ICA-500 User's manual
Contents
1. 64 Appendix B Troubleshootinsg 64 APPENDIX C BANDWIDTH CALCULATION 68 Appendix Bandwidth Calculation 68 APPENDIX D SPECIFICA TIODN5Z uqa a aq m Appendix D Specifications l l u u s Susu Chapter 1 Introduction This Chapter provides details of the ICA 500 s features components and capabilities Overview As broadband communication gets more and more popular it becomes easier to transfer video and audio through network Traditional surveillance system is gradually evolving to be deployed in packet switching TCP IP network PLANET ICA 500 provides an advanced digital solution of Internet Camera with pan and tilt capability to meet more application demands It supports wired Ethernet networking ICA 500 can be placed either in a LAN or an available xDSL Cable modem connection ICA 500 also supports DDNS With its Plug N Watch capability a network administrator or system operator can seamlessly complete network deployment in simply minutes Combining 1 3 inch color CCD sensor with the advanced motion JPEG video compression technology sharp high quality video is digitized and delivered by the adva2. 23 Network C 25 lt u Oq Q 28 IP Filter Sree u Z TT 28 BO JlieptESCEe8 kuu uu u iu a a 3 Qu s asa 30 SNI TP Sere u uuu i a aS 31 Alarm 1 amp Alarm 2 Screen 34 sScheiule Sere u luu EENE y y 34 Motion Detection Screen 35 Time Setting Sereen RR 36 37 Firmware upgrade Screen 38 Factory Default u aaa a aa akauassssqayaskaspasayqasqascakayawasqasqaqpakkasqawasqa 39 ACTIVEX C OMEN u y uuu uksa ha 40 u uuu u u eus ve u 46 INSTALEATION u 46 HOW a 51 APPENDIX TROUBLESHOOTING 63 Appendix Alarm Connector 63 APPENDIX B TROUBLESHOOTING
3. amp Cernere 13 Canis 14 15 Fesi CamView Add Camera Screen 15 You then select the camera in the Cameras list the main screen click OK to establish a connection and view live video Please check respective chapter for further details of viewing Video using either the Windows Viewing Recording utility or Web Browser 16 Chapter 4 Web based Management This Chapter provides Setup details of the ICA 500 s Web based Interface This Chapter is for Administrators only Introduction The ICA 500 can be configured using your Web Browser The ICA 500 must have an IP address which is compatible with your PC Connecting to ICA 500 lf you have run the CamView utility the screen provided a button k a Clicking this button will immediately connect to the ICA 500 f using only your Web Browser use the following procedure to establish a connection from your PC to the ICA 500 e Once connected you can add the 500 to your Browser s Favorites or Bookmarks Connecting using your Web Browser 1 Start your web browser 2 Inthe Address box enter HTTP and the IP Address of the ICA 500 as in this example which uses the ICA 500 s default IP Address HTTP 192 168 0 20 3 Default username password for machine login admin no password 4 Ifthe Administrator ID and Password have been assigned
4. Motion Detection L sensor Periodical sending sensor SAVE CANCEL SMTP Screen Network Settings SMTP server Enter the address of SMTP server used to send the mail Please name ensure the server is using SMTP protocol and able to relay mails for you Some SMTP server may require authentication Please enable the Check Password and enter the Account Password fields below for authentication Username Enter the Username Password for your SMTP account Password Sender s Mail Enter the sender e mail address in the field This field must be Box entered with a valid e mail format Receiver s Mail Enter the receiver e mail address in the field Box Subject Enter the subject of outgoing mail Mode Motion Detection Sensor1 Sensor2 Periodical sending Off Please select send a captured image mode 31 Setup CF memory card setting or view the pictures stored CF memory card User can store the pictures into CF memory card by enabling this function It is useful to keep image as evidence even though without remote surveillance and remote recording Image Memory Enable I Disable File Name Date Time V Sequence number Overwrite I Or OFF Capacity Warning Send Mail Q orF Id Motion Detection Sensor Periodical sending Sensor Free Space Memory Content Image Memory Screen Note This function is for CF memory card enabled version only If this option is not listed on se
5. Recording File Path Save Current Picture As This screen is displayed when you click the Save Current Picture As menu on the ActiveX control How to configure Motion Detection e Please select the Save Current Picture As to save the current display image into the local PC e Please input the saved file name and click Save button e Please select the file to display the saved image by using any one of graph editing tools 44 Trigger Capture b T ore T 18 W era hu PD ipa 45 Chapter 5 Client UTILITY INSTALLATION The CamView utility for ICA 500 is a powerful utility for video recording viewing and camera administrations Please insert the user s manual CD and start the CamView installation from the default page or manually browse the Utility folder in the CD to install the software 5 1 CamView Installation Run setup exe to start installation A welcome message is shown as the following figure and then hit the Next button to continue 15 Setup CamYiev Welcome to the CamView Setup wizard Tare will install 7 1 2 on your computer Itis recommended that you close all other applications before continuing Cick Mest to continue or Cancel ta exit Setup Read license agreement first please If you accept the agreement select accept the agreement and then hit the Nex
6. Setup has finished installing Cam View on your compute The application may be launched by selecting the installed icons Finish to exit Sctup HOW TO USE Cam 1e After successfully installing the utility this icon will be added to the desktop Double click on it to launch the program 51 5 2 CamView User Interface CamView main screen P 5 2 1 Date and Time The current date and time of the computer are displayed here 5 2 2 Viewer Screen CamView is able to monitor up to 16 Internet cameras Users may choose different layout to monitor different sites The available camera display modes are shown below Single Only one viewer displays video e 2x2 The screen is divided into 4 sub screens e 3 3 The screen is divided into 9 sub screens e 4 4 The screen is divided into 16 sub screens 5 2 3 Camera and Layout Selection Here is a combo box to select cameras When you select a camera here you can press buttons below the combo box to start the recording snapshot tasks and so on Moreover there are four buttons for you to specify the layout of the screen 5 2 4 Recording and Playback Here are buttons to record snapshot and playback 5 2 5 Camera and Application Settings Here are buttons to set the camera or the application program 52 5 2 6 Camera Zoom Here are two buttons to zoom in or zoom ou on the image Note camera zoom feature is reserved for future
7. bandwidth between client and server and quality setting of server Here is a guideline to help you roughly estimate the bandwidth requirements form your ICA 500 Image bandwidth is approximately equal to the average frame rate in frames per second multiplied by the average frame data size in kilobits Frame data size or the number of bits comprising a single video frame varies a great deal from depending on scene complexity lighting conditions camera noise etc The table shown below is reference figures Actual results generated by the ICA 500 may be varying Image Resolution Average range of Data Sizes 176 x 144 QCIF 20 40k bit 320 x 240 QVGA 56 92k bit 352 x 288 CIF 64 112k bit 640 x 480 VGA 160 320k bit For example streaming 2 fps of 320 x 240 video requires 112 to 184 kbps kilobits per second Therefore with 128K upload connection you will typically see 3 to 6 frames per second with 176 x 144 resolution and 1 to 2 frames per second with 320 x 240 resolution without audio stream Audio streaming also takes bandwidth around 32 kbps to t Not 64kbps Most ADSL Cable modem upload speeds may not e even reach up to 128 kbps Thus you may not be able to receive any video while streaming audio on a 128 kbps or lower connection Even though the upload speed is more than 128kbps for optimal video performance disabling audio streaming will get better video performance 68 Appendix D Specificat
