 2 5 SCALE READING INCORRECT OR UNSTABLE SYMPTOM PROBABLE CAUSE REMEDY Scale reads incorrectly Scale reading unstable Needs calibration Load Cell is damaged Main PC Board defective Perform Service Calibration in Appen dix A If calibration fails refer to Table 2 6 Test the Load Cell refer to Section 3 3 If defective replace see Section 4 4 After repair proceed with Performance Tests in Section 3 6 The Main PC Board should be tested in accordance with Section 3 4 The Main PC Board if defective should be re placed See Repair Procedures 4 3 After repair proceed with performance Tests in Section 3 6 TABLE 2 6 CANNOT CALIBRATE THE SCALE SYMPTOM PROBABLE CAUSE REMEDY Scale can be turned on but will not calibrate Incorrect weights Load cell assembly defec tive Main PC Board defective Verify that proper weights are use
12. for the most accurate results this is referred to as span calibration Calibration Weights Before beginning calibration make sure that the required calibration weights are available The model specific calibration points are listed in the Table 3 5 3 8 1 Calibration Points TABLE 3 5 CALIBRATION POINTS Model Calibration Unit Span Calibration EB3 kg 3 kg Ib 6 Ib 6 Kg 6 kg Ib 15 Ib 15 15 kg 10 30 10 kg 30 kg Ib 60 Ib NOTES 1 Calibration Units kg or Ib are selected in the Setup mode sub menu 3 8 2 NOTE 2 ASTM Class 4 or OIML Class F2 weights are required for calibration Span Calibration Enfer calibration by a long press of the ZERO and COUNT at the same time to initiate calibration The required calibration weight is displayed ex 3000g for a 3kg model At this time a different calibration weight value can be entered by pressing Place the corresponding calibration weight on the Platform the display flashes until the actual weight is registered and the calibration process ends the scale restarts then remove the weight 1 Different values of calibration masses can be used on the EB scale however it is recommended that the calibration mass used is close to or matches the maximum capacity of the scale for best accuracy 2 The calibration procedure can be canceled at any time by turning the scale off 3 If needed the factory default calibra
13. it is recommended that the calibration mass used is at or near the full capacity of the scale for maximum accuracy 1 4 SERVICE STRATEGY The repair method for the EB Series Scales is the direct substitution of major assemblies The available repair parts are listed in Table 5 1 The EB Series Scales contains 6 major replaceable assemblies Top Housing Membrane Switch Load Cell Assembly with Frame Lead Acid Rechargeable Battery Display PC Board with LCD and the Main PC Board NOTE The Load Cell and LCD may also be ordered and replaced separately This service manual contains sufficient information to isolate the problem replace the component test and restore the Scale to original factory specifications CHAPTER 2 DIAGNOSIS 2 DIAGNOSIS This section contains information needed to properly evaluate the reported problem and diagnose its cause 2 1 SCALE SETUP AND EXAMINATION Set up the scale according to the Instruction manual Allow the scale to stabilize to room temperature Examine the scale for signs of corrosion or physical damage 2 2 PRELIMINARY CHECKS Power up the scale using the customer s ac adapter In the case where the scale will not power up check the ac adapter Observe and record the error codes and software revision Record all menu settings as received 2 3 TROUBLESHOOTING TABLES Troubleshooting tables 2 1 through 2 7 identify actual types of problems that could be encountered with the scale The troubleshoo
14. ACING THE LOAD CELL ASSEMBLY WITH FRAME Cont 5 Refer to Section 4 5 1 and check overload stops on the new assembly 6 Liftthe Load Cell Assembly out of the Bottom Housing and replace with the new one Install screws 7 Referto Figure 3 2 and the label on the replacement Load Cell 8 Solderthe Load Cell wiring to the Main PC Board Make sure that the color coded wiring is installed in the correct locations 9 Reconnectthe battery and power connectors to the Main PC Board and connectthe battery terminal wiring to the battery 10 Connect the Display Cable from the Display PC Board to the Main PC Board 11 Install the Main PC Board into position in the slots on the Bottom Housing and secure with the screws and washers previously removed 12 Refer to Figure 4 15 and move the Main PC Board Jumper from normal to service position Sse eenn 5 19 RIS Pia 2 ML SERVICE Figure 4 15 Main PC Board Jumper Positions 13 Position the Top Housing in place over the scale temporarily and install the Platform Support and Platform in place 14 Calibrate the scale according to the Instructions in Appendix A After calibration replace the jumper into the normal position 15 Reassemble the scale and replace the Platform Support and Platform on top of the scale 16 Turn the scale off then on It will go through all the self testing When self testing is completed the scale should work nomally 17 After repair