8. time period between every tour point Sequence 16 points can be assigned Enable Enable camera tour group should be activated To use the camera tour function user must preset some camera D Hint positions first The maximum number of preset points is 16 In the Camera Tour page choose the one tour name from A to E Fill the dwelling time and tour sequence by preset points and then save these setting You can repeat above procedure to set more camera tours 24 Network Screen This screen is displayed configure Network setting such as IP address DHCP DDNS and PPPoE DHCP address Subnet mask Default gateway MAC address Primary DHS Secondary DNS HTTP Port 1 HTTP Part 2 IP Finder DDNS Data Network Screen Network Settings DHCP IP address Subnet mask Default gateway Primary DNS Secondary DNS HTTP Port 1 HTTP Port 2 IP Edit Enable Disable DDN Setting PPPoE Setting SAVE CANCEL Network screen Enable or disable DHCP client in 500 This parameter allows users to setup the IP address assigned by ISP Your ISP should provide all the information requied for Internet access Note User need to reboot the Network Camera to make this setting to take effect Users could assign the port number of http protocol and the WAN users should follow the port number to login User can use IP Edit software program to find Internet Cameras
9. 5 System Requirements 5 uuu m LL C 6 lij Eee 7 CHAPTER 3 ADVANCED VIEWING SETUBD 9 M N 9 Adjusting the Video Imaee 9 Controlling User Access to the Video Stream 12 Making Video available from the Internet 13 CHAPTER 4 WEB BASED MANAGEMENT A 17 Rtn eu TRE 17 Conneetine to ICA 500 u eee 17 Welcome u x 18 WIE WING 19 Control Panel SCEGCH u u u 20 Advanced Configuration 00020200809 a Sa 21 Camera Advanced setting Menu 21 SyS eni Sere u cm 22 Camera SCcEeel uwa uw v
10. 55 2004 3 6 PM 01 51 C Program Flos M C Program Files M 2004 9 6 PM 01 51 59 3004 3 6 01 52 52 CAFrogram Files 2004 3 6 03 04 15 2004 3 6 03 04 PM i Figure 5 6 3 The Video Search Tab 59 5 7 Image Rotation After the button is pressed the display image rotates 180 degree It is used for the camera being installed upside down direction Note video images in recorded video will not be rotated 7 Figure 5 7 5 8 eMap When you press the eMap button on the panel as shown in Figure 5 8 a form will appear to show the eMap function 5 8 5 8 1 eMap Setting Select the File from the menu bar and follow these steps to set up eMap 1 New Layout First create a new layout 2 Load Image Choose an image file to load 3 Save Save all settings The following describes other menu options e Reset Remove all camera icons in this layout e Delete Delete the editing layout e Close Exit eMap Before you select it we recommend you to save the current settings As shown in Figure 5 8 1 and Figure 5 8 2 with the map image in layout you can drag the camera icons into proper positions to deploy your cameras The following describes layout entries Name Define a name for this layout e Position Describe the layout position In the menu bar select Layout to change editing layouts 60 h uesapaga 639009090990 D E VE z FOR T TUN
11. LAN using a domain name rather than an IP address To use DDNS 1 Register for the DDNS service with a supported DDNS service provider You can then apply for and be allocated a Domain Name 2 Enter and save the correct DDNS settings on the DDNS Setting screen in the Network setting menu 3 Operation is then automatic he ICA 500 will then automatically contact the DDNS server whenever it detects that the Internet IP address has changed and inform the DDNS server of the new IP address e Internet users can then connect to your LAN using the Domain Name allocated by the DDNS service provider e Limitation if the ICA 500 is installed with private IP address behind the NAT router please find and enable the DDNS feature on the router This can prevent the remote users not able to connect to the camera e Current supported DDNS service provider www dyndns org www no ip comT DDNS Setting Screen Router Gateway Setup for remote viewing Your Router or Gateway must be configured to pass incoming TCP HTTP connections from remote viewers to the ICA 500 The Router Gateway uses the Port Number to determine which incoming connections are intended for the ICA 500 This feature is normally called Port Forwarding or Virtual Servers in the router The Port Forwarding Virtual Server entry tells the Router Gateway that incoming TCP connections should be passed to the ICA 500 If necessary check the user manual for your Router Gat
12. User s Manual is accurate PLANET disclaims liability for any inaccuracies or omissions that may have occurred Information in this User s Manual is subject to change without notice and does not represent a commitment on the part of PLANET PLANET assumes no responsibility for any inaccuracies that may be contained in this User s Manual PLANET makes no commitment to update or keep current the information in this User s Manual and reserves the right to make improvements to this User s Manual and or to the products described in this User s Manual at any time without notice If you find information in this manual that is incorrect misleading or incomplete we would appreciate your comments and suggestions Trademarks The PLANET logo is a trademark of PLANET Technology This documentation may refer to numerous hardware and software products by their trade names In most if not all cases these designations are claimed as trademarks or registered trademarks by their respective companies Revision User s Manual for PLANET Pan Tilt Internet camera Model ICA 500 Rev 4 0 June 2005 Part No EM ICA500V4 Table of Contents CHAPTER TINIRODUCTION L u u ea eoe eee eon area Deere 1 OVEDVIGW l u o suatu Qa sua de 1 Physical uu yu n Sm S u SS w u 3 C m SSO SSS 4 CHAPTER 2
13. Vu Lr DNE ei 5 Figure 5 8 1 Layout example 1 k II 29292222238 E ca LE EE Figure 5 8 2 Layout example 2 61 When your mouse moves over the camera icon you click the right button to display a menu which has options to set the configuration show the record list record show video and remove the camera icon nexo Eecord List Record show video Remove Camera Figure 5 8 3 62 Appendix Alarm I O Connector Appendix Alarm I O Connector The terminal block is used in applications for e g motion detection event triggering time lapse recording alarm notification via email image storage to FTP locations etc ICA 500 provides a general terminal block with two digital inputs and two outputs for device control Pin 1 and 2 can be connected to an external sensor 1 Pin 2 and 3 can be connected to an external sensor 2 Both of the inputs the voltage will be monitored from the initial state LOW The relay switch of pin 4 5 and 6 can be used to turn on or off the external device The relay switch of pin 7 and pin 8 can be used to turn on or off the external device External Inputs Outputs are working independently Ration o O Alarm Output 2 NO 63 Appendix Troubleshooting Appendi
14. amp P PL mmu Internet Camera ICA 500 User s Manual Copyright Copyright C 2005 PLANET Technology Corp All rights reserved The products and programs described in this User s Manual are licensed products of PLANET Technology This User s Manual contains proprietary information protected by copyright and this User s Manual and all accompanying hardware software and documentation are copyrighted No part of this User s Manual may be copied photocopied reproduced translated or reduced to any electronic medium or machine readable form by any means by electronic or mechanical Including photocopying recording or information storage and retrieval systems for any purpose other than the purchaser s personal use and without the prior express written permission of PLANET Technology Declaration of Conformity This device complies with part 15 of the FCC Rules Operation is subject to the following two conditions 1 This device may not cause harmful interference and 2 This device must accept any interference received including interference that may cause undesired operation Disclaimer PLANET Technology does not warrant that the hardware will work properly in all environments and applications and makes no warranty and representation either implied or expressed with respect to the quality performance merchantability or fitness for a particular purpose PLANET has made every effort to ensure that this
15. be permanently damaged Factory Default Screen This screen is displayed when you click the Factory Default menu on the Status screen Please Click OK button to load default settings to camera Microsoft Internet Explorer gt All configuration will be set to Factory default and system will reboot immediately Trigger amp Capture Trigger This is sending an image or output a trigger to control the alarm output using Trigger section on the main page 39 Execute Trigger Settings FTP Upload a captured image to server Mail Mail captured image to specific mail address Image Memory Save images in attached CF memory card Alarm 1 Enable Alarm output 1 Alarm 2 Enable Alarm output 2 Clear Alarm 1 Clear alarm1 output status Clear Alarm 2 Clear alarm2 output status Capture This screen is displayed when you click the Capture menu and the function can capture current image and save it to storage media The image is saved in the JPEG format Save Picture E Save Pictures E3 CamImg025201 jpg d Sample jpq History Desktop 4 My Documents My Computer File name 3013 My Network P Save as type JPEG Cancel 22 ActiveX Control This feature only supports on the ActiveX control within Microsoft Internet Explorer 40 View Splits Rotate Resolution Quality F F F
16. enter the name and password you assigned XT TL NUI e ernet Camera Web Management User Name admin Login Welcome Screen When you connect the camera Home screen will be displayed E T ag 45 Camera Home Screen The Home screen can be divided into three areas e Viewing Area Images from the ICA 500 e Control Panel Area ICA 500 Camera Manipulation and image quality control e Advanced Configuration area only available for administrator Camera administrator can have full configuration in this menu These options are explained in the following sections 18 Viewinq Area This screen is displayed when you log in machine wn RB TEITET 18 Viewing Area Screen The ICA 500 web page requires ActiveX control to display the video content The ActiveX control must be downloaded from the camera and installed on your PC The security settings on the Internet Explorer must allow the ActiveX plug in to be functional To use the ICA 500 please execute your Internet Explorer and browse to Tools gt Internet Options gt Security Custom Level and change the settings as follows e Download the signed ActiveX controls e Download the unsigned ActiveX controls Initialize and script the ActiveX controls not masked as safe to Prompt After the ActiveX installation completed video content will start playing automatically
17. or edit related parameters on the LAN Disable this option to restrict the modification of related parameters by IP Edit software DDNS Setting The DDNS is designed to solve this problem by allowing users to connect to your LAN using a domain name rather than an IP address 25 DDNS Setting Enable DONS Username Password Domain Name HTTP Proxy Proxy Username Proxy Password SAVE CANCEL BACK DDNS screen DDNS Settings Enable DDNS Enable or disable DDNS function Username Enter the Username Password for your DDNS account Password Domain Name Enter the host name which DDNS service provider assigned HTTP Proxy Enter the parameter which DDNS service provider assigned Proxy Username Proxy Password PPPoE Setting If the ISP demands PPPoE connection for Internet access please select PPPoE as connection type and insert the username password by your ISP to connect you to the Internet 26 1 PPPoE Setting Dial On Power Up Password Send mail after dialed Mail server Username Password ll Check Password Sender email Receiver email gz en Subject SAVE DIAL CANCEL BACK PPPoE screen Please consult your ISP personnel to obtain proper address related information and input carefully If Internet connection cannot be established please check the physical connection or contact the ISP service staff for support informat
18. ring x 1 Screw x 4 Terminator for Alarm I O x 1 Installation software and manual CD x 1 Chapter 2 Basic Setup This Chapter provides details of installing and configuring the ICA 500 System Requirements e Touse the LAN interface a standard 10 100BaseT hub or switch and network cable is required e System Requirement for Viewer amp Recorder System 1 4 cameras surveillance application Hardware CPU Pentium 111 800 MHz or above Memory Size 128 MB 256 MB recommended VGA card resolution 1024 x 768 or above 4 or more cameras surveillance application CPU Pentium 4 1 7G MHz or above Memory Size 512 MB or above VGA card resolution 1024 x 768 or above listed information is minimum system requirements only D Hint Actual requirement will vary depending on the nature of your environment Installation 1 Mount the Camera on the supplied Base and Stand Use 4 screws to fix the ICA 500 onto the ceiling as below You can also put the Network Camera on the table directly ICA 500 Installation 2 Connect the LAN Cable Connect the ICA 500 to a 10 100BaseT hub or switch 3 Connect power adapter Connect the external power supply to the DC power connector attached on the extension cable from the Network Camera Note use the power adapter 12VDC included in the package and connect the other end to wall outlet for AC power RESET MIC 4 Power Up Connect the su
19. should Setup place the program s shortcuts Setup will create the program s shortcuts in the following Start Menu Folder Tc continue click Nest IF pou would to select different lolder click 3rowse PLANETI e Decide whether to create a desktop icon of the program By default just hit the Next button to continue 48 12 Setup CamYiew Select Additional Tasks Which additional tasks should be performed Select the additional tasks you would ike Setup tc perform while installing Cam View then click Acditional icors e Ready to install By default just hit the Install button to start installation 18 Setup CamView Heacy to Install Setup is now ready to begn installing Cam View on your computer Cink Install ta wih the installation or cles Rack Fyni want tn review nr change any settings Destination location C Program Files Start Menu folder PLANET Additional tasks Additional icons Create desktop icon TUN 49 Installing wait for a moment Pease wait while Setup installs CamView on vour computer Lxtracting files C XProgram 1 gif Installation complete Press Finish to launch the program Otherwise uncheck the check box to run the program later 50 JS Setup Completing the CamView Setup Wizard
20. specified camera Note that these modifications are not saved to the persistent storage like HD on the computer If the OK button is pressed all settings on all tabs will be saved and exit the form The following lists descriptions of each setting e IP of the camera Port Connection port of the camera The default is 80 Record Path A directory storing recorded video files Double click the input field or click the button to select the directory Record Number of Frame The maximum number of images in a video file Snapshot Path A directory storing snapshots Double click the input field or click the button to select the directory e Recording at Start the box is checked the program will do recording for the specified camera automatically at the time it is started running 54 List Port Record Path C Program FilesSPLANET wideo ha Qus Record M amber af Frame 12000 Camera 8 Snapshot Path Files PLANE T snapshotc ee a Recording at Start i 13 Camera 14 15 Camera 15 Restore DE Apply Figure 5 3 2 The Camera Tab 5 3 3 Scheduling As shown in Figure 5 3 3 users can schedule recording tasks When you press the Add button the editing task will be added to the schedule item list When the Modify button is pressed the specified task will be updated If the Remove button is pressed the specifi
21. 176x144 320x240 352x288 gt 640x480 Image Recording This screen is displayed when you click the Image Recording menu on the ActiveX control 42 Image Recording Download Save La Frames caveinterval 5 hoo KBytes fio Seconds Save Path i ats ard Settings Adminis Pre Name em Frame Rate 5 Frames 9 Autc Save interval I Seconds haximum Mumber of Frame in Each File jl Save Path Pre Mame Recoding Screen Save as JPEG Select this option and click Save as JPEG for detailed configurations The defined schedule can be set by JPEG Loe 13 18 During the JPGEG file recording a red icon displays on lower right position of the image to indicate the AVI saving process If want stop the recording please press the Stop Image Recording to stop the save as JPEG process 43 Save Select this option click Save as AVI for detailed configurations pre defined schedule be set by ree rary an 12 5 15 18 E 28 01 WLILLP RSS During the AVI file recording a red icon displays on lower right position of the image to indicate the AVI saving process If want stop the recording please press the Stop Image Recording to stop the save as AVI process
22. 4 e You wish to use the DDNS Dynamic DNS feature of the 500 Second HTTP Port Configuration Normally HTTP Web connections use port 80 Since the ICA 500 uses HTTP but port 80 is likely to be used by a Web Server you can use a different port for the ICA 500 This port is called the HTTP Port2 The first port is port 80 The HTTP port2 is disabled in default settings If you prefer to use a different port number than port 80 you can specify the port number on the ICA 500 s Network screen as shown below Network Setting DHCP e on OFF IP address 2 158 0 Subnet mask Default gateway address Primary DNS Secondary DNS HTTP Port 1 HTTP Port 2 DDNS DONS Setting PPPoE PPPoE Setting SAVE CANCEL Network Screen The Network screen is part of the Web based Administration interface See Web based Management for further details on using this interface Viewers need to know this port number order to connect 1 Hint view live Video so the current communication port number has to be informed to the remote users to to DDNS Dynamic 5 Many Internet connections use a Dynamic IP address where the Internet IP address is allocated whenever the Internet connection is established This means that other Internet users don t know the IP address so can t establish a connection DDNS is designed to solve this problem by allowing users to connect to your