15. C30 LOAD CELL TOP FRAME LOADCELL ASSEMBLY P N 80120039 P N 80120017 EC3 P N 80120018 EC6 P N 80120019 EC15 P N 80120020 EC30 LOAD CELL BOTTOM FRAME P N 80120040 MAIN PCB P N 80104190 POWER ON OFF SWITCH P N 80120021 DISPLAY CABLE P N 80120022 BOTTOM HOUSING OPEN BUBBLE LEVEL P N 80120042 Figure 5 2 Components in Bottom Housing of EB Series Scales 5 3 CHAPTER 5 PARTS LISTS TABLE 5 1 EB SERIES SCALES PARTS LIST PART NO 80120000 80120001 80120002 80120003 80120004 80251386 80251391 80120007 80120009 80120010 80104203 80104204 80120013 80120014 80120015 80120016 80120017 80120018 80120019 80120020 80120021 80120022 80104205 80120024 80120025 80120026 80120027 80120028 80104190 80104191 80120031 80120032 80120039 80120040 80120042 80251385 DESCRIPTION Adapter US 120V Adapter EU 230V Adapter GB 230V Adapter AU 240V Adapter JP 100V Switch Membrane Switch Membrane EBJP Platform support Platform Stainless Steel Overlay Back LCD 1pc Backlight 1pc Loadcell EC3 Loadcell EC6 Loadcell EC15 Loadcell EC30 Loadcell assembly EC3 Loadcell assembly EC6 Loadcell assembly EC15 Loadcell assembly EC30 Power switch assembly Cable Display PCB Housing Top Housing Bottom Adapter KR 230V Battery Battery wire harness Cover In use PCB Main PCB Display Kit hardware Foot Frame Loadcell T
16. TI 4 lt S Md ki yf QU r E o GR 4 1 T vom OAP PEPR A VUE 774 Y L M y 49562 vere G eeteer es eeereee er 4a Figure 4 8 Installing Display Cable to Main PC Board 4 5 CHAPTER 4 REPAIR PROCEDURES 4 3 1 Main Board Replacement Cont 11 Install the Main PC Board into position in the slots on the Bottom Housing and secure with the screws and washers previously removed 12 Connect the Battery connector to the Battery NOTE When a replacement Main PC Board is installed the scale must be put into a service mode first to enter parameters such as capacity and readability Calibration must also be performed see Appendix A 13 Refer to Figure 4 9 and move the Main PC Board Jumper from normal to service position NORMAL SERVICE Figure 4 9 Main PC Board Jumper Positions 14 Position the Top Housing in place over the scale temporarily and install the Platform Support and Platform in place 15 Set the capacity and readability see Appendix A 16 Calibrate the scale according to the Instructions in Appendix A After calibration turn off the scale and replace the jumper into the normal position 17 Reassemble the scale and replace the Platform Support and Platform on top of the scale 18 Turn t
17. Test Equipment 99 Washington Street Pd Depot Melrose MA 02176 Phone 781 665 1400 HAUS 1 800 517 8431 Toll Free 1 800 517 8431 EB SERIES SCALES SERVICE MANUAL OHAUS EB SERIES SCALES SERVICE MANUAL The information contained in this manual is believed to be accurate atthe time of publication but Ohaus Corporation assumes no liability arising from the use or misuse of this material Reproduction of this material is strictly prohibited Material in this manual is subject to change Copyright 2006 Ohaus Corporation all rights reserved Registered trademark of Ohaus Corporation TABLE OF CONTENTS CHAPTER 1 INTRODUCTION Page 1 I IOQUGII N PET 1 1 BNE 150 TT temm 1 1 Tools and y n Lu aa RC RR ORE ERE GEENA 1 2 1 2 1 Standard Tools and Test 1 2 poo 1 2 1 3 Calibration Masses Required duda dad bugie a a aquas ado 1 2 ES DIO PRSE 1 2 CHAPTER 2 DIAGNOSIS 2 leen a a unupas suu us st ua EET 2 1 2 1 Scale EXGPONDORO dace 2 1 22 cse scat rcm 2 1 2 3 Troubleshooting TODOS dpa 2 1 24 EB Soris Scales Error Code TODIG E 2 5 CHAPTER 3 SCALE TESTING AND CALIBRATION 3 Testing and Galibrglio u e 3 1 3 1 Testing the AC Adapter n 3 1 3 2 Testing the Memb
18. ard MOUNTING SCREW AND DISPLAY CABLE MOUNTING SCREW AND WASHER WASHER Figure 4 6 Main PC Board Screws and Washers Removal 5 Carefully lift the Main PC Board up and out of the slots in the supporting posts You may have to rock the Main PC Board from left to right to lift the board out CHAPTER 4 REPAIR PROCEDURES 4 3 1 Main Board Replacement Cont 6 Remove the Battery connector plug from the Main PC Board and the connector that connects to the On Off Switch See Figure 4 7 LOAD CELL WIRING BATTERY CONNECTOR ON OFF SWITCH CONNECTOR 4 PXRACPTRGUTE UT m es Figure 4 7 Disconnecting Battery and On Off Switch Connectors from Main PC Board 7 Unsolder the Load Cell wiring from the Main PC Board Note the position and color coding of the wires on the Main PC Board These will have to be soldered on the new PC Board in the same positions 8 On the replacement Main PC Board install the Battery and Switch connectors 9 Refer to Figure 3 2 and solder the Load Cell wiring to the replacement Main PC Board Make sure that the color coded wiring is installed in the correct locations 10 Connect the Display Cable to the Main PC Board connector See Figure 4 8 CAUTION THE DISPLAY CABLE CONNECTOR MUST BE CORRECTLY INSTALLED WITH THE TAB FACING UP DISPLAY CABLE DISPLAY CABLE CONNECTOR MAIN PC BOARD CONNECTOR TAB 4 E 5 7 E SPE T
19. asurements Prior to making the voltage measurements the battery should have been fully charged and tested 1 Disconnect power from the scale 2 Remove the Top housing refer to Section 4 1 and leave the Membrane Switch connected to the scale 3 Disconnect the battery from the Main PC Board 4 Remove screws and washers holding the Main PC Board and lift the board and lay flat b Connect the to the scale 6 Referto Figure 3 2 Interconnection Diagram which illustrates the interconnections to the Main PC Board and is shown as a top view 7 Turn the scale on 8 Using a DVM measure the excitation voltage across EXE and EXE leads it should be 5 volts dc This is the excitation voltage for the Load Cell and is regulated Ifthe voltage is lower replace the Main PC Board refer to Section 4 3 and then proceed with Performance Tests in accordance with Section 3 6 9 Measure incoming power from the AC Adapter connector shown in Figure 3 2 The voltage should read above 6 Volts dc with power on 10 Connect the battery to the Main PC Board and measure the voltage across Black and Red leads on the battery connector The full battery voltage should read a minimum of 6 0 Volts dc Ifthe voltage is lower the battery may require charging or it may be defective Refer to section 3 5 and test the battery 11 Perform simulator testing 3 4 CHAPTER 3 SCALE TESTING AND CALIBRATION 3 4 2 SimulatorTesting To perfor