23. Due to various network conditions the video display may be a delay of a few seconds while the video stream is buffered 19 Control Panel Screen When you connect the camera control panel screen will be displayed Camera direction Up Down Left Right Home Camera speed adjustment Adjust camera focus Recall Preset Mode Camera Preset Recall positions Frame rate adjustment via image quality Video Resolution Video Brightness adjustment positions Audio feature On Off Clarity Default f E Fluency Camera Control Panel Screen The function on the control panel can be shown below Button Control camera up down left right and home position Irection Camera Speed Increase decrease the camera Pan Tilt speed Recall Preset Preset set up camera fixed locations before operation mode Recall Set camera position to preset location Adjust Video resolution The ICA 500 provides 4 resolutions 640 480 352 288 320x240 176x144 For NTSC camera 320x240 is suitable For PAL camera 352x288 and 176x144 are suitable However all resolution are available for NTSC and PAL Video Resolution camera Preset or Preset or Recall camera 1 16 location s Recall Ex If you press 5 then the camera will move to preset positions location 5 Video Brightness Adjust Camera video brightness 20 Adjust image quality Clarity Video is better but frame rate may be slower Flue
24. Explorer will be invoked to display the snapshot 58 Reco rd L ist ideo List 1 idea Canh trier elect Camera Locatian Alerts At Time s ID 104 5 10 104 s 104 s Il 104_ 5 10 104 5 10 104 s 104_ 5 10 104 5 10 104 26 15 pg 25 156 Jb 312 pg Jb 3 5 pg 26 468 jpg Jb 593 2 3 1 26 203 eo 312 Show Delete 8 25 15 21 8261521 G 2B 15 21 a 26 15 21 826 15 21 s 10 104 8 25 15 21 B zb 15 21 a 26 15 21 a 26 15 21_ 8 26 15 21 a zb 15 21 a 10 104_ 26 33 pg Figure 5 6 2 The Snapshot List Tab 5 6 3 Video Search The video search tab lists video file information about the specified search When you enter the search qualification then hit the Search button you will get the matched video files Select an item hit the Play button Windows Media Player will be opened to play the video It is shown in the following figure Record List rj Veola Video Search Camera P Use for Stat Time 2004 91 ad Hour 0 Wir End Time 2004 9 24 Hour 4 Mir Files 2004 3 6 01 49 21 2004 9 6 PM 01 49 C Program Files 2004 3 6 PM 01 49 52 2004 39 56 PM 01 50 C Program Files 2004 3 6 01 50 24 2004 39 56 PM 01 50 C Program FilesM 2004 3 6 PM 01 a
25. Image Recording Lave Current Picture As Welcome About View This screen is displayed when you click the View menu on the ActiveX control CI ay C lt ss m Bec urea Pete He Wikus Tm Y Bua Eur 11 unm View Settings Resizable Make the image is resizable but Actual size disable the Splits is supported on this mode Actual size Make the image show as the actual size the Splits function does not work on this mode Status Bar A status bar display on the button of the image 41 Split This screen is displayed when you click the Split menu on the ActiveX control The Network Camera provides four setting for Window split it can display different time frame images of the selected Network Camera The time string with green characters is the current displayed image Available Split 1 x 1 Default 2 2 3 3 4x4 lt s 7 IE NIET R IEP rss Image Beccodmq Else Cirmi Pein EZ y FUE PLRNET Rotate amp Quality amp Resolution Rotate An image can be rotated in predefined 180 degree increments Quality Available quality High Default Low Resolution Available resolution
26. PTZ model 5 2 7 Camera Pan Tilt Control Here are five buttons to move the camera to the up down left right and home respectively 5 2 8 Camera Selector and Recording Here are buttons to select cameras and toggle buttons for recording 5 2 9 Alert Message Here is a combo box to show alert messages Ex free space is almost exhausted 5 3 Application Configuration Press the button shown below to configure the application program After the button is pressed a dialog form will show up Users then configure the program by the form as the following sections 5 3 1 Initial Setup Settings Figure 5 3 1 shows settings for the global scope of the application including initialization and environment After all settings are complete press the OK button to save the configuration and exit the form The following lists descriptions of each setting e Viewer Layout Set the initial layout of cameras when starting CamView 53 Application Configuration masamuuauuuuuumuuaunuu ee Camera Viewer Layout 5 Scheduling Application List Figure 5 3 1 The Application Tab 5 3 2 Camera Settings As shown in Figure 5 3 2 users can set parameters of each camera If the Restore button is pressed the current setting modifications of the specified camera will be cleared and restore to the original If the Apply button is pressed the current setting modifications will be applied to the
27. Setting menu option is clicked Time Settings Time Setting Cam Time mt Time B wm tma Date brimi Timo ihme eee Time Screen IP Cam Time PC Time Set Time Date yy mm dd Time hh mm ss Time Zone 1 Hint Provides settings of adjusting the camera s time This is default time value for PC Three options of Synchronize with PC s time User Input NTP are available for your selection to link with the Time Server The default setting is Synchronize the time with PC s time To set the Date Time manually select User Input and system administrator must enter the Date and Time in the respective field manually System administrator must select the time zone for the region Please refer to the appendix for the time zone selection table Please find below NTP server web address for your reference to set the timeserver http www eecis udel edu mills ntp clock1 Atm http www eecis udel edu mills ntp clock2 htm 36 Popup Screen This screen is displayed setting event message while motion or sensors has been activated When any one of alarms enabled and one of them detected then a message window will be displayed on the screen Pop up Setting Pop up text Alarm pop up text Display mode Administrator users Motion detection Pop up Screen Pop up Settings Pop up text Input the warming text Display mode Select display mode for you
28. are experiencing problems try upgrading to the latest version of Microsoft s Internet Explorer from the Microsoft webpage at http www microsoft com windows ie Q Internet Explorer does not seem to work well with the ICA 500 A IP Finder program fails to save the network parameters Don t leave any space in the name field Use underline or dash to replace the space Network may have trouble Confirm the parameters and connections of the 500 Internet Explorer does not seem to work well with the ICA 500 Cannot access the login page and other web pages of ICA 500 from Internet Explorer A Another device or computer is already using Maybe the IP Address of the ICA 500 To confirm this possible problem disconnect the ICA 500 from the network first and then run the PING utility to check it out Maybe due to the network cable Try correcting your network cable and configuration Test the network interface by connecting a local computer to the ICA 500 via a crossover cable Make sure the Internet connection and setting is ok Make sure enter the IP address of Internet Explorer is correct If ICA 500 has a dynamic address it may have changed since you last checked it Network congestion may prevent the web page appearing quickly Wait for a while The IP address and Subnet Mask of the PC and ICA 500 must be in the same class of the private IP address on the LAN Make sure the http port used by the ICA 500 defau