20. ating or air conditioning ducts magnetic fields such as motors large transformers or vibrating sources such as machinery The power outlet should be grounded for safety Sufficient space should be provided around the scale as not to be affected by other equipment This will ensure that the scale is operated under ideal conditions CHAPTER 1 INTRODUCTION 1 2 TOOLS AND EQUIPMENT 1 2 1 Standard Tools and Test Equipment The service shop should contain the following equipment 1 Digital Voltmeter DVM Standard Electronics tool kit Desk magnifier on a stand Grounding mat and clip Razor blades ene 1 2 2 SpecialTools To service the Ohaus EB Series Scales the following equipment is recommended A Load Cell Simulator AC Adapter 220 V 60 Hz US Ohaus P N 80120000 AC Adapter 230 V 50 Hz EU Ohaus P N 80120001 AC Adapter 230 V 50 Hz Ohaus P N 80120002 AC Adapter 240 V 50 Hz AU Ohaus P N 80120003 AC Adapter 100 V 50 Hz JP Ohaus P N 80120004 AC Adapter 230V 50 Hz KR Ohaus P N 80120025 p Ot Asc pa Nac NOTE Adapters required for servicing are location dependent 1 3 CALIBRATION MASSES REQUIRED The masses required to test the EB Series Scales must meet the requirements of ASTM Class 4 or OIML Class F2 The mass values are listed in Table 1 1 TABLE 1 1 CALIBRATION MASSES MODEL Calibration Cal in kg Masses Totaling Note The EB Scales can be calibrated over a wide range however
21. d Test the Load Cell refer to Section 3 3 If defective replace see Section 4 4 After repair proceed with Performance Tests in Section 3 6 The Main PC Board should be tested in accordance with Section 3 4 The Main PC Board if defective should be replaced See Repair Procedures 4 3 After repair proceed with Performance Tests in Sec tion 3 6 2 4 2 4 EB SERIES SCALES ERROR CODE TABLE The EB Series Scales is equipped with software which will display an error condition when it occurs Review the listed codes and follow instructions to correct the problem CHAPTER 2 DIAGNOSIS TABLE 2 7 EB SERIES SCALES ERROR CODES ERROR CODE CAUSE REMEDY displayed The panis placed incorrectly Zero limit exceeded during power up Load Cell Assembly Defec tive Main PC Board defective Reposition the Platform correctly Ensure the Platform is empty before switch ing the scale on Test the Load Cell refer to Section 3 3 If defective replace see Section 4 4 After repair proceed with Performance Tests in Section 3 6 The Main PC Board should be tested in accordance with Section 3 4 The Main PC Board if defective should be replaced See Repair Procedures 4 3 After repair proceed with Performance Tests in Sec tion 3 6 OL displayed Load exceeds scale capac ity Load Cell Assembly Defec tive Main PC Board defective Reduce the load on the Platfor
22. ence mass on the center of the Platform and record the exact value all decimal places displayed 3 Remove the reference mass and verify that the display returns to Zero If it does not disregard the reading press ZERO to rezero the display and take the reading again 4 Place a mass equal to 1 4 of the full scale capacity on the Platform and press ZERO 5 Add the reference mass to the center of the Platform and record the exact value displayed 6 Remove the reference mass and verify that the display returns to zero If it does not disregard the reading press ZERO to rezero the display and take the reading again 7 Place a mass equal to 1 2 of the full scale capacity on the Platform and press ZERO 8 Add fhe reference mass to the center of the Platform and record the exact value displayed 9 Remove the reference mass and verify that the display returns to zero If it does not disregard the reading press ZERO to rezero the display and take the reading again 10 Place a mass equal to 3 4 of the full scale capacity on the Platform and press ZERO 1 1 the reference mass to the center of the Platform and record the exact value displayed 12 Remove the reference mass and verify that the display returns to zero If it does not disregard the reading press ZERO to rezero the display and take the reading again 13 Calculate the weight differences between the reading as shown in the recorded readings 14 The Maximum differ
23. ence should be less than or equal to the Linearity specification for the scale CHAPTER 3 SCALE TESTING AND CALIBRATION 3 6 4 Linearity Test cont Record Readings Reading 1 reference weight added to zero Reading 2 reference weight added at 1 4 full scale capacity Reading 3 reference weight added at 1 2 full scale capacity Reading 4 reference weight added at 3 4 full scale capacity Calculate Differences Reading 1 Reading 1 Reading 2 2 Reading 2 Reading 2 Reading 3 2 Reading 3 Reading 3 Reading 4 2 Maximum Difference CHAPTER 3 SCALE TESTING AND CALIBRATION 3 7 SPECIFICATIONS TABLE 3 4 EB SCALE SPECIFICATIONS Model EB3 5 Capacity x Readability 3 kg x 0 0001 kg 6 kg x 0 0002 kg 15 kg x 0 0005 kg 30 kg x 0 001 kg 3000gx 0 1 g 6000 g x 0 2 g 15000 g x 0 5 g 30000 g x 1 g 6 6 Ib x 0 0002 Ib 13 Ib x 0 0005 Ib 33 Ib x 0 001 Ib 66 Ib x 0 002 Ib 105 x0 005 oz 208 x 0 01 oz 528 x 0 02 oz 1 056 x 0 05 oz Weighing Uni Display 1 Window backlit LCD display 25 4 mm 1 High 6 digit 7 segment Power AC Adapter 12V DC 800mA Shipping Protection Shipping screw to avoid damage to sensitive components Shipping Weigh Humidity Range lt 90 relative humidity non condensing 3 13 CHAPTER 3 SCALE TESTING AND CALIBRATION 3 8 CALIBRATION Calibration The EB Series calibration can be calibrated using full scale capacity as the best method
24. f the voltage remains low ihe PC Board is defective and the Main PC Board must be replaced For Main PC Board replacement see Section 4 3 3 2 CHAPTER 3 SCALE TESTING AND CALIBRATION 3 3 2 Excitation and Output Voltage Test Cont 4 Refer to Figure 3 2 and measure the voltages on points and 4 SIG and SIG points These measurements represent the output of the Load Cell Repeat measurements at 5096 and full scale capacities See Table 3 3 for typical readings NOTE Table 3 3 indicates typical readings actual values can vary but should remain linear throughout the entire range If readings are out of tolerance replace the Load cell See Section 4 4 or 4 5 for Load Cell replacement TABLE 3 3 LOAD CELL OUTPUT READINGS NOMINAL OUTPUT IN MILLIVOLTS AT 5 VOLTS EXCITATION CAPACITY NO LOAD 5096 10096 3 kg 2 7 1 5 no load 3 2 no load 6 4 6 kg 1 9 1 5 no load 4 4 no load 8 8 15 kg 1 2 41 5 no load 5 2 no load 10 3 30kg 0 5 1 5 noload 4 9 no load 10 4 BATTERY TO POWER SWITCH w LOAD CELL TOP VIEW OF MAIN PCB JUMPER Figure 3 2 EB Series Scales Interconnection Diagram 3 3 CHAPTER 3 SCALE TESTING AND CALIBRATION 3 4 TESTING THE MAIN PC BOARD The Main PC Board can be tested by measuring voltages and by using a simulator The simulator replaces the Load Cell during testing and is a useful tool for diagnosing problems 3 4 1 MainPC Board Voltage Me
25. g surface and press the ZERO button to return the reading to zero Slide the mass halfway between the center and the left edge ofthe Platform and record the reading Slide the mass the center of the weighing surface and press the ZERO button to return the reading to zero Slide the mass halfway between the center and the right edge of the Platform and record the reading Slide the mass the center of the weighing surface and press the ZERO button to return the reading to zero Move the mass halfway between the center and the front edge of the Platform and record the reading 10 Maximum reading should be less than or equal to the OCL specifications for the scale Reading toward Rear Reading toward Left Reading toward Right Reading toward Front Maximum Reading Figure 3 4 Off Center Load Test Weight Locations 3 10 CHAPTER 3 SCALE TESTING AND CALIBRATION 3 6 4 Linearity Test The linearity test is used to determine the linearity of the scale throughout its operating range The results should be in accordance with the specifications shown above The reference mass should be approxi mately 1 8 of the full capacity of the scale NOTE The scale must pass the Off Center Load test and Repeatability Test before the Linearity Test is performed BE CERTAIN TO USE THE SAME REFERENCE MASS THROUGHOUT THE LINEARITY TEST 1 Press ZERO fo Zero the display 2 Place the refer
26. he cable from the new Membrane Switch through the hole in the Top Housing Peel off the protective film from the new Membrane Switch and carefully align and affix to the Top Housing 8 Press the Membrane Switch down uniformly Using your fingers with a cloth roll from the center of the Membrane Switch outward towards the edges to remove any air bubbles that may be trapped 9 Position the Top Housing in place over the Bottom Housing and connect the flexible cable from the Main PC Board to Display PC Board 10 Reassemble the scale by replacing the five screws at the bottom of the scale which secure the Top housing 11 Replace the Platform Support and Platform on top of the scale 4 3 CHAPTER 4 REPAIR PROCEDURES 4 3 MAIN PC BOARD The Main PC Board is located in the Bottom Housing To replace the Main PC Board it is necessary to disassemble the scale 4 3 1 Main PC Board Replacement 1 Referto Section 4 1 and remove the Top Housing 2 rear of the Bottom Housing disconnect the Red battery lead from the Battery See Figure 4 5 for location This is necessary to prevent damge to the circuitry and the Battery if the wiring is accidentally shorted during servicing Figure 4 5 Battery Terminal Connector Note the positioning of the cable for reassembly 3 Remove the screws and washers holding the Main PC Board in place See Figure 4 6 4 Disconnect the Display Cable coming from the Display PC Board on the Main PC Bo
27. he scale on It will go through all the self testing and operate normally 19 After repair initiate Performance Tests see Section 3 6 4 6 CHAPTER 4 REPAIR PROCEDURES 4 3 2 Display PC Board Replacement 1 Referto Section 4 1 and remove the Top Housing 2 Disconnect the Ribbon Cable from the Display PC board See Figure 4 10 N Figure 4 10 Disconnecting the Ribbon Cable 3 Disconnect the Membrane Switch Cable from the Display PC Board See Figure 4 11 Figure 4 11 Disconnecting the Membrane Switch Cable from the Display PC Board 4 Remove the six screws that hold the Display PC Board to the Top Housing See Figure 4 12 Figure 4 12 Removing Screws from the Display PC Board 5 Examine the replacement Display PC board and remove all protective plastic film that may be covering the LCD display 4 7 CHAPTER 4 REPAIR PROCEDURES 4 3 2 Display PC Board Replacement Cont 6 Install the replacement Display PC board with the screws previously removed 7 Connectthe Membrane Switch Cable from the Top Housing to the Display PC Board and the Ribbon Cable from the Main PC Board to the Display PC Board 8 Reassemble and test the scale according to Performance Tests in section 3 6 4 3 3 LCDReplacement This procedure is performed when an LCD shows signs of visible damage such as a cracked glass or partial display and the scale operates normally in all other functions NOTE This proced