29. ch ICA 500 provides a terminal block with 8 pins of connectors located on the center of the back panel There are 3 pins for two alarm inputs and 5 pins are for alarm output The connectors are physical interface to sense and or activate alarm signals to a variety of external sensors or alarms User can plug a CF memory card into this socket to store the alarm or scheduled images Built in microphone for audio recording The audio recording feature can be disabled in the web configuration The RESET button is used for e Restore Default IP Address Administrator ID and Administrator password e address 192 168 0 20 e Administrator ID admin e Administrator Password null no password Reset steps Power off the Network Camera e Insert the paper clip or other tool and press and hold the button down continuously e Power on the Network Camera again Wait atleast 8 seconds and release the tool Then the Network Camera has been restored to default settings Note Restoring the factory default configurations will lose the existing machine settings User needs to access machine default IP address or use the IP Finder program to search the Network Camera for configuration and operations Package Contents The following items should be included If any of these items are damaged or missing please contact your dealer immediately Planet ICA 500 Pan Tilt Camera x 1 Power adapter x 1 Power cord x 1 Decoration
30. d Password please enter admin as username to continue machine Web Management Internet Camera Web Management User Name admin Login Cancel Or you may execute IPEditV3 to discover edit IP address of ICA 500 Procedures of IPEdit utility e Please find the IPEditV3 exe in the Utility folder on user s manual CD Double click the IPEditV3 exe and the following screen should be prompt on your computer Choose the destination camera for address device name modifications Agar e After modifications you may now connect the camera via web browser Chapter 3 Advanced Viewing Setup This Chapter provides information about the optional settings and features for viewing video via the ICA 500 This Chapter is for Administrators only Introduction After finishing the network setup the ICA 500 can immediately be used by all users on your LAN This chapter describes some additional settings and options for viewing live Video Adjusting the video image e Controlling user access to the live video stream e Making video available from the Internet Adjusting the Video Image If necessary the ICA 500 Administrator can adjust the Video image Settings are provided for Image size Select the desired size The larger sizes require greater bandwidth e Image quality his determines the degree of compression applied to the Video stream Higher quality requires
31. descriptions of each setting Alert Free Percentage Set the percentage of free space you want to designate for alerts e Alert Free Size MB When free space is less than the specfied size it will alert warning messages automatically Message Numbers Set the number of lines which you want to show the alert message in Export Select the item to save the configuration Application Configuration or eMap Import Select the item to load the configuration Application Configuration or eMap e Cycle Recording IF free space is not enough it will delete the oldest recording file 56 Application Configuration IE Application Camera List Alert Frez Persentage Alert Frez Space MB IM Message Numbers 7 Export Configure sexe Import Canfigure seect ne Camera 14 15 Camera 16 Cycle Recording Figure 5 3 4 The Application Tab 5 4 Camera Configuration Users can hit the button shown in Figure 5 4 to configure the specified camera The configuration guide 15 not included in the document Please read the documentation of the camera i Figure 5 4 5 5 Recording There are three methods to start recording The first is to press the toggle button as shown in Figure 5 5 1 to start recording for the camera specified by the selector combo box on the right top side of the panel To stop recording hit the button again The
32. e selected language Set the Encoding or the Character Set of the selected language on the Internet Explorer A The traffic of the network and the object of the image affect the frame rate The network congestion causes frame rate slower than the setting When more than one client were viewing the frame rate becomes slower Ethernet switching hub can smooth the frame rate especially in viewing on the Multi Camera screen A Your connection to the ICA 500 does not have enough bandwidth to support a higher frame rate for the streamed image size Try reducing the video streaming size to 176x144 or 320x240 and or disabling audio Audio will consume 32 to 64 kbps Disable audio to improve video Your Internet connection may not have enough bandwidth to support streaming audio from the ICA 500 A Default Gateway and DNS server address should be set up correctly If FTP does not work properly ask your ISP or network administrator about the transferring mode of FTP server A The lens is dirty or dust is attached Fingerprints dust stain etc on the lens can degrade the performance camera Clean the lens with lens cleaner e Manual focusing may be setup on the external camera to prevent this Blurred images been registered when registering or modifying the preset button or home position button Adjust the focus in manual focusing again The image be out of focus if the object is to
33. ed task will be removed from the list The Apply button is unused for this tab Press OK button will save all settings on all tabs and exit the form The following lists descriptions of each setting e Hour Set the hour of time in 24 hour manner stands for all hours e Minute Set the minute of time stands for all minutes Month Set the month of date stands for all months Day Set the day stands for all days Weekday Set the weekday of a week If no day is specified all weekdays will fit e Duration The duration of the task Set the value in seconds Zero means no limit For example set a recording task which begins at 10 00 every Monday with duration 3600 seconds It is Hour 10 Minute 0 Month Day Weekday Mon Duration 3600 55 Initial Setup Scheduling Application List Hour 0 23 Minute 0 59 Month 1 12 Day 13 week dani Select Curation 2 c IL Add Modify Camera 9 9 Schedule Items Camera 10 Remove 1 Figure 5 3 3 Scheduling Tab 5 3 4 Application Settings Figure 5 3 4 shows settings for the global scope of the application including initialization and environment After all settings are complete press the OK button to save the configuration and exit the form The Apply button is unused for this tab The following lists
34. eway for further details The Port for the Port Forwarding Virtual Server entry above is D Hint the Second Port number specified on the Network screen of the ICA 500 Viewing via the Internet Clients viewers will need a broadband connection dial up connections are NOT recommended Using your Web Browser If using your Web browser you need to know the address of the camera either the Internet IP address or the Domain name and the correct communication port number Enter the address of the ICA 500 and its port number in the Address or Location field of your Browser Example IP address 77203 70 249 5241024 Where the Router Gateway s Internet address is 203 70 212 52 and the HTTP Port2 number on the ICA 500 is 1024 Example Domain Name HTTP 7 1c048500 dynd s org 1024 Where the Router Gateway s Domain name is ica500 dyndns org and the HTTP Port2 number on the ICA 500 is 1024 Using the Windows Viewing Recording Utility If using the CamView Utility the details of the ICA 500 must be entered on the Internet tab of the Add Camera screen Application Configuration d E Apaletan Scheiding Canea Lisi p Camera 2 For 4 Locaban Camara 5 gt Camere Record Fath Camam 7 Record Frene Amim Carnaera amp acid of Fema Camera 3 Camera 10 Snapshot Path Files 11 Camara 12
35. greater bandwidth e Saturation Sharpness Contrast Hue adjustment To Adjust the Video Image 1 Connectto the Web based interface of the ICA 500 2 Administration menu select Image You will see a screen like the example below Camera Setting Size Image Quality lage Coo Mirror Focus Mode Whale Balance Mode Exposure Mode Saturation Shite pares Comrast Hue Reset to Def aiit Camera setting 3 Make the required adjustments as explained below and save your changes Camera Settings Select the desired video resolution The default resolution is set to 320 240 Available resolution 176x144 320x240 352x288 640x480 Select the desired image quality The default Image Quality is set to Standard Image Size Image Quality Available selection Clarity Video is better but frame rate may be slower e Fluency Video is not as good as Clarity but frame rate may be higher e Standard System default value Note Higher image quality requires more bandwidth Saturation Image quality adjustment the parameter ranges from O to 255 Sharpness Contrast Hue Options Enable the check box if you want the time to be displayed on the Video image Camera tour Reset to default If this option is enabled all the settings in this page will be reset to factory default values 10 1 Note Please check the append
36. ion 27 This User setting set up to 10 different usernames and passwords Every one set of username and password can be acted as an Administrator or just a general user User Setting usar 0 Uusarname PasgWword Ailipantiat anne liger 1 User 2 Usor J User 4 L ser User 6 Lisi Lasar f User 0 Ugar 10 User Screen IP Filter Screen The IP filter can set 10 different user s IP address which are allowing enter or disregarding by the Network Camera Please configure User before IP Filter Each User username and password matches with one IP Filter user IP Filter 10 Filter Screen 28 Application Setting Parameters in the Basic configuration menu provide machine adjustment the avallable configurations are listed below Icon Definition FTP Client Setup IVS 100 as a FTP client and configure Server site in order to upload images to server Setup Mail transferring service configuration Setup CF memory card setting or view the pictures stored in CF memory card Setup Alarm Output 1 action via manual or event Setup Alarm Output 2 action via manual or event Schedule Motion Detection to send email or upload images Motion Setup motion detection area and sensor Detection sensitivity Setup the Network Camera time configuration Setup event message while motion or sensors has been act
37. ions Appendix D Specifications Model 0 590 Video drive iris control High Low switchable PAN Horizontal Rotation 0325 Tilt Vertical Rotation 109 9029 1 x 10 100Mbps RJ 45 port Generic port 2 x I O ports one for input and one for output Video interface BNC connector for monitoring Audio interface Built in microphone for audio recording Image Video setting Image compression JPEG 3 levels Video Resolution and Frame 640 x 480 20fps 352 x 288 30fps 320 x 240 Rate 304 176 x 144 305 Image Rotate Rotate 0 Rotate 180 Flip Horizontal Flip Vertical note the recorded video will not be rotated Operating Temperature 5 45 degree C 10 8096 humidity Power Requirement 12V DC EMC EMI CE FCC Network and Configuration Connection type Static IP PPPoE DHCP Web CamView camera utility 6 cO
38. ivated Firmware Product firmware upgrade Upgrade Factory Pre default the Network Camera factory Default default setting 29 FTP Client Screen FTP Client Setting FTP server name User Password Remote path Image file name sufix O None DateTime Sequence number Sequence clear io Motion Detection sensor Periodical sending sensor SAVE CANCEL FTP Client Screen FTP Client Settings FTP server name Username Password Remote path Image file name Suffix Sequence No clear Mode IP address or domain name of the destination FTP server Please input the Username Password for the FTP server Please input the path to the destination Please input the basic file name you want to assign to the images when sending to the FTP server Select the suffix to add to the file name Enable or disable clear sequence number Motion Detection Sensor1 Sensor2 Periodical sending Off Please select send a captured image mode 30 SMTP Screen This screen is displayed when the SMTP menu option is clicked SMTP Simple Mail Transfer Protocol is a protocol for sending e mail messages between servers The mail server address must be filled in this field SMTP Setting SMTP server planetcomtw Username Password Check Password 5955 Sender s Mail Recewer s Mail Box 722798 Subject 4500 motion email
39. ix for more information on the image adjustment Controlling User Access to the Video Stream By default only system administrators can connect to the ICA 500 and view live Video If desired you may apply the access privileges to known users by requiring each user to login to the ICA 500 with their individual username and password To Enable this feature 1 Connect to the Web based interface of the ICA 500 Please check related chapters for details 2 In machine Administration menu select User 3 You may add up to 10 users in machine database choose the user number and enter the name password and access right for each user User ID Username Password Access right Administrator User 1 User 2 User 3 User 4 User 5 User 6 User 7 User 8 User 9 User 10 SAVE CANCEL User Setting Screen Operation e When each user connects they will be prompted for their username and password They must enter the name and password defined on the User screen above e The camera system administrator can have full access system modification privileges the user only has viewing privilege Video available from Internet If your LAN is connected to the Internet typically by a Broadband Gateway Router and Broadband modem you can make the ICA 500 available via the Internet ICA 500 Setup The ICA 500 configuration does NOT have be changed unless e You wish to change the port number from the default value 102
40. lt 80 is forward to the ICA 500 s private IP address The port number assigned in your ICA 500 might not be available via Internet Check your ISP for available port The proxy server may prevent you from connecting directly to 500 set up not to use the proxy server e Confirm that Default Gateway address is correct e The router needs Port Forwarding feature Refer to your router s manual for details Packet Filtering of the router may prohibit access from an external network Refer to your router s manual for details Access ICA 500 from the Internet with the global IP address of the router and port number of ICA 500 e Some routers reject the global IP address to access ICA 500 on the same LAN Access with the private IP address and correct port number of ICA 500 e When you use DDNS you need to set Default Gateway and DNS server address If it s not working after above procedure reset ICA 500 to default setting and installed it again e f the problem is not solved the 500 might be faulty Contact your dealer for further help Q Image or video does not appear in the main page A The first time the PC connects to 500 a pop up Security Warning window will appear to download ActiveX Controls When using Windows NT Windows 2000 or Windows XP log on with an appropriate account that is authorized to install applications Network congestion may prevent the Image screen from appearing quickl
41. nced microcomputer in ICA 500 The high quality of M JPEG files brings vivid images which are suitable for surveillance applications Motion detection is a powerful function enhanced in ICA 500 If a motion is detected in surveillance spot this function will capture images attach them in an email and alert the system administrator via pop up message With bundled camera utility centralized management up to 16 cameras can be fulfilled to save TOC for enterprise users ICA 500 IVS 100 applications Features e capability ICA 500 is able to perform PAN 0 325 and tilt 109 909 adjustment which brings more convenience and flexibility in network deployment Ease of use Plug N Watch capability to simplify system integration in an existing network environment Meeting SOHO business or public facilities surveillance needs ICA 500 can be deployed in many different situations such as library train station or factory production line to provide efficient human resource reducing and offers flexibility affordability and reliability for the proper surveillance of manufacturing facilities Multi Platform support Supporting TCP IP networking SMTP e mail and HTTP public network standards ICA 500 can be applied and utilized to a mixed IP network environment Motion Detection This feature will send you alert message when motion is detected The ICA 500 will compare consecutive frames to detect changes cau
42. ncy Video is not as good as Clarity but frame rate may be higher Standard System default value Image quality Frame rate adjustment directly Adjust video frame rate via giving a number directly 1 5 10 15 20 25 30 Turn on off audio output function Note The Microphone is located on the rear panel You AUTO ONON need to position the MIC hole face to the audio source to have better audio quality Advanced Configuration Area The Advanced Configuration menu offers more features and camera control privileges to meet various application demands Advanced Configuration Screen The ICA 500 Advanced Configuration page divided into three sub menus e Camera Advanced Setting e Camera Trigger Setting e Screen capture Setting Respective menu descriptions are illustrated in the following sections Camera Advanced setting Menu Clicking on Setting on the menu provides privileges to all the settings for the ICA 500 The Advanced Setting menu is divided into 2 categories Basic and Application settings The Basic menu provides essential configurations of the ICA 500 and the Application menu is provided for various applications Basic Setting Parameters in the Basic configuration menu provide machine adjustment the available configurations are listed below Define Frame Rate Turn on off Remote System camera control and view system log file 21 Adjust camera parameters set camera Camera