28. he voltage is below or above these readings replace the Adapter This is the actual battery voltage while charging 3 2 TESTING THE MEMBRANE SWITCH The Membrane Switch can be tested after removing the Top Housing from the Bottom Housing l 2 Refer to Section 4 1 and remove the Top Housing Disconnect the Membrane Switch connector from the Display PCB Referto Table 3 1 Using an Ohmmeter measure the resistance between the pins shown in the table The readings should be less than 70 Ohms for each button If continuity is not present or the resistance is higher than 100 Ohms the Membrane Switch is defective Replace the Membrane Switch Figure 3 1 illustrates the cable connector and pin locations Reassemble Top Housing to Bottom Housing TABLE 3 1 MEMBRANE SWITCH PIN CONNECTIONS PANEL BUTTON PINS M 1 to 2 UNITS 1 to 3 ZERO 1104 TARE 1105 00000000 8 CHECK 1106 Figure 3 1 Membrane Switch Connector COUNT 1 107 9 1108 3 CHAPTER 3 SCALE TESTING AND CALIBRATION 3 3 TESTING THE LOAD CELL ASSEMBLY This section contains two methods of testing the Load cell 3 3 1 Resistance Test 1 Referto Section 4 1 and remove the Top Housing 2 Referto Figure 3 2 and record color code and position of the wires from the Load Cell Unsolderthe Load Cell cable from the Main PC Board Using an Ohmmeter measure in accordance with Table 3 2 Load Cell Resista
29. hydrogen gas Leak ignite or burst e Operate the battery at normal temperature range as specified for the scale e Do NOT short the battery terminals under any conditions e DoNOTdispose ofthe battery in incinerators or crush or try to open Dispose ofthe defective battery in accordance with local regulations for lead acid type batteries CAUTION e Checkthe battery for any sign of irregularities in appearance If there 15 any damage to the case such as cracks deformation or leakage replace the battery with a new one e Do NOT charge the battery with the charger terminals reversed 3 5 2 Battery Tests A new battery when installed in the EB Series Scales will provide many years of useful service The length of service depends upon the type of use of the scale If left connected to the AC Adapter all of the time the battery receives a small charge when the battery voltage is low service life can be many years The EB Series Scales can be operated for up to 80 hours per charge Battery life can be maximized by frequent charging m Upon receipt of the scale plug in the AC Adapter to a power source and the scale Allow the battery to charge If the battery required a charge the battery indicator on the front of the LCD display will indicate charging Green indicates fully charged yellow indicates a partial charge and red indicates the battery is nearly discharged Refer to Section 4 1 and remove the Top Housing Leave the Membrane
30. is functioning properly or improperly E With the scale on and the Membrane Switch connected enter calibration mode by pressing and holding the ZERO switch until CAL is displayed and perform calibration Follow the scale prompts When the scale indicates a given weight should be placed on the scale set the simulator to an equivalent value based on Table 3 3 For example when a span value of kg for a 3 kg scale is shown the simulator should be set to output 9 1mV 2 7 6 4 3 5 CHAPTER 3 SCALE TESTING AND CALIBRATION Calibration Test Cont 3 Upon completion of calibration the Main PC Board can be further checked using the Simulator to simulate various weight values If simulator settings and weight reading on the scale agree the Main PC Board is functional If the scale readings vary or do not agree with readings in Table 3 3 the Main PC Board is defective and should be replaced Remove power from the scale and proceed with Section 4 3 and replace the Main PC Board After Main PC Board replacement and assembly of the scale proceed with Performance Tests in Section 3 6 3 5 TESTING THE BATTERY The EB Series Scales contains a rechargable 6 0 Volt 5 0 Ampere rated Lead Acid Battery 3 5 1 Precautions for Battery Handling WARNING DEATH OR SERIOUS INJURY CAN OCCUR Charge the battery only with the charger inthe scale Charging the battery under any other conditions may cause the battery to overheat emit
31. m Test the Load Cell refer to Section 3 3 If defective replace see Section 4 4 After repair proceed with Performance Tests in Section 3 6 The Main PC Board should be tested in accordance with Section 3 4 The Main PC Board if defective should be replaced See Repair Procedures 4 3 After repair proceed with Performance Tests in Sec tion 3 6 2 0 CHAPTER 2 DIAGNOSIS 2 6 CHAPTER 3 SCALE TESTING AND CALIBRATION 3 TESTING AND CALIBRATION This section of the manual contains testing procedures of the individual replaceable components and the scale Before and after servicing the EB Series Scales an operational test and various performance tests should be made to ascertain whether or not the scale meets specifications 3 1 TESTING THE AC ADAPTER The AC Adapters are available with different input voltages Before testing the Adapter make sure the Adapter rating agrees with the power source being used All Adapters are rated with an output of 12 V dc at 800mA Adapters can fail by having shorted internal windings producing low voltage output or no output at all l Plug the AC Adapter in a suitable power source and measure the open circuit voltage on connector it should be 10 V dc to 16 V dc Refer to Section 4 1 and remove the Top Housing Plug the AC Adapter into the scale and measure the voltage on the battery terminals Turn the scale on The voltage should be 6 5 Volts dc minimum and 7 5 Volts dc maximum Ift