43. o near or depending on the zoom position Move the object off ICA 500 or adjust the zoom position e Some objects are difficult to focus on by the camera When the objects are still out of focus adjust the focus using manual focusing or change the objects using Pan Tilt operation A To insure the images you are viewing are the best they can be set the Display property setting color quality to 16bit at least and 24 bit or higher if possible within your computer The configuration on the ICA 500 image display is incorrect You need to adjust the image related parameters such as brightness contrast hue and saturation properly Q Image flickers Wrong power line frequency makes images flicker Make sure the NTSC or PAL format of your ICA 500 If the object is dark the image will flicker Make the condition around the ICA 500 brighter A The video images might be noisy if the ICA 500 is located in a very low light environment Make the condition around the ICA 500 brighter A If you just want to reboot system without change anything Go to Network page and click SAVE button directly then system will reboot again A Have installed Microsoft s DirectX 9 0 or later and use the Windows Media Player 9 or later to play the AVI filed recorded by the ActiveX Appendix Bandwidth Calculation Appendix C Bandwidth Calculation The fame rate of video transmitted from the ICA 500 depends on connection
44. pplied power adapter to the 500 and power up Use only the power adapter provided Using a different one may cause hardware damage 5 Check the LEDs e When powering on machine the status LED will turn green It means the system is booting up successfully Furthermore if you have a proper network connection and access to the ICA 500 the 10 100M LAN LED will flash orange Initial setup can be performed either from the web browser or using the supplied Windows based camera utilities This program can locate the ICA 500 even if its IP address is invalid for your network You can then configure the 500 with appropriate TCP IP settings for your LAN Subsequent administration can be performed with your Web browser as explained in Chapter 3 Web based Administration Setup Procedure Before setup operations The ICA 500 provides GUI Web based Graphical User Interface for machine management and maintenance To start 500 web configuration the requirement of the web browser should be Microsoft Internet Explorer 6 0 or higher with Java support 1 Note Current firmware supports Microsoft Internet Explorer the Netscape Navigator support is planned in the future firmware release Default LAN interface IP address of ICA 500 is 192 168 0 20 You may now open your web browser and insert http 192 168 0 20 in the address bar of your web browser to logon ICA 500 web configuration page ICA 500 will prompt for User Name an
45. r Sensor 1 Enable or disable the display of a text string in the video image Sensor 2 Type the text string that you want to display in the adjacent field Motion detection 37 This screen is displayed when you click the Firmware Upgrade menu on the Status screen Firmware Upgrade Firmware Version 2 0 6 Firmware Upgrade Screen This screen allows you upgrade the Firmware software in your ICA 500 Before using this screen your must download the upgrade file to your PC Then follow this procedure 1 Click the Browse button and locate the upgrade file 2 Select this file and click OK The filename will then appear in the Upgrade File field 3 Click the Start Upgrade button to transfer the file to the ICA 500 and start the upgrade procedure Firmware Upgrade Click to begin to Update firmware Click to ignore and delete the file uploaded just now 4 Click the here button to begin to upgrade firmware Firmware Upgrade 5 Click the OK button to continue 38 Firmware Uperade Click to begin to update firmware to ignore and delete the file uploaded just now TANNE Witting Progress 7845 6 The upgrade progress status information will be displayed on the screen Once the upgrading process completed the Network Camera will reboot the system automatically 4 Do not interrupt the upgrading procedure during proceeding or D Hint the inner component might
46. r further help Q The Network Camera will be installed and work if a firewall exists on the network If a firewall exists on the network port 80 is open for ordinary data communication The Network Camera uses port 80 default only This port or the port you specify from the Configuration screen if you change the default port needs to be opened on the firewall Q The username and password for the first time or after factory default reset A Username admin and leave password blank Note that it s all case sensitivity Q Forgot the username and password A Follow the steps below RHestore the factory default setting by press pressing and holding down more than 8 seconds when power on Network Camera Reconfigure the Network Camera A Check IP address of Network Camera by using the IP Finder ipeditv3 program Re power the ICA 500 if cannot find the unit within 1 minute Do not connect ICA 500 over a router IP Finder program cannot detect ICA 500 e If IP address is not assigned to the PC which running IP Finder program then IP Finder program cannot find ICA 500 Make sure that IP address is assigned to the PC properly Antivirus software on the PC might interfere with the setup program Disable the firewall of the antivirus software during setting up ICA 500 Q Internet Explorer does not seem to work well with the ICA 500 A Make sure that your Internet Explorer is version 6 0 or later If you
47. rm 1 amp Alarm 2 Screen This screen is displayed when the Alarm 1 Alarm 2 menu option is clicked You can select Manual or Event for the Alarm mode Duration Alarm1 Screen Alarm out 1 seconds i 0 866400 0 means static Motion Detection Manual LA sensor sensor DAW CAMCEL Schedule Screen The Schedule can enable motion detection in an arranged period in order to avoid unnecessary images transmitting and catch the desired images r Schedule T n 1 foo 4 BUM _ 2 PE LIE NUN O Li a H m ii k d BUT PH MIT Schedule Setting Schedule Setting Screen 34 Motion Detection Screen This screen is displayed when the Motion Detection menu option is clicked You can Enable Disable function and adjust the sensitivity level Motion Detection ipnabie Motion Detection yrs Motion Detection Screen Motion Detection Settings Enable Motion Enable or disable Motion Detection function in ICA 500 Detection Sensitivity Select the desired option to suit your environment If covering large area you usually need higher sensitivity since a moving object will take only a small portion of the image Area Use the adjust the determine which areas of the image are examined for motion 35 Time Setting Screen This screen is displayed when the Time
48. se check the available network upload bandwidth and carefully select the proper video resolution Video display quality selection in ICA 500 Clarity Video is better but frame rate may be slower e Fluency Video is not as good as Clarity but higher frame rate Standard System default value Note The value on the list box displays the current setting all the modifications will not take effects until it is saved in this menu Image Quality Image Rotate Mirror Focus Mode White Balance These functions are reserved for future product developing They are not functional in ICA 500 23 Saturation Sharpness Contrast Hue Key in respective value for image adjustment It is not required to adjust this value when the image is vivid Camera Tour To use the camera tour function user must preset some camera positions first Select the SET Tour button to enter the Camera Tour setting page Reset to Restore the values of these pages to factory default value Default Camera Tour In the Camera Tour page choose the one tour name Fill the dwelling time and tour sequence by preset points can repeat above procedure to set more camera tours lour narma Dwelling tire tehe fe ie fe ie i Data Camera Tour Screen Camera Tour Settings Tour Name Choose the one tour name from A to E Dwelling Time
49. second method is to use buttons described in section 5 2 8 You may select a camera by hitting the button with camera number as shown in Figure 5 5 2 and then press the corresponding button at the second line to record The button is shown as in Figure 5 5 3 After hitting the button it will light up as shown in Figure 5 5 4 to indicate the specified camera is recording To stop recording is similar to the previous steps press the lighten up button can stop the video recording The last method to record video is done by scheduling Please setup the schedule recording tasks as described in section 5 3 3 When the time is up the program will start to record 57 Figure 5 5 1 Figure 5 5 2 Figure 5 5 Figure 5 5 3 4 5 6 Playback When you press the Playback button on the panel as shown in Figure 5 6 a form will appear to show the list of video records and snapshots Figure 5 6 5 6 1 Video List The video list tab lists video records and displays the information about the specified record When you hit the Play button the Windows Media Player will start to play the video The Video list is shown in the following figure E Video Search Camera gt Location Ales Start Time Duration Figure 5 6 1 The Video List Tab 5 6 2 Snapshot List The snapshot list tab lists snapshots and displays the information about the specified snapshot When you hit the Show button Internet
50. sed by the movement of large objects Audio Support With built in microphone the voice around can be recorded with live image Internet Features User definable administration port number This allows Internet Gateways to use port mapping so the ICA 500 a and a Web Server can share the same Internet IP address DDNS Support In order to view video over Internet user must know the Internet IP address of the gateway used by ICA 500 An easy to remember DDNS Dynamic DNS name will help you memorize your site more easily NTP Network Time Protocol Support NTP allows the 500 to calibrate its internal clock from an Internet Time Server This ensures that the time stamp on the recorded video from the ICA 500 will be correct Security Features User Authentication If desired the camera access can be restricted to known users Users will have to enter their username and password before being able to view the video stream Up to 10 users can be entered IP filter The camera access not only can be restricted by username password but also can be limited by the IP range to bring users more security Physical Details i Rear Panel LAN port Alarm I O Connector CF SLOT MIC Reset Button RESET MIC F5 Fo 4078 12 3 4 5 6 7 B CF Slot STATUS ALARM LO ICA 500 Rear Panel Use a standard LAN cable to connect your ICA 500 to a 10 100BaseT hub or swit
51. t button to continue 46 18 Setup CamYiew License Agreement Please read the following important information before continuing Please read the following License Agreement vou must sccept the terns of this agreement before continuing with the installation LICENSE ABREZMENT read the lollawing terms of this agreement carefull Software here means IE includes the program and any associated materials inc uding but nct limited ta saflware components documentation maces audio and data Files The Software protected by Copyright Law and International Treaties Pou may install one copy of the Software onto ane computer IF you want to install the Software anta more than one computer M CO Llu accept it lt Back Cancel e Decide which directory to install the software By default just hit the Next button to continue is Setup CamView Selecl Destination Location Where should Camview be installed Lo W Setup will install ies into the Folder continue click IF pou would like to select a different folder click Browse C 4 rogram Files PLANET Al least 5 4 MB disk space is required lt Back Cancel 47 e Decide the program group name By default just hit the Next button to continue 12 Setup CamYiew Select Start Menu Folder Were
52. tour Configure Network setting such as DHCP On Off DDNS and PPPoE Setup user name password and login privilege Setup legal IP address of user login This IP Filter function should be used with function User respectively After entering machine Home screen click on the System menu you will see a screen like the example below System ID Camera Name Default frame rate BE Remote camera control N OFF g phy CANCEL System Screen Data System Screen System Settings Serial Number Product serial number Camera Name This displays the name for the ICA 500 camera name is useful while multiple unit installation Default frame The default frame rate in ICA 500 is 30fps the video frame rate rate can be adjusted in this menu or on the Control panel menu Remote Enable or disable remote control feature in 500 camera control Log Administrator can check the log information in machine including the Main Info Appended Info Operator IP Operator MAC and Time Select the View button to check the log file 22 Camera Screen This screen is displayed when the Camera menu option is clicked Note please adjust carefully to have proper machine configurations Camera Setting Camera Screen Data Camera Screen Camera Settings Display resolution selection supported resolution 500 176x144 352 288 320x240 640x480 Image Size Plea
53. tting menu it means this Internet Camera does not support CF memory card function Image Memory Settings Image Memory Choose Enable to activate the CF memory card function or choose Disable button to stop this function Note Please disable this function when remove the CF memory card otherwise the CF memory card may be damaged and all image files are lost File Name The recording filename can be based on either date time or sequence number Overwrite Choose On to overwrite the files in the oldest day or choose OFF to stop recording while the attached CF memory card is full Capacity While the attached CF memory card is full this device can send Warming an email for warning Mode send a captured image via motion detection sensor or periodically Free Space Show the available space of the attached CF memory card Memory View or delete the image files stored in the CF memory card Content 32 Note We strongly suggest using SanDisk CF memory card to avoid compatible issue with this device Because this device does not support plug and play function yet Therefore while you want to plug a CF memory card into slot please make sure power off the device first then plug this CF memory card When you want to remove this CF memory card from device make sure click the disable button first then remove CF memory card Otherwise this memory card may be damaged and all image files are lost 33 Ala
54. x B Troubleshootino Q The video and audio codec is adopted in the Network Camera A The Network Camera utilizes JPEG compression to providing high quality images JPEG is a standard for image compression and can be applied to various web browsers without the need to install extra software The audio codec is ADPCM compression Q The maximum number of users access Network Camera simultaneously A The maximum number users is depending on the total bandwidth accessed to Network Camera from clients The data throughout of Network Camera is around 5 6Mbps Therefore the maximum number of connected clients is varying by settings of resolution and frame rate Obviously the performance of the each connected client will slow down when many users are logged on Q The Network Camera can be used outdoors or not The Network Camera is not weatherproof It needs to be equipped with a weatherproof case for outdoors using However equipped with a weatherproof case will disable the audio function of Network Camera Q The network cabling is required for the Network Camera A The Network Camera uses Category 5 UTP cable allowing 10 and or 100 Base T networking Q Why doe the Status LED not light up A Check and confirm that the standard AC adaptor included in packaged is used Secure the power connector and re powers it on again e f the problem is not solved the Network Camera might be faulty Contact your dealer fo
55. y You may choose lower resolution to reduce the required bandwidth Go to CAWindowsW Downloaded Program Files and check to see if there is an entry for the file WebWatch Class The status column should show Installed If the file is not listed make sure your Security Settings in Internet Explorer are configured properly and then try reloading the ICA 500 s home page Most likely the ICA 500 ActiveX control did not download and install correctly Check your Internet Explorer security settings and then close and restart Internet Explorer Try to browse and log in again A Internet Explorer displays the following message Your current security settings prohibit downloading ActiveX controls Setup the IE security settings or configure the individual settings to allow downloading and scripting of unsigned ActiveX controls Q The ICA 500 works in local network but not accessible from remote network A This might be caused from the firewall protection Check the Internet firewall with your system or network administrator The firewall may need to have some settings changed in order for the ICA 500 to be accessible outside your LAN Make sure that the ICA 500 isn t conflicting with any other web server running on your LAN Check the configuration of the router settings allow the ICA 500 to be accessed outside your local LAN Q There are unreadable characters displayed in machine configuration pages A Use the operating system of th
Download Pdf Manuals
Related Search