32. m these tests the use of a Simulator is required The basic function of a Simulator is to simulate the output of a full bridge Load Cell allowing the scale to be separated from the Load Cell for the purposes of troubleshooting and calibration The Load Cell used in the scale is rated at 2mV V output with a 5 Volt excitation voltage applied General Load Test This test checks the Main PC Board circuitry by simulating accurate load cell voltages at 096 5096 and 10096 load capacities 1 2 Disconnect power from the scale Remove the Top housing refer to Section 4 1 and leave the Membrane Switch connected to the scale Disconnect the battery Unsolder the Load Cell cable from the Main PC Board Refer to Figure 3 2 for location With the Simulator set to zero connect the Simulator test leads to the Main PCB by soldering test leads in place of the load cell Make sure connections are correct Connect a known good AC Adapter to the scale and connect to a power source Turn on fhe scale an error may be displayed This is normal Review Table 3 3 and adjust the Simulator to simulate 096 load 50 load and 100 load for the rated capacity of the scale If the resulting readings are unstable the Main PC Board is defective Use the Simulator to calibrate the scale in the next procedure to verify if the Main PC Board is good or bad Calibration Test This test calibrates the scale using the simulator and can verify that the Main PC Board
33. nce Readings on the cable If the resistance readings vary more than the table readings allow replace the Load Cell in accordance with the procedure in Section 4 4 or4 5 This resistance test is useful in determining ifthe Load Cell has been severely damaged by a short or open circuit which has occurred on the cell or wiring If the Load Cell resistance readings are good continue with this procedure TABLE 3 2 LOAD CELL RESISTANCE READINGS MEASUREMENT POINTS READING Wires 2 amp 5 415 15 Ohms Wires 3 amp 4 350 4 3 Ohms NOTE Wires 2 3 4 and 5 must be isolated from chassis ground and shield Resistance should be greater than 5 megohms A lower reading indicates a short in either in the Load Cell cable or the Load Cell 4 Reconnect Load cell cable to the Main PCB 3 3 2 Excitation and Output Voltage Test NOTES 1 The following steps involve power applied to the scale 2 Load Cell solder contacts can be used as measuring points See Figure 3 2 1 Insert the Platform Support into the Load Cell Frame and place the Platform on top 2 Turn on power to the scale 3 With no load on the Platform first measure the excitation voltage across point 2 and 5 Load Cell connection on the PCB This voltage must be 5 0 Volts dc with the Load cell connected If the voltage is lower disconnect the Load Cell cable from the PC Board and measure again If the voltage is 5 Volts dc the Load Cell is defective and must be replaced I
34. op Frame Loadcell Bottom Level Bubble Overlay Front 5 4 APPENDIX A EB SERVICE MODES SERVICE CALIBRATION A EB SERVICE MODES This Appendix describes the Service menu and sub menus which allow authorized service personnel to configure the EB scale Configuration settings include setting the capacity and resolution and setting the decimal point position ENTERING THE SERVICE MENU 1 Open the scale housing and move the jumper to the service position as shown in Figure C804B D 2004 3 31 NORMAL SERVICE Figure A 1 Main PC Board Jumper Positions 2 Turn on the scale and press and hold the TARE COUNT and ZERO buttons simultaneously while the display is counting down release when either 0 0 or xx000 is displayed Notes 1 Ifthe PCB has calibration data the display will indicate 0 0 When 0 0 is displayed proceed to paragraph A 2 Calibration 2 If a new PCB has been installed the display will indicate the resolution of the scale xx000 where xx 12 15 30 60 or 75 When xx000 is displayed proceed to paragraph A 3 Scale Configuration A 2 SERVICE CALIBRATION Service calibration utilizes a three point calibration technique where calibration weights of 1 3 2 3 and full capacity are used If after performing paragraph A 1 and 0 0 is displayed proceed as follows 1 Lightly depress the Platform and wait until the display shows the first calibration weight to add 1 3 of capacity
35. rane Switch 3 33 Testing the Load Gall Assembly aca a ae eh bnnc edid 3 2 Resistance WGN zu a EET rrr 3 2 3 3 2 Excitation and Output Voltage Test rete rh b ERU it nidi 3 2 34 Testing he Main PC Boord a nrnna 3 4 3 4 1 Main PC Board Voltage Measurement s rr 3 4 34 2 Simulator TOS DB tnl astu 3 5 SA eSHng INE BOB 2 u sa nn bend uni a a uu 3 6 3 5 1 Precautions for Battery Handling ui eben te 3 6 99 2 Batto u ann ULT 3 6 36 Porormmance TOSS a 3 8 3 6 1 T S T 3 8 3 6 2 Repeatability WEST 3 8 Off Contor Logd ToS TT 3 10 DEL TT 3 11 p eGifioglloliSu s u uuu ua una a ro 3 13 vs Calbiatiom Qurucu u na qia assqa 3 14 3 8 1 Calibration n Sa a dad dS ih ood tid rob bea 3 14 PR RN PE a mu 3 14 92 S TOO OTT ncm 3 15 TABLE OF CONTENTS Cont CHAPTER 4 REPAIR PROCEDURES Page 4 Rep PIOGBUIBS oerni ib p n uuu Q aua QUERI a asum ipa aqa a atau sa Q 4 1 41 Removing Top THOM SNE u u L qaa 4 1 42 Replacing the Membrane Switch nn 4 2 Lo Man PO BOGO NET
36. rminals reversed 1 Referto section 4 1 and remove the Top housing 4 13 CHAPTER 4 REPAIR PROCEDURES 4 6 REPLACING THE BATTERY Cont 2 Disconnect the two wires from the battery See Figure 4 19 which is a close up view of the battery Figure 4 19 Battery Connections 3 Remove the Battery from the Bottom Housing 4 Install a replacement Battery into the same position as the original Battery The positive terminal Red should be facing up 5 Connect the wires to the Battery Make sure the Red wire is attached to the positive terminal on the Battery and the Black wire is attached to the negative terminal on the Battery Note The Battery is held in place by the Top Housing that has a cutout and foam backing When the Top Housing is installed the Battery is held in place CAUTION Dispose of the Battery according to local regulations for hazardous materials Do not incinerate crush or throw out in regular garbage containers Battery contains an acid solution 6 Reassemble the scale and connect the ac adapter to the scale and plug into a power source Allow the battery to charge for at least 12 hours with the scale off A new battery requires a long charge period to obtain maximum service when operating the scale for the first time CHAPTER 5 PARTS LISTS 5 PARTS LISTS This section of the manual contains exploded views and parts lists for the EB Series Scales The exploded view drawings identify the replaceable par
37. rs maintenance on the following EB Series Scales Models EB3 6 EB15 and EB30 The contents of this manual are contained in five chapters and an Appendix with Service Mode and Service Calibration instructions Chapter 1 Introduction Contains information about service facilities tools test equipment test masses and service strategy Chapter 2 Diagnosis Contains information on problem verification scale examination preliminary checks and troubleshooting tables Chapter 3 Testing Contains testing procedures an interconnection diagram performance tests battery tests specifications and calibration Chapter 4 Repair Procedures Contains detailed repair procedures for all major components Chapter 5 Parts Lists Contains overall views identifying all major serviceable replacement components with associated parts lists Appendix A EB Service Modes Service Calibration Contains configuration capacity and resolution settings for the EB Series Scales in a service mode 1 1 SERVICE FACILITIES The service area should be a stable environment The bench area should be clean and should contain an antistatic mat with a personnel grounding clip to protect internal circuit boards The ideal electrical power source for the scales should be a dedicated line to avoid sudden fluctuations or voltage drops caused by external equipment drawing heavy current The service area for the scales should be away from direct sunlight overhead he
38. s dc minimum If voltage is not present at the connector disconnect the leads from the battery and make a continuity test between the connectors on the Harness to the con nector on the Main PC Board Resis tance should be 0 ohms for the red lead and O ohms forthe black lead If an open condition exists replace wiring and con nector as necessary If OK proceed Refer to Section 3 2 and test the Mem brane Switch Replace if necessary See Repair Procedure 4 2 If the scale fails to turn on with a new Membrane Switch the Main PC Board should be tested in accordance with Section 3 4 The Main PC Board if defec tive should be replaced See Repair Procedures 4 3 Affer repair proceed with Performance Tests in Section 3 6 2 2 CHAPTER 2 DIAGNOSIS TABLE 2 3 SCALE DOES NOT RESPOND TO FRONT PANEL CONTROLS SYMPTOM PROBABLE CAUSE REMEDY Scale does not respond to front panel controls Membrane Switch is defec tive Refer to Section 3 2 and test the Mem brane switch Replace if necessary See Repair Procedure 4 2 If membrane switches are OK refer to Section 3 4 and test the Main PC Board If defec tive replace the Main PC Board See Repair Procedures 4 3 After repair proceed with Performance Tests in Sec tion 3 6 TABLE 2 4 NO DISPLAY OR PARTIAL DISPLAY SYMPTOM PROBABLE CAUSE REMEDY Display is noton or partial char acters are displayed Display PC Board is
39. s pressed turns off after 5 seconds of inactivity on oFF um xS Zero Display Range Sets the range in which the Zero reading is maintained The following settings are available 0 59 1d 2d 4d d scale division Filtering Sets the level in which the Stable indication turns on the higher the setting the faster the stabilization time The following settings are available O 1 2 3 levels CHAPTER 3 SCALE TESTING AND CALIBRATION 3 16 CHAPTER 4 REPAIR PROCEDURES 4 REPAIR PROCEDURES This section describes how to change individual components of the EB Series Scales When doing this please refer to the drawings and parts lists in Section 5 Important After replacing components an operational test ofthe scale must always be carried out see Section 3 6 4 1 REMOVING TOP HOUSING To gain access to the components in the scale perform the following procedures 1 Remove power from the scale by disconnecting the AC adapter Make sure the scale is off 2 Carefully lift and remove the Platform and Platform Support from the scale 3 Turn the scale over and remove the five screws which hold the Top Housing Refer to Figure 4 RETAINING SCREW RETAINING SCREW RETAINING SCREWS Figure 4 1 Top Housing Retaining Screws Location CAUTION Use care in the next step as the Display PCB wiring is attached to the Main PC board 4 Place the scale in the upright position and
40. ting tables refer to an interconnection diagram in Section 3 to assist in locating the problem 2 1 SCALE WILL NOT TURN ON WITH AC ADAPTER SYMPTOM PROBABLE CAUSE REMEDY Scale will not tum on with AC Adapter defective Refer to Section 3 1 and check the ac adapter supplied adapter voltage output If voltage is low or nonexistent replace the ac adapter If OK proceed Membrane Switch defective Refer to Section 3 2 and test the Mem brane Switch Replace if necessary See Repair Procedure 4 2 Main PC Board is defective scale fails to turn on with a new Membrane Switch the Main PC Board should be tested in accordance with section 3 4 The Main PC Board if defective should be replaced See Re pair Procedures 4 3 After repair pro ceed with Performance Tests in Section 3 6 2 1 CHAPTER 2 DIAGNOSIS TABLE 2 2 SCALE WILL NOT TURN ON USING BATTERY POWER SYMPTOM PROBABLE CAUSE REMEDY Scale will not turn on using battery power Battery discharged or de fective Wiring harness defective or battery clips connection broken Membrane Switch defec tive Main PC Board is defec tive Refer to Section 3 5 and test the battery Replace if necessary See Repair Proce dure 4 6 Refer to section 4 1 and open the scale Check voltage at battery contacts first Check dc voltage atthe battery connector on the Main PC Board Voltage should read approximately 6 Volt
41. tion value can be recovered As the scale is turned on press TARE and COUNT at the same time during power on sequence The power on sequence will re cycle and the scale will re initiate with the default calibration CHAPTER 3 SCALE TESTING AND CALIBRATION 3 9 SCALE SETTINGS The EB scale contains four user selectable scale settings Setup mode These are as follows Scale Increment Backlight Zero Tracking Range and Filtering A description of each setting is explained below 1 To enter the Setup mode press and then release COUNT and at the same time to enter into the user selectable scale settings 2 In the Setup mode press to step through available settings 3 Press Enter to accept the displayed setting and proceed to the next parameter 4 Press Exit to proceed to the next parameter without saving any changes mL Of EL Ri Fa d model dependent settings AU r Lon 0 59 T OFF E 2 2d 3 4d Levels d scale division x Scale increment Sets the displayed scale increment also known as readability or graduation Selectable setup values will be model dependent and are equivalent to within 30 000 to 3 000 scale divisions Ee Backlight Sets the activation mode of the backlight M The following settings are available AU Auto on with items greater than 9d placed on the Platform or any button i
42. ts NOTE In all cases where a part is replaced the scale must be thoroughly checked after the replacement is made The scale MUST meet the parameters of all applicable specifications in this manual If further technical information is needed in the United States call toll free 1 800 526 0659 between 8 00 a m and 4 00 p m EST An Ohaus factory service technician will be available to provide assistance Outside the U S A please visit our site www Ohaus com to locate the nearest Ohaus office Ohaus Corporation 19A Chapin Road P O Box 2033 Pine Brook NJ 07058 USA Tel 973 377 9000 Fax 973 944 7177 5 CHAPTER 5 PARTS LISTS 5 EB Series Scales Components PLATFORM P N 80120009 SUITES PLATFORM SUPPORT P N 80104205 P N 80120007 TOP HOUSING OPEN LCD P N 80104203 Sea DISPLAY PCB P N 80104191 MEMBRANE SWITCH P N 80251386 FRONT OVERLAY P N 80251391 EBJP P N 80251391 EBJP P N 80251385 EB SCALE FULLY ASSEMBLED FEET P N 80120032 1 Pc ADAPTER P N 80120000 US P N 80120001 EU P N 80120002 GB lt P N 80120003 AU HARDWARE KIT P N 80120004 JP P N 80120031 P N 80120025 KR BOTTOM HOUSING P N 80120024 Figure 5 1 Major Components of EB Series Scales 5 2 CHAPTER 5 PARTS LISTS 5 1 EB Series Scales Components Cont LOADCELL BATTERY P N 80120013 P N 80120026 P N 80120014 EC6 P N 80120015 EC15 P N 80120016 E
43. ure is very difficult and should not be attempted unless you have the proper tools 1 Perform steps 1 through 4 of Section 4 3 2 2 Carefully unsolder all contacts of the defective LCD and remove the LCD All solder holes on the Display PC board must clean and open to accept the pins of the LCD 3 Solderall connections check the Display PC Board and make sure that solder has not spilled over to other connections Remove any protective film from the LCD and replace the LCD 4 Continue with steps 6 through 8 of Section 4 3 2 4 8 CHAPTER 4 REPAIR PROCEDURES 4 4 REPLACING THE LOAD CELL ASSEMBLY WITH FRAME The Load Cell Assembly is centrally located inside the scale The Load Cell is factory assembled and the overload protection stops are installed The overload protection stops should be checked before installation 1 Referto Section 4 1 and remove Top Housing 2 Turn the scale over and remove the four feet by unscrewing them counter clockwise The feet are actually screwed into the Load Cell Frame Figure 4 13 Bottom of Scale Feet 3 Referto Section 4 3 1 and perform steps 1 through 7 to gain access to the Load Cell wiring on the Main PC Board and unsolder the connections 4 Remove the four screws holding the Load Cell Assembly to the bottom housing See Figure 4 14 for screw locations Figure 4 14 Load Cell Retaining Screw Locations 4 9 CHAPTER 4 REPAIR PROCEDURES 4 4 REPL
Download Pdf Manuals
Related Search